NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F062776

Metagenome / Metatranscriptome Family F062776

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F062776
Family Type Metagenome / Metatranscriptome
Number of Sequences 130
Average Sequence Length 68 residues
Representative Sequence MEKYSNPDVFIVLVGFIGIILLGALLGEVAVRIAKMLGYEYEEKPNVDFWQRLQDGEVLDADNMFSNE
Number of Associated Samples 101
Number of Associated Scaffolds 130

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Viruses
% of genes with valid RBS motifs 85.38 %
% of genes near scaffold ends (potentially truncated) 29.23 %
% of genes from short scaffolds (< 2000 bps) 79.23 %
Associated GOLD sequencing projects 90
AlphaFold2 3D model prediction Yes
3D model pTM-score0.39

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group unclassified viruses (50.000 % of family members)
NCBI Taxonomy ID 12429
Taxonomy All Organisms → Viruses → unclassified viruses

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine
(34.615 % of family members)
Environment Ontology (ENVO) Unclassified
(71.538 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Water (saline)
(93.846 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Transmembrane (alpha-helical) Signal Peptide: No Secondary Structure distribution: α-helix: 42.71%    β-sheet: 0.00%    Coil/Unstructured: 57.29%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.39
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 130 Family Scaffolds
PF01471PG_binding_1 15.38
PF01510Amidase_2 15.38
PF13730HTH_36 3.08
PF02592Vut_1 2.31
PF16945Phage_r1t_holin 1.54
PF00145DNA_methylase 0.77
PF01464SLT 0.77

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 130 Family Scaffolds
COG1738Queuosine precursor transporter YhhQ, DUF165 familyTranslation, ribosomal structure and biogenesis [J] 2.31
COG0270DNA-cytosine methylaseReplication, recombination and repair [L] 0.77

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms61.54 %
UnclassifiedrootN/A38.46 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000117|DelMOWin2010_c10014688All Organisms → Viruses → Predicted Viral4291Open in IMG/M
3300000949|BBAY94_10110429All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.752Open in IMG/M
3300001830|ACM40_1031804All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.614Open in IMG/M
3300002483|JGI25132J35274_1030615Not Available1224Open in IMG/M
3300005512|Ga0074648_1043352Not Available2052Open in IMG/M
3300006029|Ga0075466_1007732All Organisms → Viruses → Predicted Viral3730Open in IMG/M
3300006425|Ga0075486_1821312All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.644Open in IMG/M
3300006735|Ga0098038_1070921Not Available1233Open in IMG/M
3300006735|Ga0098038_1163083All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.737Open in IMG/M
3300006735|Ga0098038_1203860All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.639Open in IMG/M
3300006735|Ga0098038_1218009All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.612Open in IMG/M
3300006737|Ga0098037_1060172Not Available1355Open in IMG/M
3300006737|Ga0098037_1181141All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.696Open in IMG/M
3300006737|Ga0098037_1212988All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.629Open in IMG/M
3300006749|Ga0098042_1078915Not Available854Open in IMG/M
3300006749|Ga0098042_1122988All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.647Open in IMG/M
3300006749|Ga0098042_1162459Not Available544Open in IMG/M
3300006752|Ga0098048_1009519Not Available3494Open in IMG/M
3300006789|Ga0098054_1262557All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.621Open in IMG/M
3300006793|Ga0098055_1021171All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.2781Open in IMG/M
3300006802|Ga0070749_10678379Not Available552Open in IMG/M
3300006921|Ga0098060_1015961Not Available2381Open in IMG/M
3300006922|Ga0098045_1080337All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.780Open in IMG/M
3300006929|Ga0098036_1029360Not Available1728Open in IMG/M
3300006929|Ga0098036_1091244Not Available937Open in IMG/M
3300006929|Ga0098036_1243379All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.544Open in IMG/M
3300006990|Ga0098046_1007083Not Available3220Open in IMG/M
3300007236|Ga0075463_10235768Not Available588Open in IMG/M
3300007276|Ga0070747_1044965Not Available1706Open in IMG/M
3300007538|Ga0099851_1018204Not Available2849Open in IMG/M
3300009001|Ga0102963_1316754All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.613Open in IMG/M
3300009481|Ga0114932_10478079All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.734Open in IMG/M
3300009529|Ga0114919_10073890Not Available2496Open in IMG/M
3300009605|Ga0114906_1288616All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.523Open in IMG/M
3300010148|Ga0098043_1022606All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.2009Open in IMG/M
3300010148|Ga0098043_1042127Not Available1415Open in IMG/M
3300010148|Ga0098043_1069456All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.1055Open in IMG/M
3300010148|Ga0098043_1205541Not Available544Open in IMG/M
