| Basic Information | |
|---|---|
| Family ID | F062848 |
| Family Type | Metagenome |
| Number of Sequences | 130 |
| Average Sequence Length | 39 residues |
| Representative Sequence | MWNLTSFSLEIVLVSVQDRCTVCAKRTIGSEIILDAPF |
| Number of Associated Samples | 65 |
| Number of Associated Scaffolds | 130 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 60.00 % |
| % of genes near scaffold ends (potentially truncated) | 6.15 % |
| % of genes from short scaffolds (< 2000 bps) | 7.69 % |
| Associated GOLD sequencing projects | 64 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.36 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (100.000 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Miscanthus Phyllosphere (88.462 % of family members) |
| Environment Ontology (ENVO) | Unclassified (89.231 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant surface (89.231 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 50.00% β-sheet: 0.00% Coil/Unstructured: 50.00% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.36 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 100.00 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300005338|Ga0068868_100509076 | Not Available | 1055 | Open in IMG/M |
| 3300005718|Ga0068866_10675771 | Not Available | 706 | Open in IMG/M |
| 3300015299|Ga0182107_1027151 | Not Available | 750 | Open in IMG/M |
| 3300015300|Ga0182108_1103675 | Not Available | 507 | Open in IMG/M |
| 3300015342|Ga0182109_1196310 | Not Available | 528 | Open in IMG/M |
| 3300015355|Ga0182159_1174744 | Not Available | 681 | Open in IMG/M |
| 3300015361|Ga0182145_1094978 | Not Available | 640 | Open in IMG/M |
| 3300017404|Ga0182203_1027670 | Not Available | 878 | Open in IMG/M |
| 3300017424|Ga0182219_1003712 | Not Available | 1764 | Open in IMG/M |
| 3300017443|Ga0182193_1170700 | Not Available | 529 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Miscanthus Phyllosphere | Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Miscanthus Phyllosphere | 88.46% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 6.15% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 2.31% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.54% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.77% |
| Phyllosphere | Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Phyllosphere | 0.77% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Host-Associated | Open in IMG/M |
| 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Host-Associated | Open in IMG/M |
| 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Host-Associated | Open in IMG/M |
| 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) | Host-Associated | Open in IMG/M |
| 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Host-Associated | Open in IMG/M |
| 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Host-Associated | Open in IMG/M |
