Basic Information | |
---|---|
Family ID | F062755 |
Family Type | Metagenome |
Number of Sequences | 130 |
Average Sequence Length | 47 residues |
Representative Sequence | MKVEKKEVVCIRLPESIKKKVDAEAKKMYLAPSKLVSIIVQKYYESKN |
Number of Associated Samples | 99 |
Number of Associated Scaffolds | 130 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | No |
Most common taxonomic group | Viruses |
% of genes with valid RBS motifs | 0.00 % |
% of genes near scaffold ends (potentially truncated) | 40.00 % |
% of genes from short scaffolds (< 2000 bps) | 74.62 % |
Associated GOLD sequencing projects | 87 |
AlphaFold2 3D model prediction | No |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Duplodnaviria (64.615 % of family members) |
NCBI Taxonomy ID | 2731341 |
Taxonomy | All Organisms → Viruses → Duplodnaviria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake (26.923 % of family members) |
Environment Ontology (ENVO) | Unclassified (56.154 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (63.846 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 56.25% β-sheet: 14.58% Coil/Unstructured: 29.17% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 130 Family Scaffolds |
---|---|---|
PF08299 | Bac_DnaA_C | 23.08 |
PF04404 | ERF | 6.15 |
PF13392 | HNH_3 | 3.08 |
PF13482 | RNase_H_2 | 3.08 |
PF14090 | HTH_39 | 1.54 |
PF10544 | T5orf172 | 1.54 |
PF05766 | NinG | 1.54 |
PF06199 | Phage_tail_2 | 1.54 |
PF00959 | Phage_lysozyme | 0.77 |
PF03837 | RecT | 0.77 |
PF04586 | Peptidase_S78 | 0.77 |
PF07120 | DUF1376 | 0.77 |
COG ID | Name | Functional Category | % Frequency in 130 Family Scaffolds |
---|---|---|---|
COG0593 | Chromosomal replication initiation ATPase DnaA | Replication, recombination and repair [L] | 23.08 |
COG3723 | Recombinational DNA repair protein RecT | Replication, recombination and repair [L] | 0.77 |
COG3740 | Phage head maturation protease | Mobilome: prophages, transposons [X] | 0.77 |
COG3756 | Uncharacterized conserved protein YdaU, DUF1376 family | Function unknown [S] | 0.77 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 70.00 % |
Unclassified | root | N/A | 30.00 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2046860005|LWAeNNiAF_GBUVFP102FRCNF | Not Available | 520 | Open in IMG/M |
3300002091|JGI24028J26656_1005417 | All Organisms → cellular organisms → Bacteria | 1911 | Open in IMG/M |
3300002092|JGI24218J26658_1007097 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2097 | Open in IMG/M |
3300002092|JGI24218J26658_1015422 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1132 | Open in IMG/M |
3300002092|JGI24218J26658_1035774 | Not Available | 588 | Open in IMG/M |
3300002098|JGI24219J26650_1005958 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2414 | Open in IMG/M |
3300002276|B570J29586_1007699 | Not Available | 1020 | Open in IMG/M |
3300002408|B570J29032_109265186 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 661 | Open in IMG/M |
3300002835|B570J40625_100012891 | Not Available | 14930 | Open in IMG/M |
3300002835|B570J40625_100024483 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 9918 | Open in IMG/M |
3300002835|B570J40625_100360571 | Not Available | 1435 | Open in IMG/M |
3300003393|JGI25909J50240_1029172 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1219 | Open in IMG/M |
3300003394|JGI25907J50239_1091559 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 595 | Open in IMG/M |
3300004240|Ga0007787_10067302 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1628 | Open in IMG/M |
3300004448|Ga0065861_1002215 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 12956 | Open in IMG/M |
3300004448|Ga0065861_1092044 | Not Available | 668 | Open in IMG/M |
3300005582|Ga0049080_10079395 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1123 | Open in IMG/M |
3300005584|Ga0049082_10240302 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 613 | Open in IMG/M |
3300005805|Ga0079957_1015623 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5496 | Open in IMG/M |
3300006484|Ga0070744_10035095 | All Organisms → Viruses → Predicted Viral | 1481 | Open in IMG/M |
3300006484|Ga0070744_10047015 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1267 | Open in IMG/M |
3300006484|Ga0070744_10161520 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 641 | Open in IMG/M |
3300006484|Ga0070744_10244786 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 507 | Open in IMG/M |
3300006641|Ga0075471_10234376 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae | 947 | Open in IMG/M |
3300006802|Ga0070749_10236557 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1038 | Open in IMG/M |