3300010149|Ga0098049_1206435All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.601Open in IMG/M
3300010149|Ga0098049_1248705Not Available540Open in IMG/M
3300010149|Ga0098049_1256034Not Available531Open in IMG/M
3300010153|Ga0098059_1275034All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.646Open in IMG/M
3300010368|Ga0129324_10004385Not Available8192Open in IMG/M
3300011252|Ga0151674_1054551Not Available2199Open in IMG/M
3300011258|Ga0151677_1040966All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.3109Open in IMG/M
3300012920|Ga0160423_10328846All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.1049Open in IMG/M
3300012920|Ga0160423_10363819All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.991Open in IMG/M
3300012936|Ga0163109_10450822Not Available942Open in IMG/M
3300017708|Ga0181369_1074877All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.727Open in IMG/M
3300017709|Ga0181387_1000769Not Available7011Open in IMG/M
3300017721|Ga0181373_1012328All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.1604Open in IMG/M
3300017721|Ga0181373_1094235All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.530Open in IMG/M
3300017728|Ga0181419_1080309Not Available816Open in IMG/M
3300017731|Ga0181416_1085735All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.748Open in IMG/M
3300017738|Ga0181428_1053249All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.943Open in IMG/M
3300017745|Ga0181427_1062783Not Available914Open in IMG/M
3300017750|Ga0181405_1060201All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.989Open in IMG/M
3300017758|Ga0181409_1146350Not Available692Open in IMG/M
3300017759|Ga0181414_1073096All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.909Open in IMG/M
3300017771|Ga0181425_1004800Not Available4701Open in IMG/M
3300017786|Ga0181424_10295056All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.673Open in IMG/M
3300017951|Ga0181577_10774693All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.579Open in IMG/M
3300017952|Ga0181583_10243080All Organisms → Viruses → Predicted Viral1164Open in IMG/M
3300017956|Ga0181580_10269004All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.1171Open in IMG/M
3300017962|Ga0181581_10563958All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.697Open in IMG/M
3300017968|Ga0181587_10762400Not Available607Open in IMG/M
3300017969|Ga0181585_10171723All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.1572Open in IMG/M
3300017969|Ga0181585_10221644Not Available1346Open in IMG/M
3300018041|Ga0181601_10292482Not Available907Open in IMG/M
3300018416|Ga0181553_10528679All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.628Open in IMG/M
3300018416|Ga0181553_10620912Not Available570Open in IMG/M
3300018420|Ga0181563_10054739Not Available2795Open in IMG/M
3300018421|Ga0181592_11027447All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.530Open in IMG/M
3300018424|Ga0181591_10855309All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.627Open in IMG/M
3300019708|Ga0194016_1007321Not Available1113Open in IMG/M
3300019756|Ga0194023_1041983All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.922Open in IMG/M
3300020055|Ga0181575_10587822All Organisms → cellular organisms → Bacteria584Open in IMG/M
3300020269|Ga0211484_1080305All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.579Open in IMG/M
3300020392|Ga0211666_10127533Not Available1008Open in IMG/M
3300020404|Ga0211659_10158192Not Available1027Open in IMG/M
3300020409|Ga0211472_10245893Not Available719Open in IMG/M
3300020410|Ga0211699_10161711All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.847Open in IMG/M
3300020417|Ga0211528_10030131Not Available2559Open in IMG/M
3300020430|Ga0211622_10182860All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.901Open in IMG/M
3300020439|Ga0211558_10016943All Organisms → Viruses → Predicted Viral3755Open in IMG/M
3300020450|Ga0211641_10384390All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.678Open in IMG/M
3300020470|Ga0211543_10091331All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.1561Open in IMG/M
3300021356|Ga0213858_10349531Not Available699Open in IMG/M
3300021364|Ga0213859_10099673All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.1377Open in IMG/M
3300021368|Ga0213860_10424325All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.574Open in IMG/M
3300021957|Ga0222717_10043851Not Available2916Open in IMG/M
3300021964|Ga0222719_10661893All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.596Open in IMG/M
3300022053|Ga0212030_1012283All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.1081Open in IMG/M
3300022065|Ga0212024_1007375All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria1555Open in IMG/M
3300022065|Ga0212024_1057633Not Available685Open in IMG/M
3300022068|Ga0212021_1061556All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.767Open in IMG/M
3300022183|Ga0196891_1007434All Organisms → Viruses → Predicted Viral2230Open in IMG/M
3300022183|Ga0196891_1083459All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.565Open in IMG/M