| 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Host-Associated | Open in IMG/M |
| 3300015268 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015269 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015274 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015276 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015279 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015281 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015282 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015286 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015288 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015289 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015292 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015294 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015295 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015296 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015298 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015299 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015300 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015303 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015304 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015307 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015308 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015322 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015323 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015341 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015342 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015343 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015344 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015345 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015346 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015347 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015351 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015355 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015361 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017404 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017407 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017409 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017410 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017411 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017413 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017415 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017417 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_07NOV2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017420 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_07NOV2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017424 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017425 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017427 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017438 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017442 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017443 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017680 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_07NOV2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017683 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017684 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017685 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_07NOV2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017686 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017690 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300021060 | Phyllosphere microbial comminities from miscanthus, Michigan, USA - G6R3_NF_07NOV2016_LD2 MG | Host-Associated | Open in IMG/M |
| 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| Ga0068868_1005090762 | 3300005338 | Miscanthus Rhizosphere | VTWVMWDLTSFSLETVLVSVQDRSTVCAKRTIGSEIILDAPDGTPR* |
| Ga0068868_1013539451 | 3300005338 | Miscanthus Rhizosphere | VTWVVWNLVLVHLEVVLASVEDRCTVCTNCTIGSEIILDA |
| Ga0068866_106757711 | 3300005718 | Miscanthus Rhizosphere | MTWVMLNLVLIRLETVLVSVQDRCTVCAKHTIGSEIILDAPD |
| Ga0068866_114339272 | 3300005718 | Miscanthus Rhizosphere | MWNLVLVRLETVLVSVQDRCTVCTKCTIGSEIILNAP |
| Ga0068870_101792451 | 3300005840 | Miscanthus Rhizosphere | MWNLTYFSLEIVLVSVQDWCTVSAKRTIDSEIILDAPNGTPR* |
| Ga0068870_111567121 | 3300005840 | Miscanthus Rhizosphere | MWDLTSFSLETVSVLVQDRCTVCAKRTIGSEIFLDTPDIT |
| Ga0097621_1020731061 | 3300006237 | Miscanthus Rhizosphere | MTWVMLNLVLIRLETVLVSVQDRCTVCAKHTIGSEIILDA |
| Ga0068865_1006327531 | 3300006881 | Miscanthus Rhizosphere | MWNLTSFSLEIVLVSVQDRCTVCAKRTIGSEIILDAPF |
| Ga0105244_102530481 | 3300009036 | Miscanthus Rhizosphere | MWNLFSVHLEAVLVSVQDRCTICAECTIGSEIILDAPN |
| Ga0105244_103167461 | 3300009036 | Miscanthus Rhizosphere | MWNLVSVRLEKVLVSVQDRCTVCTKCIIGSKIFSDAPDG |
| Ga0105245_129488081 | 3300009098 | Miscanthus Rhizosphere | VTWVIWNLVSVRLQTVLVSVQDRCTVCAKCTKGIEIISDAP |
| Ga0157378_124326311 | 3300013297 | Miscanthus Rhizosphere | MWNLSSFSLEIVLVSVQDRCTVCAKRTIDSEIILD |
| Ga0157377_110736911 | 3300014745 | Miscanthus Rhizosphere | MWNLTSFSLEIVLVSVQDRCTVCAKRTIGLEIVWDAPDGTP |
| Ga0182154_10605181 | 3300015268 | Miscanthus Phyllosphere | MWNLVLVCLEIGLVLVQDRCTVCAKRTIGSEIALEAPDG |
| Ga0182154_10741081 | 3300015268 | Miscanthus Phyllosphere | VTWVRWNLVLVHLETVLVSVQDRYTVCTKCTLDSEI |
| Ga0182113_10952851 | 3300015269 | Miscanthus Phyllosphere | KFVLVLFEIVLILKQDRSTVCTERTIGLKIISDAPDGTPR* |
| Ga0182188_10059101 | 3300015274 | Miscanthus Phyllosphere | VTWDMWNLVSVRLETVLVSVQDRCTVCTERTTGSGV |
| Ga0182188_10353011 | 3300015274 | Miscanthus Phyllosphere | MWNLTYFSLERVLVSVQDRCMVCAKHTIDSEIILDEPDGTTR* |
| Ga0182188_10466471 | 3300015274 | Miscanthus Phyllosphere | MWNLLSVRLETVLVSVQDRCMVCAKCTIGSEIILD |