3300006802|Ga0070749_10637511 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Podoviridae → unclassified Podoviridae → crAss-like viruses → unclassified Crassvirales → Podoviridae sp. ctrTa16 | 573 | Open in IMG/M |
3300006805|Ga0075464_10838983 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 572 | Open in IMG/M |
3300006920|Ga0070748_1365068 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 507 | Open in IMG/M |
3300007276|Ga0070747_1264238 | Not Available | 596 | Open in IMG/M |
3300007560|Ga0102913_1225875 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 599 | Open in IMG/M |
3300007590|Ga0102917_1083810 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1125 | Open in IMG/M |
3300007620|Ga0102871_1077345 | Not Available | 964 | Open in IMG/M |
3300007973|Ga0105746_1033974 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1564 | Open in IMG/M |
3300008450|Ga0114880_1023292 | All Organisms → cellular organisms → Bacteria | 2855 | Open in IMG/M |
3300008450|Ga0114880_1061448 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1551 | Open in IMG/M |
3300009002|Ga0102810_1277404 | Not Available | 519 | Open in IMG/M |
3300009026|Ga0102829_1336101 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 507 | Open in IMG/M |
3300009151|Ga0114962_10125879 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1566 | Open in IMG/M |
3300009154|Ga0114963_10009000 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 6786 | Open in IMG/M |
3300009158|Ga0114977_10109245 | Not Available | 1673 | Open in IMG/M |
3300009159|Ga0114978_10045891 | Not Available | 3039 | Open in IMG/M |
3300009159|Ga0114978_10170684 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → unclassified Eubacteriales → Clostridiales bacterium | 1389 | Open in IMG/M |
3300009163|Ga0114970_10747052 | Not Available | 517 | Open in IMG/M |
3300009164|Ga0114975_10105531 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1628 | Open in IMG/M |
3300009164|Ga0114975_10674804 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 547 | Open in IMG/M |
3300009181|Ga0114969_10004939 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 10517 | Open in IMG/M |
3300009181|Ga0114969_10031402 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3664 | Open in IMG/M |
3300009181|Ga0114969_10094876 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1927 | Open in IMG/M |
3300009181|Ga0114969_10116595 | Not Available | 1706 | Open in IMG/M |
3300009181|Ga0114969_10118156 | Not Available | 1693 | Open in IMG/M |
3300009684|Ga0114958_10015320 | Not Available | 4586 | Open in IMG/M |
3300010157|Ga0114964_10025676 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3302 | Open in IMG/M |
3300010157|Ga0114964_10630943 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 502 | Open in IMG/M |
3300010158|Ga0114960_10446566 | Not Available | 626 | Open in IMG/M |
3300010158|Ga0114960_10527801 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 564 | Open in IMG/M |
3300010160|Ga0114967_10179997 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1152 | Open in IMG/M |
3300010885|Ga0133913_11346743 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1820 | Open in IMG/M |
3300010885|Ga0133913_13569304 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1012 | Open in IMG/M |
3300011009|Ga0129318_10080965 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 896 | Open in IMG/M |
3300011009|Ga0129318_10082068 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 892 | Open in IMG/M |
3300011114|Ga0151515_10737 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 13731 | Open in IMG/M |
3300011116|Ga0151516_10553 | Not Available | 17969 | Open in IMG/M |
3300012017|Ga0153801_1087773 | Not Available | 548 | Open in IMG/M |
3300014811|Ga0119960_1050081 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 688 | Open in IMG/M |
3300014811|Ga0119960_1059904 | Not Available | 650 | Open in IMG/M |
3300017716|Ga0181350_1115085 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 650 | Open in IMG/M |
3300017766|Ga0181343_1155075 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 638 | Open in IMG/M |
3300017785|Ga0181355_1134349 | Not Available | 1005 | Open in IMG/M |
3300017785|Ga0181355_1137477 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 992 | Open in IMG/M |
3300020151|Ga0211736_10662433 | Not Available | 501 | Open in IMG/M |
3300020159|Ga0211734_10581797 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 570 | Open in IMG/M |
3300020164|Ga0194037_1001531 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 16570 | Open in IMG/M |
3300020164|Ga0194037_1018589 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3143 | Open in IMG/M |
3300020172|Ga0211729_11063253 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 925 | Open in IMG/M |