3300022306|Ga0224509_10204223All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.708Open in IMG/M
3300023172|Ga0255766_10156984All Organisms → cellular organisms → Bacteria1291Open in IMG/M
3300023176|Ga0255772_10297407All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.858Open in IMG/M
3300025070|Ga0208667_1059892All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.596Open in IMG/M
3300025086|Ga0208157_1002021All Organisms → cellular organisms → Bacteria8654Open in IMG/M
3300025086|Ga0208157_1137929All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.549Open in IMG/M
3300025086|Ga0208157_1147880Not Available519Open in IMG/M
3300025099|Ga0208669_1011189Not Available2492Open in IMG/M
3300025099|Ga0208669_1020115All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.1727Open in IMG/M
3300025102|Ga0208666_1081127All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.835Open in IMG/M
3300025108|Ga0208793_1038981All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.1526Open in IMG/M
3300025110|Ga0208158_1033272Not Available1310Open in IMG/M
3300025110|Ga0208158_1079843All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.780Open in IMG/M
3300025128|Ga0208919_1135767Not Available771Open in IMG/M
3300025128|Ga0208919_1259664All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.501Open in IMG/M
3300025132|Ga0209232_1016565Not Available2940Open in IMG/M
3300025543|Ga0208303_1028152Not Available1519Open in IMG/M
3300025630|Ga0208004_1010342All Organisms → Viruses → Predicted Viral3143Open in IMG/M
3300025647|Ga0208160_1067291All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria983Open in IMG/M
3300025687|Ga0208019_1017886All Organisms → Viruses → Predicted Viral2841Open in IMG/M
3300025759|Ga0208899_1046795Not Available1882Open in IMG/M
3300025759|Ga0208899_1064545All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales1497Open in IMG/M
3300025889|Ga0208644_1062687Not Available1990Open in IMG/M
3300025889|Ga0208644_1265090All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.702Open in IMG/M
3300026201|Ga0208127_1119347All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.663Open in IMG/M
3300027917|Ga0209536_100127611All Organisms → Viruses → Predicted Viral3223Open in IMG/M
3300028022|Ga0256382_1162777All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.534Open in IMG/M
3300029309|Ga0183683_1000322All Organisms → cellular organisms → Bacteria28399Open in IMG/M
3300029309|Ga0183683_1024211All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.1168Open in IMG/M
3300029318|Ga0185543_1027080All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.1311Open in IMG/M
3300029318|Ga0185543_1079472All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.657Open in IMG/M
3300029792|Ga0183826_1027097Not Available912Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine34.62%
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous15.38%
Salt MarshEnvironmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh12.31%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine11.54%
SeawaterEnvironmental → Aquatic → Marine → Strait → Unclassified → Seawater7.69%
Surface SeawaterEnvironmental → Aquatic → Marine → Oceanic → Photic Zone → Surface Seawater2.31%
SeawaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Seawater2.31%
MarineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Marine1.54%
Estuarine WaterEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water1.54%
SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Sediment0.77%
FreshwaterEnvironmental → Aquatic → Freshwater → River → Unclassified → Freshwater0.77%
Deep OceanEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean0.77%
Marine PlanktonEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine Plankton0.77%
Marine SedimentEnvironmental → Aquatic → Marine → Oceanic → Sediment → Marine Sediment0.77%
Deep SubsurfaceEnvironmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface0.77%
Freshwater To Marine Saline GradientEnvironmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient0.77%
SeawaterEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Seawater0.77%
MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine0.77%
SedimentEnvironmental → Aquatic → Marine → Sediment → Unclassified → Sediment0.77%
Deep SubsurfaceEnvironmental → Aquatic → Marine → Volcanic → Unclassified → Deep Subsurface0.77%
Pond WaterEnvironmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Pond Water0.77%
Saline Water And SedimentEnvironmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Epilimnion → Saline Water And Sediment0.77%
Macroalgal SurfaceHost-Associated → Algae → Green Algae → Ectosymbionts → Unclassified → Macroalgal Surface0.77%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000117Marine microbial communities from Delaware Coast, sample from Delaware MO Winter December 2010EnvironmentalOpen in IMG/M
3300000949Macroalgal surface ecosystem from Botany Bay, Sydney, Australia - BBAY94Host-AssociatedOpen in IMG/M