| Ga0182170_10330372 | 3300015276 | Miscanthus Phyllosphere | MWNLTSFSLETVLVSVPDRCAVCAKRTIGSEIILNALYGT |
| Ga0182174_10173122 | 3300015279 | Miscanthus Phyllosphere | WNLTSFSLETVLVSVPDRCAVCAKRTIGLEIVLNGLYGTTR* |
| Ga0182160_10712552 | 3300015281 | Miscanthus Phyllosphere | VTGVKWNLLSVHLETVLVSVQDRCTVCAKCTIGSEIVSDAPDG |
| Ga0182124_10194471 | 3300015282 | Miscanthus Phyllosphere | MWNLVLVHLETVLVSVQDRCTVCAKHTIGSKIVLD |
| Ga0182124_10328321 | 3300015282 | Miscanthus Phyllosphere | MWNLVLFRSETVLVSVQDRCTVCAKRTIGSEIILDAPDG |
| Ga0182176_10436291 | 3300015286 | Miscanthus Phyllosphere | SFSLEIVLVSVQDRCTVCAKRTIDSEIILDEPDSTTR* |
| Ga0182176_10492741 | 3300015286 | Miscanthus Phyllosphere | MWNLVSVRLEIVFVWVQDRCTVCTKHAIGSEIILDA |
| Ga0182173_10521061 | 3300015288 | Miscanthus Phyllosphere | MWDLTSFSSETVLLSVQDRSTVCAKRTIGSEIILDAPDGTP |
| Ga0182138_10453511 | 3300015289 | Miscanthus Phyllosphere | LEIVLVSVQDRCTVCAKRTIDSEIILDEPDSTTR* |
| Ga0182138_10711421 | 3300015289 | Miscanthus Phyllosphere | MWNVTYFSLEIVLVLVQDRCTVSAKRTIDLEIILD |
| Ga0182141_10195101 | 3300015292 | Miscanthus Phyllosphere | MWNLDLVRLETVLVSVQDRCTVCTKRTIGSEIVLDTPNGTSR |
| Ga0182141_10207911 | 3300015292 | Miscanthus Phyllosphere | WNLVLVRLETVLVSVQDRCTVCTKCTVGSEIILDAPNGTPR* |
| Ga0182141_10562001 | 3300015292 | Miscanthus Phyllosphere | MWNFNSVCLKTVLVSVQDRCTVCAKRTIGSEIVLDTPD |
| Ga0182126_10928141 | 3300015294 | Miscanthus Phyllosphere | MWNIVSVRLETVLVSVQDRCTVCAKRTISSEFILD |
| Ga0182175_10017991 | 3300015295 | Miscanthus Phyllosphere | MWNLSSFSLEIVLVSVQDRCTVCAKRTIDSEIILDEP |
| Ga0182157_10535491 | 3300015296 | Miscanthus Phyllosphere | MWNLLSVRLETVLVSVQDRCMVCTKCIIGSKSFQTHP |
| Ga0182106_10759991 | 3300015298 | Miscanthus Phyllosphere | MWNLTSFALEIVLVSVQDRCTVCAKRTIGLEIVWDAPD |
| Ga0182106_10983291 | 3300015298 | Miscanthus Phyllosphere | VTWVRWNLVLVRLETVLVSVQDRCTVCTKCTIGSEIILDAPDGTP |
| Ga0182106_11027791 | 3300015298 | Miscanthus Phyllosphere | MMWVKWNLTSFHLETVLVSVQDRCTVCAKRTIGSEIILDAPD |
| Ga0182107_10271512 | 3300015299 | Miscanthus Phyllosphere | WVMWNLTSFSLETVLVSVLDRCAVCAKHTIGSEIILNALDGTTR* |
| Ga0182107_10697291 | 3300015299 | Miscanthus Phyllosphere | MWNVVPVRLETVLVLVQGRCTVCTKCIIGSKIISDTPD |
| Ga0182108_10553661 | 3300015300 | Miscanthus Phyllosphere | MWNLTSFHLEIVLGSVQDRCTVCAKRTIGSEIILDAPDRTTR |
| Ga0182108_11036751 | 3300015300 | Miscanthus Phyllosphere | LVIVFVSGQDRCTVCAKRTIDSEIILDAPDRTTR* |
| Ga0182123_10457641 | 3300015303 | Miscanthus Phyllosphere | MWVMWNLTSFSLEIVLVSVQDRCTVCAKRTIGLEIV |
| Ga0182112_10686471 | 3300015304 | Miscanthus Phyllosphere | VMWDLTSFSLETVSVLVQDRFMVYARRTIGLEIILDAPDGTPR* |
| Ga0182112_10871532 | 3300015304 | Miscanthus Phyllosphere | MWDLTSFLVETVLVSVQDSCTVCAKCTIRSEIILDAPD |
| Ga0182144_10087431 | 3300015307 | Miscanthus Phyllosphere | MWNLDSVHLETVLVSVQDRCTVCTKRTIGSEIILDT |
| Ga0182144_10272311 | 3300015307 | Miscanthus Phyllosphere | VTWVRWNLVLVRLETVLVSVQDRCTVCTKCIVGSEIVLDAPDA |