3300020560|Ga0208852_1006123 | Not Available | 2673 | Open in IMG/M |
3300021354|Ga0194047_10079571 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1426 | Open in IMG/M |
3300021354|Ga0194047_10121017 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1092 | Open in IMG/M |
3300021519|Ga0194048_10000188 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 28601 | Open in IMG/M |
3300021600|Ga0194059_1242951 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 538 | Open in IMG/M |
3300021602|Ga0194060_10003553 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 10984 | Open in IMG/M |
3300021952|Ga0213921_1036977 | Not Available | 756 | Open in IMG/M |
3300021961|Ga0222714_10088891 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1989 | Open in IMG/M |
3300021961|Ga0222714_10128652 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1552 | Open in IMG/M |
3300021963|Ga0222712_10305685 | Not Available | 996 | Open in IMG/M |
3300022190|Ga0181354_1218500 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 559 | Open in IMG/M |
3300024343|Ga0244777_10258497 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1107 | Open in IMG/M |
3300024346|Ga0244775_10929954 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Weeksellaceae → Chryseobacterium group → Chryseobacterium → Chryseobacterium gleum | 689 | Open in IMG/M |
3300024500|Ga0255143_1031394 | Not Available | 882 | Open in IMG/M |
3300026478|Ga0255156_1097646 | Not Available | 515 | Open in IMG/M |
3300026931|Ga0209850_1004587 | Not Available | 1198 | Open in IMG/M |
3300027129|Ga0255067_1004308 | All Organisms → Viruses → Predicted Viral | 2349 | Open in IMG/M |
3300027133|Ga0255070_1006251 | Not Available | 2213 | Open in IMG/M |
3300027212|Ga0208554_1007969 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1703 | Open in IMG/M |
3300027281|Ga0208440_1040834 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1043 | Open in IMG/M |
3300027631|Ga0208133_1014645 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2090 | Open in IMG/M |
3300027631|Ga0208133_1060186 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 909 | Open in IMG/M |
3300027697|Ga0209033_1095602 | Not Available | 982 | Open in IMG/M |
3300027712|Ga0209499_1060133 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1529 | Open in IMG/M |
3300027733|Ga0209297_1036034 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2288 | Open in IMG/M |
3300027733|Ga0209297_1374808 | Not Available | 510 | Open in IMG/M |
3300027734|Ga0209087_1022635 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3073 | Open in IMG/M |
3300027741|Ga0209085_1064495 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1669 | Open in IMG/M |
3300027749|Ga0209084_1010203 | Not Available | 5733 | Open in IMG/M |
3300027749|Ga0209084_1340481 | Not Available | 553 | Open in IMG/M |
3300027754|Ga0209596_1000282 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 47590 | Open in IMG/M |
3300027754|Ga0209596_1000957 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 25628 | Open in IMG/M |
3300027754|Ga0209596_1022024 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3789 | Open in IMG/M |
3300027764|Ga0209134_10309937 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 535 | Open in IMG/M |
3300027777|Ga0209829_10213778 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 833 | Open in IMG/M |
3300027782|Ga0209500_10014865 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4668 | Open in IMG/M |
3300027785|Ga0209246_10042158 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1751 | Open in IMG/M |
3300027808|Ga0209354_10017795 | Not Available | 2831 | Open in IMG/M |
3300027896|Ga0209777_10510161 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 885 | Open in IMG/M |
3300027899|Ga0209668_10152456 | Not Available | 1402 | Open in IMG/M |
3300027969|Ga0209191_1036525 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2322 | Open in IMG/M |
3300028392|Ga0304729_1011440 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4110 | Open in IMG/M |
3300031707|Ga0315291_10499971 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1128 | Open in IMG/M |
3300031885|Ga0315285_10404694 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 974 | Open in IMG/M |
3300031999|Ga0315274_10720430 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1074 | Open in IMG/M |
3300032118|Ga0315277_10239356 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1947 | Open in IMG/M |
3300033992|Ga0334992_0169939 | Not Available | 1107 | Open in IMG/M |
3300033996|Ga0334979_0521695 | Not Available | 641 | Open in IMG/M |
3300034022|Ga0335005_0150223 | Not Available | 1481 | Open in IMG/M |