3300001830Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - ACM40, ROCA_DNA028_0.2um_3lEnvironmentalOpen in IMG/M
3300002483Marine viral communities from the Pacific Ocean - ETNP_6_30EnvironmentalOpen in IMG/M
3300005512Saline surface water microbial communities from Etoliko Lagoon, Greece - halocline_waterEnvironmentalOpen in IMG/M
3300006029Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_<0.8_DNAEnvironmentalOpen in IMG/M
3300006425Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_<0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006735Marine viral communities from the Subarctic Pacific Ocean - 5B_ETSP_OMZ_AT15132_CsCl metaGEnvironmentalOpen in IMG/M
3300006737Marine viral communities from the Subarctic Pacific Ocean - 5_ETSP_OMZ_AT15132 metaGEnvironmentalOpen in IMG/M
3300006749Marine viral communities from the Subarctic Pacific Ocean - 9_ETSP_OMZ_AT15188 metaGEnvironmentalOpen in IMG/M
3300006752Marine viral communities from the Subarctic Pacific Ocean - 13_ETSP_OMZ_AT15268 metaGEnvironmentalOpen in IMG/M
3300006789Marine viral communities from the Subarctic Pacific Ocean - 16_ETSP_OMZ_AT15313 metaGEnvironmentalOpen in IMG/M
3300006793Marine viral communities from the Subarctic Pacific Ocean - 17_ETSP_OMZ_AT15314 metaGEnvironmentalOpen in IMG/M
3300006802Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18EnvironmentalOpen in IMG/M
3300006921Marine viral communities from the Subarctic Pacific Ocean - 21_ETSP_OMZ_AT15319 metaGEnvironmentalOpen in IMG/M
3300006922Marine viral communities from the Subarctic Pacific Ocean - 11_ETSP_OMZ_AT15265 metaGEnvironmentalOpen in IMG/M
3300006929Marine viral communities from the Subarctic Pacific Ocean - 4_ETSP_OMZ_AT15127 metaGEnvironmentalOpen in IMG/M
3300006990Marine viral communities from the Subarctic Pacific Ocean - 11B_ETSP_OMZ_AT15265_CsCl metaGEnvironmentalOpen in IMG/M
3300007236Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_>0.8_DNAEnvironmentalOpen in IMG/M
3300007276Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31EnvironmentalOpen in IMG/M
3300007538Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaGEnvironmentalOpen in IMG/M
3300009001Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_C_H2O_MGEnvironmentalOpen in IMG/M
3300009481Deep subsurface microbial communities from Kolumbo volcano to uncover new lineages of life (NeLLi) - 2SBTROV12_ACTIVE470 metaGEnvironmentalOpen in IMG/M
3300009529Deep subsurface microbial communities from Black Sea to uncover new lineages of life (NeLLi) - Black_00105 metaGEnvironmentalOpen in IMG/M
3300009605Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_M9EnvironmentalOpen in IMG/M
3300010148Marine viral communities from the Subarctic Pacific Ocean - 9B_ETSP_OMZ_AT15188_CsCl metaGEnvironmentalOpen in IMG/M
3300010149Marine viral communities from the Subarctic Pacific Ocean - 13B_ETSP_OMZ_AT15268_CsCl metaGEnvironmentalOpen in IMG/M
3300010153Marine viral communities from the Subarctic Pacific Ocean - 20_ETSP_OMZ_AT15318 metaGEnvironmentalOpen in IMG/M
3300010368Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.2_DNAEnvironmentalOpen in IMG/M
3300011252Seawater microbial communities from Japan Sea near Toyama Prefecture, Japan - 2014_4, permeateEnvironmentalOpen in IMG/M
3300011258Seawater microbial communities from Japan Sea near Toyama Prefecture, Japan - 2015_1, permeateEnvironmentalOpen in IMG/M
3300012920Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St8 metaGEnvironmentalOpen in IMG/M
3300012936Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St13 metaGEnvironmentalOpen in IMG/M
3300017708Marine viral communities from the Subarctic Pacific Ocean - Lowphox_04 viral metaGEnvironmentalOpen in IMG/M
3300017709Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 10 SPOT_SRF_2010-04-27EnvironmentalOpen in IMG/M
3300017721Marine viral communities from the Subarctic Pacific Ocean - Lowphox_09 viral metaGEnvironmentalOpen in IMG/M
3300017728Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 42 SPOT_SRF_2013-04-24EnvironmentalOpen in IMG/M
3300017731Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 39 SPOT_SRF_2013-01-16EnvironmentalOpen in IMG/M
3300017738Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 51 SPOT_SRF_2014-02-12EnvironmentalOpen in IMG/M
3300017745Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 50 SPOT_SRF_2014-01-15EnvironmentalOpen in IMG/M
3300017750Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 28 SPOT_SRF_2011-11-29EnvironmentalOpen in IMG/M
3300017758Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 32 SPOT_SRF_2012-05-30EnvironmentalOpen in IMG/M
3300017759Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 37 SPOT_SRF_2012-11-28EnvironmentalOpen in IMG/M
3300017771Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 48 SPOT_SRF_2013-11-13EnvironmentalOpen in IMG/M
3300017786Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 47 SPOT_SRF_2013-09-18EnvironmentalOpen in IMG/M