| Ga0182144_10728871 | 3300015307 | Miscanthus Phyllosphere | MWVMWNFTSFYLEIVLVSVQDRCTVCAKRTIGLEIVWDAPDYTHR |
| Ga0182142_10174531 | 3300015308 | Miscanthus Phyllosphere | VTWVVWNLISVRVETVLVSVQDRCTVCTKRTIGSEIALD |
| Ga0182142_11002711 | 3300015308 | Miscanthus Phyllosphere | MWNVDSVRLEAVLVSVQDRCTVCAKRTIGSETFWTH |
| Ga0182110_10015341 | 3300015322 | Miscanthus Phyllosphere | MWNLSSFSLEIVLVSVQDRCTVCAKRTIDSEIILDEPDSTTR* |
| Ga0182110_10916181 | 3300015322 | Miscanthus Phyllosphere | VTWVRWNLVLLRLETVLVSVQDRCTVCTKCTIGSEIVLDAPDG |
| Ga0182129_11037822 | 3300015323 | Miscanthus Phyllosphere | MWNLTSFSLETVSVLVQDRCMVCAKRTIGSEIFLDKPD |
| Ga0182187_10379031 | 3300015341 | Miscanthus Phyllosphere | MWNLTSFSLETLLLSVQDRCTVCAKRTIGSEIVLDAPDGTTRY |
| Ga0182187_11493561 | 3300015341 | Miscanthus Phyllosphere | MWNLTYFLLEIVLVSVQDRCTVCAKRTIDSEIILDALDGTTR* |
| Ga0182187_11525782 | 3300015341 | Miscanthus Phyllosphere | MWNLTSLSVEIVLVSVQDRCTVSAKRTIDSDIILD |
| Ga0182187_11828771 | 3300015341 | Miscanthus Phyllosphere | MWNLISICLEIVLVSVQDRCTVCAKRTIGSEIILDATD |
| Ga0182109_10905861 | 3300015342 | Miscanthus Phyllosphere | MWVLWNLNSVRLETVLVSVQDRCTVCAKRTIGSETILDS |
| Ga0182109_11963102 | 3300015342 | Miscanthus Phyllosphere | WAMWNLVSVRLEIVFVWVQDRCTVCTKHAIGSEIILDALDGTPR* |
| Ga0182155_11776401 | 3300015343 | Miscanthus Phyllosphere | VTRVMWNVCSFHLEVVLASVQDRCMVCTRHTIGSEIVLV |
| Ga0182155_11891021 | 3300015343 | Miscanthus Phyllosphere | MWNLLSVRLEIVLVSVQDRCTVCAKCTIGSEIVLDAPDGT |
| Ga0182189_11781941 | 3300015344 | Miscanthus Phyllosphere | VTWVKWNLLSVCLEIVLVSVQDRCTVCAKCTIGSEIVSDAPDG |
| Ga0182189_12061651 | 3300015344 | Miscanthus Phyllosphere | MWDLISFSLEIVLASVQDRCTVCAKRTIGSEIILDAP |
| Ga0182189_12224901 | 3300015344 | Miscanthus Phyllosphere | MWNLTYFSLEIVLVSVQDRCTVCAKRTIDSEIILDALDVTTR* |
| Ga0182111_10095991 | 3300015345 | Miscanthus Phyllosphere | MWNLVLVRVETVLVSVQDRCTVCTKRTIGSEIALDAS |
| Ga0182111_11731891 | 3300015345 | Miscanthus Phyllosphere | VTWIKLKLVLVRLEIVLILVQNRCTVCAKHTIGSAI |
| Ga0182111_12188581 | 3300015345 | Miscanthus Phyllosphere | GDVGHVDLTSFSLEIVLVSVHDRCTVCANCTIGLEIILDAHDCTPR* |
| Ga0182139_10573161 | 3300015346 | Miscanthus Phyllosphere | MTWVMLNLVLIRLETVLVSVQDRCTVCAKHTIGSEI |
| Ga0182139_11218861 | 3300015346 | Miscanthus Phyllosphere | MWNLISVRLEIVLVSVQDRCTVCTKHTIGLEIILDA |
| Ga0182139_11679832 | 3300015346 | Miscanthus Phyllosphere | MWNLISLSLEIVLVSVQDRCTVSAKRTIDSDIILD |
| Ga0182139_11885021 | 3300015346 | Miscanthus Phyllosphere | VTWVGWNLVLVRLETVLVSVQDRCTVCTKCIVGSEIVLDAPDATLR* |
| Ga0182139_12170401 | 3300015346 | Miscanthus Phyllosphere | VTWVRWNLVLVHLEMVLVSVQDRCTVCTKCTIGSEIVLD |
| Ga0182139_12355492 | 3300015346 | Miscanthus Phyllosphere | WVMWDLTSFSLETVLVLVQDRSTVCAKRTIALGIAYDAPDGTPR* |
| Ga0182177_11352181 | 3300015347 | Miscanthus Phyllosphere | MWNLDSVRLETVLVSVQDRCTVCTKRTIGSEIILD |
| Ga0182177_12204651 | 3300015347 | Miscanthus Phyllosphere | MWSRVSVRLETVLVSVQDRCTVCAKRSISSEIVLDA |