3300034051|Ga0335024_0498237 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 595 | Open in IMG/M |
3300034068|Ga0334990_0533958 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 622 | Open in IMG/M |
3300034082|Ga0335020_0344091 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 725 | Open in IMG/M |
3300034102|Ga0335029_0236092 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1190 | Open in IMG/M |
3300034102|Ga0335029_0488792 | Not Available | 718 | Open in IMG/M |
3300034107|Ga0335037_0725087 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 517 | Open in IMG/M |
3300034116|Ga0335068_0186651 | Not Available | 1096 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 26.92% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 9.23% |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 7.69% |
Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 6.15% |
Anoxic Zone Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Anoxic Zone Freshwater | 5.38% |
Estuarine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine | 5.38% |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 4.62% |
Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 4.62% |
Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 3.85% |
Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Lentic | 3.85% |
Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 3.08% |
Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 3.08% |
Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 2.31% |
Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 1.54% |
Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment | 1.54% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 1.54% |
Aquatic | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Aquatic | 1.54% |
Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 1.54% |
Marine | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine | 1.54% |
Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 0.77% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Sediment | 0.77% |
Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Lake | 0.77% |
Freshwater | Environmental → Aquatic → Freshwater → Creek → Unclassified → Freshwater | 0.77% |
Estuary Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water | 0.77% |
Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Sand | 0.77% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2046860005 | Sediment microbial communities from Lake Washington, Seattle, for Methane and Nitrogen Cycles, sample from SIP 13C-methane aerobic no nitrate additional fraction | Environmental | Open in IMG/M |
3300002091 | Lentic bog actinobacteria communities from Grosse Fuchskuhle, Germany - Sample acI-B2 co-culture F-F8 metagenome | Environmental | Open in IMG/M |
3300002092 | Lentic bog actinobacteria communities from Grosse Fuchskuhle, Germany - Sample acI-B2 co-culture F-B6 metagenome | Environmental | Open in IMG/M |
3300002098 | Lentic bog actinobacteria communities from Grosse Fuchskuhle, Germany - Sample acI-B2 co-culture F-B7 metagenome | Environmental | Open in IMG/M |
3300002276 | Freshwater microbial communities from Lake Mendota, WI - 09JUN2009 deep hole epilimnion ns | Environmental | Open in IMG/M |
3300002408 | Freshwater microbial communities from Lake Mendota, WI, sample - 15JUL2010 deep hole epilimnion (Lake Mendota Combined assembly, ASSEMBLY_DATE=20140123) | Environmental | Open in IMG/M |
3300002835 | Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605) | Environmental | Open in IMG/M |
3300003393 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.DD | Environmental | Open in IMG/M |
3300003394 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SN | Environmental | Open in IMG/M |
3300004240 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.SN | Environmental | Open in IMG/M |
3300004448 | Marine viral communities from Newfoundland, Canada BC-1 | Environmental | Open in IMG/M |
3300005582 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF | Environmental | Open in IMG/M |
3300005584 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG HU45MSRF | Environmental | Open in IMG/M |
3300005805 | Microbial and algae communities from Cheney Reservoir in Wichita, Kansas, USA | Environmental | Open in IMG/M |
3300006484 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535 | Environmental | Open in IMG/M |
3300006641 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_>0.8_DNA | Environmental | Open in IMG/M |
3300006802 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 | Environmental | Open in IMG/M |
3300006805 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA | Environmental | Open in IMG/M |
3300006920 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 | Environmental | Open in IMG/M |