3300017951Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101413BT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300017952Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071405CT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300017956Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071403BT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300017962Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071404AT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300017968Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071409AT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300017969Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071407BT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018041Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041407BS metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018416Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011502XT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018420Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011512CT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018421Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071412BT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018424Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071412AT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300019708Sediment microbial communities from the Broadkill River, Lewes, Delaware, United States ? BRC_2-3_MGEnvironmentalOpen in IMG/M
3300019756Freshwater microbial communities from the Broadkill River, Lewes, Delaware, United States ? IW6Sep16_MGEnvironmentalOpen in IMG/M
3300020055Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101411CT metaG (spades assembly)EnvironmentalOpen in IMG/M
3300020269Marine microbial communities from Tara Oceans - TARA_A100001035 (ERX556080-ERR599041)EnvironmentalOpen in IMG/M
3300020392Marine microbial communities from Tara Oceans - TARA_B100000963 (ERX555916-ERR599163)EnvironmentalOpen in IMG/M
3300020404Marine microbial communities from Tara Oceans - TARA_B100000900 (ERX555954-ERR598978)EnvironmentalOpen in IMG/M
3300020409Marine microbial communities from Tara Oceans - TARA_A100001403 (ERX555912-ERR599106)EnvironmentalOpen in IMG/M
3300020410Marine microbial communities from Tara Oceans - TARA_B100000519 (ERX555959-ERR599148)EnvironmentalOpen in IMG/M
3300020417Marine microbial communities from Tara Oceans - TARA_B100000073 (ERX556034-ERR599082)EnvironmentalOpen in IMG/M
3300020430Marine microbial communities from Tara Oceans - TARA_B100000683 (ERX556126-ERR599160)EnvironmentalOpen in IMG/M
3300020439Marine microbial communities from Tara Oceans - TARA_B100001939 (ERX556062-ERR599029)EnvironmentalOpen in IMG/M
3300020450Marine microbial communities from Tara Oceans - TARA_B100000575 (ERX555933-ERR599077)EnvironmentalOpen in IMG/M
3300020470Marine microbial communities from Tara Oceans - TARA_B100000287 (ERX555976-ERR599053)EnvironmentalOpen in IMG/M
3300021356Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO245EnvironmentalOpen in IMG/M
3300021364Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO304EnvironmentalOpen in IMG/M
3300021368Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO550EnvironmentalOpen in IMG/M
3300021957Estuarine water microbial communities from San Francisco Bay, California, United States - C33_18DEnvironmentalOpen in IMG/M
3300021964Estuarine water microbial communities from San Francisco Bay, California, United States - C33_34DEnvironmentalOpen in IMG/M
3300022053Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG (v2)EnvironmentalOpen in IMG/M
3300022065Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 (v2)EnvironmentalOpen in IMG/M
3300022068Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 (v2)EnvironmentalOpen in IMG/M
3300022183Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 (v3)EnvironmentalOpen in IMG/M
3300022306Sediment microbial communities from San Francisco Bay, California, United States - SF_Jan12_sed_USGS_24EnvironmentalOpen in IMG/M
3300023172Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071403BT metaGEnvironmentalOpen in IMG/M
3300023176Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071411BT metaGEnvironmentalOpen in IMG/M
3300025070Marine viral communities from the Subarctic Pacific Ocean - 11B_ETSP_OMZ_AT15265_CsCl metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025086Marine viral communities from the Subarctic Pacific Ocean - 5_ETSP_OMZ_AT15132 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025099Marine viral communities from the Subarctic Pacific Ocean - 21_ETSP_OMZ_AT15319 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025102Marine viral communities from the Subarctic Pacific Ocean - 5B_ETSP_OMZ_AT15132_CsCl metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025108Marine viral communities from the Subarctic Pacific Ocean - 17_ETSP_OMZ_AT15314 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025110Marine viral communities from the Subarctic Pacific Ocean - 8_ETSP_OMZ_AT15162 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025128Marine viral communities from the Subarctic Pacific Ocean - 4_ETSP_OMZ_AT15127 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025132Marine viral communities from the Pacific Ocean - ETNP_2_60 (SPAdes)EnvironmentalOpen in IMG/M