| Ga0182161_11735331 | 3300015351 | Miscanthus Phyllosphere | MWNLTSFSLDILLVSVQDRCTVYAKRTIGSEIILDA |
| Ga0182161_11774931 | 3300015351 | Miscanthus Phyllosphere | MWVTWNLTSFSLEIVLVSVQDRCTVCAKRTIGLEI |
| Ga0182161_12094001 | 3300015351 | Miscanthus Phyllosphere | MWNLAFICLEMVLASVQDRCTVSAKCTIGSEILLDAPDGTPRQCG |
| Ga0182161_12148551 | 3300015351 | Miscanthus Phyllosphere | VTWVMWDLTSFSLETVLVSVQDRSTVCAKRTIGSEIGLDAPVGTPR* |
| Ga0182159_11471771 | 3300015355 | Miscanthus Phyllosphere | SFSLEIVLVSVQDRCTVCANRTIDSEIILDAPDGTPR* |
| Ga0182159_11747442 | 3300015355 | Miscanthus Phyllosphere | MVTWVMWNLTPFSLDIVLVSVQDRCTVCAKCTIGSEIILDAPVGTP |
| Ga0182159_12224782 | 3300015355 | Miscanthus Phyllosphere | LEIVLVLVQDRCTVCAKRTIDSEIILDAPDGTTR* |
| Ga0182159_12361201 | 3300015355 | Miscanthus Phyllosphere | NLTYFSLEIVLVSVQDRCTVSAKRTIDSEIILDALDVTTR* |
| Ga0182145_10528291 | 3300015361 | Miscanthus Phyllosphere | WNLTSFSLEIVLVSVQDRCTVCAKRTIDSEIILDAPDGTTR* |
| Ga0182145_10880011 | 3300015361 | Miscanthus Phyllosphere | MWNLTSLSLEIVLVLVQDRCTVSAKRTIVSDIILDAPDG |
| Ga0182145_10949781 | 3300015361 | Miscanthus Phyllosphere | VTWVMWNLISVCLETVLVSVQDRCMVCTKRTIDSEIILDAP |
| Ga0182145_11176232 | 3300015361 | Miscanthus Phyllosphere | MWNLTSLSLEIVLVSVQDRCTVSAKRTINSDIILDAPDGTTR |
| Ga0182145_11959341 | 3300015361 | Miscanthus Phyllosphere | VTWVVWNLVSVRLETVLVSVQDRCTVCAKRTIGSEIV |
| Ga0182203_10276702 | 3300017404 | Miscanthus Phyllosphere | MWNLTSFSLETVLVSVQDRCTVCAKRTIGSEIVLD |
| Ga0182203_10900491 | 3300017404 | Miscanthus Phyllosphere | MWNLVLVPLETVLVSVRDRWTVCAKCTIGSEIISDAPDGTP |
| Ga0182220_11098241 | 3300017407 | Miscanthus Phyllosphere | MWNLDLVRLETVLVSVQDRCTVCTKRTIGSEIVLDTPN |
| Ga0182204_10180091 | 3300017409 | Miscanthus Phyllosphere | VTWVRWNLVLVHLETVLVSVQDRCTVYTKCPVGSE |
| Ga0182207_10690971 | 3300017410 | Miscanthus Phyllosphere | VTWVRWNLVLVHLETVLVSVQDRCTVCTKCPVGSEIILDAPN |
| Ga0182208_10672631 | 3300017411 | Miscanthus Phyllosphere | NSSVTWVMWNLVLVYLEVVLVFVQDRCTVYAKCTIAS |
| Ga0182222_10009311 | 3300017413 | Miscanthus Phyllosphere | MWNLSSFSLEIVLVSVQDRCTVCAKRTIDSEIILDEPGSTTR |
| Ga0182202_10109362 | 3300017415 | Miscanthus Phyllosphere | VMWNLTSFSLETVLVSVQDRCTVCAKRTIGSEIVLDALDGTTR |
| Ga0182202_11288381 | 3300017415 | Miscanthus Phyllosphere | VTWVRWNLVLVRLETVLVSVQDRCTVCTKCIVGSEIVLD |
| Ga0182230_10462132 | 3300017417 | Miscanthus Phyllosphere | MWNLVLFRSETVLVSVQDRCTVCAKRTIGSEIILDA |
| Ga0182230_11137671 | 3300017417 | Miscanthus Phyllosphere | MWDLTSFSLETVLVSVQDRSTICVKRTIGSEIILDGPDGTPR |
| Ga0182228_11119231 | 3300017420 | Miscanthus Phyllosphere | TSFSLETVSVLVQDRCMVCAKCTIGSEIFLDTPDITPR |
| Ga0182219_10037122 | 3300017424 | Miscanthus Phyllosphere | MWNLSSFSLEIVLVSVQDRCTVCAKRTIDSEIILDEPDSTTR |
| Ga0182219_10498761 | 3300017424 | Miscanthus Phyllosphere | MWILWNLVSLCLETVLVSVQDRCTVCAKRTIGLEI |