3300007276 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 | Environmental | Open in IMG/M |
3300007560 | Estuarine microbial communities from the Columbia River estuary - metaG 1560A-02 | Environmental | Open in IMG/M |
3300007590 | Estuarine microbial communities from the Columbia River estuary - metaG 1562A-02 | Environmental | Open in IMG/M |
3300007620 | Estuarine microbial communities from the Columbia River estuary - metaG 1546C-02 | Environmental | Open in IMG/M |
3300007973 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460A_0.2um | Environmental | Open in IMG/M |
3300008450 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - Oct 27, 2014 all contigs | Environmental | Open in IMG/M |
3300009002 | Estuarine microbial communities from the Columbia River estuary - Ebb tide ETM metaG S.573 | Environmental | Open in IMG/M |
3300009026 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.575 | Environmental | Open in IMG/M |
3300009151 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_MF_MetaG | Environmental | Open in IMG/M |
3300009154 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_EF_MetaG | Environmental | Open in IMG/M |
3300009158 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG | Environmental | Open in IMG/M |
3300009159 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG | Environmental | Open in IMG/M |
3300009163 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140205_XF_MetaG | Environmental | Open in IMG/M |
3300009164 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaG | Environmental | Open in IMG/M |
3300009181 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG | Environmental | Open in IMG/M |
3300009684 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130208_EF_MetaG | Environmental | Open in IMG/M |
3300010157 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_MF_MetaG | Environmental | Open in IMG/M |
3300010158 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_MF_MetaG | Environmental | Open in IMG/M |
3300010160 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130628_MF_MetaG | Environmental | Open in IMG/M |
3300010885 | northern Canada Lakes Co-assembly | Environmental | Open in IMG/M |
3300011009 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_0.1_0.8_DNA | Environmental | Open in IMG/M |
3300011114 | Freshwater viral communities from Lake Soyang, Gangwon-do, South Korea - SYL_2016Feb | Environmental | Open in IMG/M |
3300011116 | Freshwater viral communities from Lake Soyang, Gangwon-do, South Korea - SYL_2015Nov | Environmental | Open in IMG/M |
3300012017 | Freshwater microbial communities from Central Basin Lake Erie, Ontario, Canada - Station 1208 - Top - Depth 1m | Environmental | Open in IMG/M |
3300014811 | Aquatic viral communities from ballast water - Michigan State University - AB_ballast water | Environmental | Open in IMG/M |
3300017716 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.DCM.D | Environmental | Open in IMG/M |
3300017766 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.S.D | Environmental | Open in IMG/M |
3300017785 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.D.N | Environmental | Open in IMG/M |
3300020151 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_202 megahit1 | Environmental | Open in IMG/M |
3300020159 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_108 megahit1 | Environmental | Open in IMG/M |
3300020164 | Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Jun2016-L304-6m | Environmental | Open in IMG/M |
3300020172 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_102 megahit1 | Environmental | Open in IMG/M |
3300020560 | Freshwater microbial communities from Lake Mendota, WI - 18JUN2009 deep hole epilimnion ns (SPAdes) | Environmental | Open in IMG/M |
3300021354 | Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Jun2016-L221-5m | Environmental | Open in IMG/M |
3300021519 | Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Jun2016-L222-5m | Environmental | Open in IMG/M |
3300021600 | Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Sep2016-L626-11m | Environmental | Open in IMG/M |
3300021602 | Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Sep2016-L222-5m | Environmental | Open in IMG/M |
3300021952 | Freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 20-17 MG | Environmental | Open in IMG/M |
3300021961 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_3D | Environmental | Open in IMG/M |
3300021963 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_657D | Environmental | Open in IMG/M |
3300022190 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.N | Environmental | Open in IMG/M |