3300025543Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300025630Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_>0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025647Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300025687Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1D Viral MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300025759Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 (SPAdes)EnvironmentalOpen in IMG/M
3300025889Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 (SPAdes)EnvironmentalOpen in IMG/M
3300026201Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201306SV45 (SPAdes)EnvironmentalOpen in IMG/M
3300027917Marine sediment microbial communities from White Oak River estuary, North Carolina - WOR-2-8_12 (SPAdes)EnvironmentalOpen in IMG/M
3300028022Seawater viral communities from deep brine pools at the bottom of the Mediterranean Sea - LS1 750mEnvironmentalOpen in IMG/M
3300029309Marine viral communities collected during Tara Oceans survey from station TARA_100 - TARA_R100001440EnvironmentalOpen in IMG/M
3300029318Marine giant viral communities collected during Tara Oceans survey from station TARA_038 - TARA_Y100000289EnvironmentalOpen in IMG/M
3300029792Marine giant viral communities collected during Tara Oceans survey from station TARA_041 - TARA_Y100000052EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
DelMOWin2010_1001468863300000117MarineMEKYSNPDVFIVLVGFIGIILLGALLGEVAVWIAKILGYEYEEKPNVDFWQRLQDGEVLDADNMFNNGN*
BBAY94_1011042943300000949Macroalgal SurfaceMDKYSNPDVFIVLFYFMAIFLIGALLGEVAVYIAKLLGFDYEEDQINVDFLQRLENGEVLDSENMFK*
ACM40_103180413300001830Marine PlanktonMEKYSNPDVLIVLVGFIGIILIGALLGEVAVWVAKILGYQYEEQPNVDFWQRLQDGEVLDADNMFSNGN*
JGI25132J35274_103061513300002483MarineMDKYSNPDVFIVLVGFIGIILLGALLGEVAVWVAKILGYEYEEKPNVDFWQRLQDGEVLDADNMFSNE*
Ga0074648_104335243300005512Saline Water And SedimentMEKYSNPDVFIVLVGFIGIIILGALLGEVAVWIAKMLGYEYEEQPNLDFWQRLQDGEVLDADNMFNNGN*
Ga0075466_100773293300006029AqueousMEKYSNPDVFIVLVGFIGIILLGALLGEVAVRIAKMLGYEYEEKPNVDFWQRLQDGEVLDADNMFNNGN*
Ga0075486_182131213300006425AqueousEQMEKYSNPDVFIVLVGFIGIILLGALLGEVAVRIAKMLGYEYEEKPNVDFWQRLQDGEVLDADNMFNNGN*
Ga0098038_107092133300006735MarineMENDITIFIVLAGFMSILTIGALLGEVAVWVAKILGYEFIDNQVNVDFIQRLQDGEVLDAENMFSNGE*
Ga0098038_116308333300006735MarineMDKYSNPDVFIVLGGFVAIFLIGALLAEVAVFIAKLLGYEDVADKPNVDFMQRLQDGEVLDPDNMFSNDTTK*
Ga0098038_120386013300006735MarineTKE*TMDKYSNPDVFIVLGGFVAIFLIGALLAEVAVFIAKMLGYEDVEDKPNVDFWQRLEDGEVLDADNMFK*
Ga0098038_121800923300006735MarineMDKYSNPDVFIVLGGFIAIFLIGALLAEVAVFIAKMLGYEDVEDKPNVDFWQRLDDGEVLDADNMFSNDTIK*
Ga0098037_106017213300006737MarineMENDITVFIVLAGFMSILTIGALLGEVAVWVAKILGYEYEDKPNVDFWQRLQDGEVLDADNMFINE*VK*
Ga0098037_118114133300006737MarineMDKYSNPDVFIVLGGFVAIFLIGALLAEVAVFIAKMLGYEDVEDKPNVDFWQRLEDGEVLDADNMFK*
Ga0098037_121298823300006737MarineMDKYSNPDVFIVLGGFVAIILLGALLAEVAVFIAKMLGYEDVEDKPNVDFWQRL
Ga0098042_107891523300006749MarineMDKYSNPDVFIVLVGFIGIILLGALLGEVAVWVAKILGYEYEEKPNVDFWQRLQDGEVLDADNMFSNDK*
Ga0098042_112298823300006749MarineMDKYSNPDVFIVLGGFIAIFLIGALLAEVAVFIAKMLGYEDVEDKPNVDFWQRLENGEVLDA
Ga0098042_116245913300006749MarineDVFIVLGGFVAIFLIGALLAEVAVFIAKMLGYEDVEDKPNVDFWQRLEDGEVLDADNMFK
Ga0098048_100951973300006752MarineMDKYSNPDVFIVLGGFVAIFLIGAFLAEVAVFIAKMLGYEDVKDKPNVDFWQRLENGEVLDADNMFSNDTTK*
Ga0098054_126255723300006789MarineMDKYSNPDVFIVLGGFVAIFLIGALLAEVAVFIAKMLGYEDVEDKPNVDFWQRLDDGEVLDADNMFSNDTIK*
Ga0098055_102117123300006793MarineMDKYSNPDVFIVLGGFIAIFLIGALLAEVAVFIAKMLGYEDVEDKPNVDFWQRLENGEVLDADNMFSNDTTK*
Ga0070749_1067837923300006802AqueousMEKYSNPDVFIVLVGLIGIILLGALLGEVAVRIAKMLGYEYEEKPNVDFWQRLQDGE
Ga0098060_101596173300006921MarineMENDITVFIVLAGFMSILTIGALLGEVAVWVAKILGYEYEDKPNVDFWQRLQDGEVLDADNMFINE*
Ga0098045_108033723300006922MarineMDKYSNPDVFIVLGGFVAIFLIGALLAEVAVFIAKMLGYEDVEDKPNVDFWQRLENGEVLDADNMFSNDTTK*
Ga0098036_102936033300006929MarineMENDITIFIVLAGFMSILTIGALLGEVAVWVAKILGYEYEDKPNVDFWQRLQDGEVLDADNMFINE*
Ga0098036_109124423300006929MarineMDKYSNPDVFIVLGGFVAIILLGALLAEVAVFIAKMLGYENVKDQPNVDFWQRLEDGEVLDADNMFSNDTTK*
Ga0098036_124337913300006929MarineMDKYSDPDVFIVFGGFVAIFLIGALLGEVAIFIAKMLGYEDVADKPNVDFMQRLQDGEILHADNMFIKE*NDTK*
Ga0098046_100708353300006990MarineMDKYSNPDVFIVLGGFVAIFLIGAFLAEVAVFIAKMLGYEDVKDKPNVDFWQRLENGEVLDADNMFSNDTIK*
Ga0075463_1023576823300007236AqueousMEKYSNPDVFIVLVGLIGIILLGALLGEVAVRIAKMLGYEYEEKPNVDFWQRLQDG
Ga0070747_104496533300007276AqueousMEKYSNPDVFIVLVGFIGIILLGALLGEVAVRIAKMLGYEYEEKPNVDFWQRLQDGEVLDADNMFSNE*
Ga0099851_101820463300007538AqueousMEKYSNPDVFIVLVGFIGIILLGALLGEVAVRIAKMLGYEYEEKPNVDFWQRLQDGEVLDANNMFNNGN*
Ga0102963_131675433300009001Pond WaterEQMEKYSNPDVFIVLVGFIGIILLGALLGEVAVYIAKILGYEYEEQPNVDFWQRLQDGEVLDADNMFNNGN*
Ga0114932_1047807933300009481Deep SubsurfaceMDKYSNPDVFIVLVGFIGIFLIGALLGEVAVWIAKILGYEYEEQPNVDFWQRLQDGEVLDADNMFNNGN*
Ga0114919_1007389043300009529Deep SubsurfaceMEKYSNPDVFIVLVGFIGIILLGALLGEVAVWIAKILGYEYEEQPNLDFWQRLQDGEVLDADNMFK*
Ga0114906_128861623300009605Deep OceanMEKYSNPDVFIVLVGFIGIFLIGALLGEVAVWIAKILGYEYEEQPNVDFWQRLQDGEVLDANNMFNNGK*