| Ga0182224_10431872 | 3300017425 | Miscanthus Phyllosphere | MWNLVSVRLEIVFVWVQDRCTVCTKHAIGSEIILDALDG |
| Ga0182224_10665701 | 3300017425 | Miscanthus Phyllosphere | WIMWNLVLLRLERVLVSMQDRCTDCAERTIGLEIILDALDDSPR |
| Ga0182224_11427711 | 3300017425 | Miscanthus Phyllosphere | MSNLVSVRSETVLVSVQDRCMVCTKCTIGSEIILDAPDGT |
| Ga0182190_10488131 | 3300017427 | Miscanthus Phyllosphere | MWNLVLVRLETVLVSVQDRCTVCTKCTIGSEIILNAPDG |
| Ga0182191_10884362 | 3300017438 | Miscanthus Phyllosphere | WNLTSFSLEIVLVSVQDRCTVCAKRTIGLEIVWDTPDGTPR |
| Ga0182221_10154561 | 3300017442 | Miscanthus Phyllosphere | MWNLVLVRLEIKLVSVQDRSTVCTKCIIGSKIILDAPH |
| Ga0182221_10156741 | 3300017442 | Miscanthus Phyllosphere | VTWVMWNLTSFSLEIVLVSVQDRCTVCAKRTIDSEIILDAPDGTTR |
| Ga0182221_11295412 | 3300017442 | Miscanthus Phyllosphere | MWNLTSFSLETVLVSVPDRCAVCAKRTIGSEIILNA |
| Ga0182193_10423681 | 3300017443 | Miscanthus Phyllosphere | MWNLTSLSLEIVLVSVQDRCMDCAKRTIDSKIIFNA |
| Ga0182193_11036021 | 3300017443 | Miscanthus Phyllosphere | VTWVMWNLTSFSLEIVLVSVQDRCTVCAKRTIGSEIILDAPF |
| Ga0182193_11246671 | 3300017443 | Miscanthus Phyllosphere | MWVTWNFVSIRLEIVFVSVQDRCTVFAKRTIGSEIILD |
| Ga0182193_11707002 | 3300017443 | Miscanthus Phyllosphere | MWDLTSFSLETVLVSVQDRCMVCAKRTIGLEIILDA |
| Ga0182233_10548721 | 3300017680 | Miscanthus Phyllosphere | VTWVTWNLASVRSETVLVSVQDRCTVCAKRTIGSRIVLDAPDG |
| Ga0182233_10658231 | 3300017680 | Miscanthus Phyllosphere | VRLEIVLVSVQDMCTVCTKCIIGSKIISDAPDGTPR |
| Ga0182218_10203251 | 3300017683 | Miscanthus Phyllosphere | TSFSLEIVLVSVQDRCTVCAKRTIDSEIILDAPDGTTS |
| Ga0182218_10365791 | 3300017683 | Miscanthus Phyllosphere | MWNVVSVHLEIVLVSVQDRCMVCTKCIIGSKIISDAP |
| Ga0182218_10571381 | 3300017683 | Miscanthus Phyllosphere | MVTWVMWNLTSFSLDIVLVSMQDRCTVCAKRTISLEII |
| Ga0182218_10712971 | 3300017683 | Miscanthus Phyllosphere | SLEIVLVSVQDWCTVSAKRTIDSEIILDAPDGTPR |
| Ga0182225_10327951 | 3300017684 | Miscanthus Phyllosphere | VTWVGWNLVSVRLETVLVSVQDRCTVCAKRTIGSEII |
| Ga0182225_10468961 | 3300017684 | Miscanthus Phyllosphere | TWVMWNLTYFSLETVLVSVQDRCMVCAKHTIDSEIILDEPDGTTR |
| Ga0182225_10715191 | 3300017684 | Miscanthus Phyllosphere | VTWVRWNLVLVHLETVLVSVQDRCTVCAKRTIGSGIILDA |
| Ga0182225_10722971 | 3300017684 | Miscanthus Phyllosphere | MWNLTSFHLETVLLSVQDRCTVCAKRTIGSEIVLDAPDGTT |
| Ga0182227_10394332 | 3300017685 | Miscanthus Phyllosphere | MLDLTSFSLETLLVSVQNRCMVCAKRTIGSEIILDAPD |
| Ga0182227_11264161 | 3300017685 | Miscanthus Phyllosphere | MWNVVSVCLEIVLGSVQDRCTVCTKCIIGSKIISDTPDG |
| Ga0182205_11685691 | 3300017686 | Miscanthus Phyllosphere | VTWVGWNLVFVCLETVLVSVQDRCTVCTKCIVGSEIVLDAPDATL |
| Ga0182223_10550131 | 3300017690 | Miscanthus Phyllosphere | VTWVRWNLVLLRLETVLVSVQDRCTVCTKCTIGSEIVLDA |
| Ga0182232_10668601 | 3300021060 | Phyllosphere | MWNLTSFGLEEVLVSVQDRCTLCAKRTISSEIVLDA |
| Ga0207677_111741212 | 3300026023 | Miscanthus Rhizosphere | MWNLTSFSLETVLVLVPDSCAVCAKRTIGSEIILNALD |
| ⦗Top⦘ |