Ga0098043_102260663300010148MarineMDKYSNPDVFIVFGGFVAIFLIGALLGEVAVLIAKMLGYEDVADKPNVDFMQRLQDGEVLDADNMFSNE*
Ga0098043_104212723300010148MarineMDKYSNPDVFIVLVGFIGIIILGALLGEVAVWVAKILGYEYEEKPNVDFWQRLQDGEVLDADNMFSNDN*
Ga0098043_106945633300010148MarineMDKYSNPDVFIVFGGFIAIFLIGALLAEVAVFIAKILGYEDVANQPNIDFMQRLQDGEVLDADNMFKRECNDTK*
Ga0098043_120554113300010148MarineDVFIVLGGFVAIFLLGALLAEVAVFIAKMLGYEDVEDKPNVDFWQRLEDGEVLDADNMFK
Ga0098049_120643523300010149MarineMDKYSNPDVFIVLGGFIAIFLIGALLAEVAVFIAKMLGYEDVEDKPNVDFWQRLENGEVL
Ga0098049_124870523300010149MarineMDKYSNPDVFIVLGGFVAIFLLGALLAEVAVFIAKMLGYEDVEDKPNVDFWQRLD
Ga0098049_125603433300010149MarineVLGGFVAIFLIGALLAEVAVFIAKMLGYEDVEDKPNVDFWQRLDDGEVLDADNMFSNDTTK*
Ga0098059_127503433300010153MarineMDKYSNPDVFIVLGGFVAIFLLGALLAEVAVFIAKMLGYEDVEDKPNVDFWQRLEDGEVLDADNMFK*
Ga0129324_1000438593300010368Freshwater To Marine Saline GradientMDKYSNPDVFIVLGGFVAIILLGAFLAEVAVFIAKMLGYEDVEDKPNVDFWQRLENGEVLDADNMFSNDTIK*
Ga0151674_105455143300011252MarineMDKYSNPDVFIVLVGFIGIFLIGALLGEVAVWVAKILGYEYEEKPNVDFWQRLQDGEVLDADNMFSNGK*
Ga0151677_104096683300011258MarineMDKYSNPDVFIVLVGFIGIFFIGALLGEVAVWIAKMLGYEYEEKPNVDFWRRFQDGEVLDADNMFNNVC*
Ga0160423_1032884633300012920Surface SeawaterMDKYSNPDVFIVLVGFIGIILLGALLGEVAVWVAKILGYEYEEKPNVDFWQRLQDGEVLDADNMFSNGK*
Ga0160423_1036381933300012920Surface SeawaterMDKYSNPDVFIVLGGFIAIFLIGALLAEVAVFIAKMLGYEDVEDKPNVDFWQRLQDGEVLHAENMFTNE*
Ga0163109_1045082233300012936Surface SeawaterMDKYSNPDVFIVLGGFIAIFLIGALLAEVAVFIAKMLGYEDVADKPNVDFMQRLQDGEVLNADNMFTNE*
Ga0181369_107487723300017708MarineMDKYSNPDVFIVLGGFVAIFLIGALLAEVAVFIAKLLGYEDVADNPNVDFMQRLQDGEVLDADNIFSDE
Ga0181387_1000769113300017709SeawaterMDKYSNPDVFIVLVGFIGIILLGALLGEVAVWVAKILGYEYEEKPNVDFWQRLQDGEVLDAENMFSNE
Ga0181373_101232813300017721MarineMDKYSNPDVFIVLGGFIAIFLIGALLAEVAVFIAKMLGYEDVKDQPNVDFWQRLKDGEVLDADNMFSNDTTK
Ga0181373_109423513300017721MarineMDKYSNPDVFIVLGGFVAIFLIGALLAEVAVFIAKMLGYEDVKDQPNVDFWQRLENGEVLDADNMFSNE
Ga0181419_108030943300017728SeawaterSRPAVPVVLVGFIGIILLGALLGEVAVSVAKILGYEYEEKPNVDFWQRLQDGEVLDAENMFSNE
Ga0181416_108573513300017731SeawaterMDKYSNPDVFIVLGGFVAIILLGALLAEVAVFIAKMLGYEDVEDKPNVDFWQRLEDGEVLDADNMFK
Ga0181428_105324913300017738SeawaterKYSNPDVFIVLGGFVAIFLLGALLAEVAVFIAKMLGYEDVEDKPNVDFWQRLEDGEVLDADNMFK
Ga0181427_106278333300017745SeawaterMDKYSNPDVFIVLGGFVAIFLLGALLAEVAVFIAKMLGYEDVEDKPNVDFWQRLEDGEVLDADNMF
Ga0181405_106020113300017750SeawaterKYSNPDVFIVLVGFIGIILLGALLGEVAVWVAKILGYEYEEKPNVDFWQRLQDGEVLDAENMFSNE
Ga0181409_114635013300017758SeawaterMDKYSNPDVFIVLGGFVAIFLLGALLAEVAVFIAKMLGYEDVEDKPNVDFWQRLEDGE
Ga0181414_107309633300017759SeawaterMDKYSNPDVFIVLGGFVAIFLIGAFLAEVAVFIAKMLGYEDVEDKPNVDFWQRLEDGEVLDADNMFK
Ga0181425_100480073300017771SeawaterMDKYSNPDVFIVLGGFVAIFLLGALLAEVAVFIAKMLGYEDVEDKPNVDFWQRLEDGEVLDADNMFSNDTTK
Ga0181424_1029505613300017786SeawaterMDKYSNPDVFIVLGGFVAIFLLGALLAEVAVFIAKMLGYEDVEDKPNVDFWQRLEDGEVLDADNMFSNDTTKXTIR
Ga0181577_1077469323300017951Salt MarshMDKYSDPDVFIVLIGFVAIFLIGAFLGEVAVFIAKMLGYEDVADKPNVDFMQRLQDGEVLDADNMFSNDS
Ga0181583_1024308013300017952Salt MarshMDKYSDPDVFIVLIGFVAIFLIGAFLGEVAVFIAKILGYEYEEQPNVDFWQRLQDGEVLDADNMFNNGN
Ga0181580_1026900443300017956Salt MarshMEKYSNPDVFIVLVGFIGIILLGALLGEVAVWIAKILGYEYEEKPNVDFWQRLQDGEVLDADNMFNNGN
Ga0181581_1056395813300017962Salt MarshMEKYSNPDVFIVLVGFIGIILLGALLGEVAVWIAKMLGYQYEEQPNVDFWQRLQDGEVLDADNMFNNGN
Ga0181587_1076240013300017968Salt MarshDVFIVLVGFIGIILIGALLGEVAVWIAKMLGYQYEEQPNVDFWQRLQDGEVLDADNMFNNGN
Ga0181585_1017172313300017969Salt MarshTKRSEQMEKYSNPDVFIVLVGFIGIILIGALLGEVAVWIAKILGYEYEEQPNVDFWQRLQDGEVLDADNMFNNGN
Ga0181585_1022164433300017969Salt MarshMEKYSNPDVFIVLVGFIGIILLGALLGEVAVWIAKMLGYEYEEKPNVDFWQRLQDGEVLDADNMFNNGN
Ga0181601_1029248233300018041Salt MarshMEKYSNPDVFIVLVGFIGIILLGALLGEVAVWIAKILGYEYEEQPNVDFWQRLQDGEVLDADNMFNNGNXKIXRNYTNLHYL
Ga0181553_1052867913300018416Salt MarshMEKYSNPDVFIVLVGFIGIFLIGALLGEVAVWIAKILGYEYEEQPNVDFWQRLQDGEVLDANNMFSNE
Ga0181553_1062091223300018416Salt MarshVLIGFVAIFLIGAFLGEVAVFIAKMLGYEDVADKPNVDFMQRLQDGEVLDAENMFSNE
Ga0181563_1005473973300018420Salt MarshMDKYSDPDVFIVLIGFVAIFLIGAFLGEVAVFIAKMLGYEDVADQPNVDFMQRLQDGEVLDADNMFK
Ga0181592_1102744723300018421Salt MarshMEKYSNPDVFIVLVGFIGIILLGAVLGEVAVWIAKILGYEYEEQPNVDFWQRLQDGEVLDANNMFSNE
Ga0181591_1085530923300018424Salt MarshMEKYSNPDVFIVLVGFIGIILIGALLGEVAVWIAKILGYEYEEKPNVDFWQRLQDGEVLDADNMFNNGNXKIXRNYTNLHYL
Ga0194016_100732133300019708SedimentMEKYSNPDVFIVLVGFIGIILLGALLGEVAVWIAKILGYEYEEKPNVDFWQRLQDGEVLDADNMFSNGK
Ga0194023_104198323300019756FreshwaterMEKYSNPDVFIVLVGFIGIILLGALLGEVAVWIAKILGYEYEEKPNVDFWQRLQDGEVLDADNMFSNE
Ga0181575_1058782213300020055Salt MarshMDKYSDPDVFIVLIGFVAIFLIGAFLGEVAVFIAKMLGYEDVADKPNVDFMQRLQDGEVL
Ga0211484_108030523300020269MarineMDKYSDPDVFIVLIGFVTIFLIGAFLGEVAVFIAKMLGYEDVAEKPNVDFMQRLQDGEVLDADNMFK
Ga0211666_1012753333300020392MarineMDKYSNPDVFIVFGGFVAIFLIGALLGEVAVLIAKMLGYEDVADKRNVDFMQRLQDGEVLDANNMFSNE
Ga0211659_1015819233300020404MarineMDKYSNPDVFIVLGGFVAIFLLGALLAEVAVFIAKMLGYEDVKDKPNVDFWQRLEDGEVLDADNMFK
Ga0211472_1024589313300020409MarineMDKYSDPDVFIVLIGFVTIFLIGAFLGEVAVFIAKMLGYEDVADKPNVDFMQRLQD
Ga0211699_1016171123300020410MarineMEKYSDPDVFIVLGIFVAIFLIAAILGEVAVFIAKMLGYEDVADKPNVDFMQRLQDGEVLHADNMFKKEXNDTK
Ga0211528_1003013143300020417MarineMDKYSDPDVFIVLVGFIGILLIGALLGEVAVWVAKILGYEYEEKPNVDFWQRLQDGEVLDADNMFSNGN
Ga0211622_1018286033300020430MarineMDKYSDPDVFIVFGGFVAIFLIGALLGEVAVLIAKMLGYEDVADKPNVDFMQRLQDGEVLDADNMFSNE
Ga0211558_1001694343300020439MarineMEKYSNPDVFIVLVGFIGIILIGALLGEVAVWIAKILGYQYEEQPNVDFWQRLQDGEVLDADNMFNNGK
Ga0211641_1038439013300020450MarineMDKYSDPDVFIVFGGFVAIFLIGALLGEVAVLIAKMLGYEDVADKRNVDFMQRLQDGEVLDANNMFSNE
Ga0211543_1009133153300020470MarineMDKYSDPDAFIVLGGFVTIFLIGALLGEVAVFIAKMLGYEDVADKPNVDFWQRLQDGEILHADNMFSNE
Ga0213858_1034953113300021356SeawaterMEKYSNPDVFIVLVGFIGIFLVGALLGEVAVWIAKILGYEYEEQPNVDFWQRLQDGEVLDADNMFNNGK
Ga0213859_1009967353300021364SeawaterMEKYSNPDVFIVLVGFIGIILLGALLGEVAVWIAKMLGYEYEEQPNVDFWQRLQDGEVLDADNMFNNGN
Ga0213860_1042432513300021368SeawaterMEKYSNPDVFIVLVGFIGIILIGALLGEVAVWIAKILGYEYEEKPNVDFWQRLQDGEVLDADNMFNNGN
Ga0222717_1004385143300021957Estuarine WaterMEKYSNPDVFIVLVGFIGIILLGALLGEVAVYIAKILGYEYEEQPNVDFWQRLQDGEVLDADNMFNNGN
Ga0222719_1066189333300021964Estuarine WaterEQMEKYSNPDVFIVLVGFIGIILLGALLGEVAVRIAKMLGYQYEEQPNVDFWQRLQDGEVLDANNMFSNE
Ga0212030_101228323300022053AqueousMEKYSNPDVFIVLVGFIGIILLGALLGEVAVRIAKMLGYEYEEKPNVDFWQRLQDGEVLDADNMFNNGN
Ga0212024_100737523300022065AqueousMEKYSNPDVFIVLVGFIGIILLGALLGEVAVRIAKMLGYEYEEKPNVDFWQRLQDGEVLDADNMFTNE
Ga0212024_105763313300022065AqueousIVLVGFIGIILLGALLGEVAVRIAKMLGYEYEEQPNVDFWQRLQDGEVLDANNMFSNE
Ga0212021_106155623300022068AqueousMEKYSNPDVFIVLVGFIGIILLGALLGEVAVRIAKMLGYEYEEKPNVDFWQRLQDGEVLDANNMFSNE
Ga0196891_100743473300022183AqueousEKYSNPDVFIVLVGFIGIILLGALLGEVAVRIAKMLGYEYEEKPNVDFWQRLQDGEVLDADNMFTNE
Ga0196891_108345913300022183AqueousEKYSNPDVFIVLVGFIGIILLGALLGEVAVRIAKMLGYEYEEQPNVDFWQRLQDGEVLDANNMFSNE
Ga0224509_1020422323300022306SedimentMDKYSNPDVFIVLGGFVAIILLGAFLAEVAVFIAKMLGYEDVEDKPNVDFWQRLDDGEVLDADNMFSNDTTKXTIR
Ga0255766_1015698433300023172Salt MarshMEKYSNPDVFIVLVGFIGIILLGALLGEVAVWIAKMLGYEYEEQPNVDFWQRLQDGEVLDADNMFNNGNXKIXRNYTNLHYL
Ga0255772_1029740743300023176Salt MarshTKRSEQMEKYSNPDVFIVLVGFIGIILLGALLGEVAVWIAKILGYEYEEQPNVDFWQRLQDGEVLDADNMFNNGN
Ga0208667_105989223300025070MarineMDKYSNPDVFIVLGGFIAIFLIGALLAEVAVFIAKMLGYEDVEDKPNVDFWQRLEDGEVLDADNMFSNDTTK
Ga0208157_1002021143300025086MarineMDKYSNPDVFIVLGGFVAIFLIGALLAEVAVFIAKLLGYEDVADKPNVDFMQRLQDGEVLDPDNMFSNDTTK
Ga0208157_113792923300025086MarineMDKYSNPDVFIVLGGFVAIILLGALLAEVAVFIAKMLGYEDVEDKPNVDFWQRLEDGEVLDAD
Ga0208157_114788013300025086MarineMENDITVFIVLAGFMSILTIGALLGEVAVWVAKILGYEYEDKPNVDFWQRLQDGEVLDADNMFINEXV
Ga0208669_101118943300025099MarineMENDITVFIVLAGFMSILTIGALLGEVAVWVAKILGYEYEDKPNVDFWQRLQDGEVLDADNMFINE
Ga0208669_102011513300025099MarineMDKYSNPDVFIVLGGFVAIFLIGALLAEVAVFIAKMLGYEDVEDKPNVDFWQRLEDGEVLDADNMFK
Ga0208666_108112723300025102MarineMDKYSNPDVFIVLGGFIAIFLIGALLAEVAVFIAKMLGYEDVEDKPNVDFWQRLDDGEVLDADNMFSNDTIK
Ga0208793_103898163300025108MarineMDKYSNPDVFIVLGGFVAIFLIGALLAEVAVFIAKMLGYEDVKDQPNVDFWQRLEDGEILDADNMFSNDTTK
Ga0208158_103327233300025110MarineMDKYSNPDVFIVLGGFVAIFLIGALLAEVAVFIAKMLGYEDVEDKPNVDFWQRLDDGEVLDADNMF
Ga0208158_107984323300025110MarineMDKYSNPDVFIVLGGFIAIFLIGALLAEVAVFIAKMLGYEDVEDKPNVDFWQRLENGEVLDADNMFSNDTTK
Ga0208919_113576733300025128MarineMDKYSNPDVFIVLGGFVAIFLIGALLAEVAVFIAKLLGYEDVADKPNVDFMQRLQD
Ga0208919_125966413300025128MarineMDKYSDPDVFIVFGGFVAIFLIGALLGEVAIFIAKMLGYEDVADKPNVDFMQRLQDGEILHADNMFIKEXNDTK
Ga0209232_101656543300025132MarineMDKYSNPDVFIVLGGFVAIFLLGAFLAEVAVFIAKMLGYEDVEDKPNVDFWQRLEDGEVLDADNMFK
Ga0208303_102815243300025543AqueousMEKYSNPDVFIVLVGFIGIILLGALLGEVAVRIAKMLGYEYEEKPNVDFWQRLQDGEVLDANNMFNNGN
Ga0208004_101034263300025630AqueousMEKYSNPDVFIVLVGFIGIILLGALLGEVAVRIAKMLGYEYEEKPNVDFWQRLQDGEVLDADNMF
Ga0208160_106729113300025647AqueousMEKYSNPDVFIVLVGFIGIILLGALLGEVAVRIAKMLGYEYEEKPNVDFWQRLQDGEVLDADNMFN
Ga0208019_101788643300025687AqueousVNKWEKYSNPDVFIVLVGFIGIILLGALLGEVAVRIAKMLGYEYEEKPNVDFWQRLQDGEVLDANNMFNNGN
Ga0208899_104679513300025759AqueousMEKYSNPDVFIVLVGFIGIILLGALLGEVAVRIAKMLGYEYEEKPNVDFWQRLQDGEV
Ga0208899_106454513300025759AqueousMEKYSNPDVFIVLVGLIGIILLGALLGEVAVRIAKMLGYEYEEKPNVDFWQRLQDGEV
Ga0208644_106268733300025889AqueousMEKYSNPDVFIVLVGLIGIILLGALLGEVAVRIAKMLGYEYEEKPNVDFWQRLQDGEVLDADNMFTNE
Ga0208644_126509033300025889AqueousMEKYSNPDVFIVLVGFIGIILLGALLGEVAVRIAKMLGYEYEEQPNVDFWQRLQDGEVLDANNMFSNE
Ga0208127_111934723300026201MarineMDKYSNPDVFIVLVGFVGIILLGALLGEVAVWVAKILGYEYEEKPNVDFWQRLQDGEVLDADNMFSNGK
Ga0209536_10012761173300027917Marine SedimentMEKYSNPDVFIVLVGFIGIILLGALLGEVAVRIAKMLGYEYEEKPNVDFWQRLQDGEVLDADNMFTND
Ga0256382_116277723300028022SeawaterMEKYSNPDVFIVLVGFIGIFLIGALLGEVAVWIAKILGYEYEEQPNVDFWQRLQDGEVLD
Ga0183683_1000322143300029309MarineMDKYSNPDVFIVLGGFVAIFLLGALLGEVAIFIAKMLGYEDVADQPNVDFMQRLQDGEVLNADNMFIKE
Ga0183683_102421133300029309MarineMDKYSNPDVFIVFGGFVAIFLIGALLGEVAVLIAKMLGYEDVADKPNVDFMQRLQDGEVLDADNMFSNE
Ga0185543_102708013300029318MarineMDKYSNPDAFIVLGGFVTIFLIGALLGEVAVFIAKMLGYEDVADKPNVDFMQRLQDGEILHADNMFSNE
Ga0185543_107947223300029318MarineMDKYSDPDVFIVLVGFIGIFLVGALLGEVAVWVAKILGYEYEEKPNVDFWQRLQDGEVLDADNMFSNGN
Ga0183826_102709713300029792MarineMDKYSDPDVFIVLVGFIGIFFIGALLGEVAVWVAKILGYEYEEKPNVDFWQRLQDGEVLDADNMFSNE

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.