3300024343 | Combined assembly of estuarine microbial communities from Columbia River, Washington, USA >3um size fraction | Environmental | Open in IMG/M |
3300024346 | Whole water sample coassembly | Environmental | Open in IMG/M |
3300024500 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Cont_RepC_0h | Environmental | Open in IMG/M |
3300026478 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atlam_RepA_8h | Environmental | Open in IMG/M |
3300026931 | Groundwater microbial communities from the Columbia River, Washington, USA, for microbe roles in carbon and contaminant biogeochemistry - GW-RW metaG T2_23-Sept-14 (SPAdes) | Environmental | Open in IMG/M |
3300027129 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Cont_RepB_8h | Environmental | Open in IMG/M |
3300027133 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Miss_RepB_8h | Environmental | Open in IMG/M |
3300027212 | Estuarine microbial communities from the Columbia River estuary - metaG 1371B-02 (SPAdes) | Environmental | Open in IMG/M |
3300027281 | Estuarine microbial communities from the Columbia River estuary - metaG 1547B-02 (SPAdes) | Environmental | Open in IMG/M |
3300027631 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535 (SPAdes) | Environmental | Open in IMG/M |
3300027697 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.DN (SPAdes) | Environmental | Open in IMG/M |
3300027712 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130208_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027733 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027734 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027741 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027749 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027754 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027764 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MLB.SN (SPAdes) | Environmental | Open in IMG/M |
3300027777 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_140205_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027782 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027785 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SN (SPAdes) | Environmental | Open in IMG/M |
3300027808 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.DD (SPAdes) | Environmental | Open in IMG/M |
3300027896 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies -HBP12 HB (SPAdes) | Environmental | Open in IMG/M |
3300027899 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - PLP11 PL (SPAdes) | Environmental | Open in IMG/M |
3300027969 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300028392 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_MF_MetaG (v2) | Environmental | Open in IMG/M |
3300031707 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G12_20 | Environmental | Open in IMG/M |
3300031885 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_36 | Environmental | Open in IMG/M |
3300031999 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_20 | Environmental | Open in IMG/M |
3300032118 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G05_15 | Environmental | Open in IMG/M |
3300033992 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME16Jun2014-rr0035 | Environmental | Open in IMG/M |
3300033996 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2016-rr0004 | Environmental | Open in IMG/M |
3300034022 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Apr2018-rr0058 | Environmental | Open in IMG/M |
3300034051 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME13May2013-rr0097 | Environmental | Open in IMG/M |
3300034068 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME13Apr2016-rr0031 | Environmental | Open in IMG/M |
3300034082 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME05Jun2015-rr0088 | Environmental | Open in IMG/M |
3300034102 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jul2002-rr0112 | Environmental | Open in IMG/M |
3300034107 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME21Apr2017-rr0133 | Environmental | Open in IMG/M |
3300034116 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-CONTROL-GENDONOR | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
LWAeNNiAF_593710 | 2046860005 | Freshwater Sediment | MKVEKKEVVCIRLPESIKKKVDAEAKKMYLAPSKLVSIIVQMYYEKL |
JGI24028J26656_10054174 | 3300002091 | Lentic | MKVEKKEVVCIRLPESIKKKVDAEAKKMYLAPSKLVSIIVQKYYETKN* |
JGI24218J26658_10070975 | 3300002092 | Lentic | MKKEKQEVVCIRLPELIKKKVDAEAKKMYLAPSKLVSIIVQKYYETKN* |
JGI24218J26658_10154224 | 3300002092 | Lentic | VEKKEVVCIRLPESIKKKVDAEAKKMYLAPSKLVSIIVQKYYETKN* |
JGI24218J26658_10357741 | 3300002092 | Lentic | MKVEKKEVVCIRLPESIKKKVDNEAKKMYLAPSKLVSIIVQKYYETKNQ* |
JGI24219J26650_100595812 | 3300002098 | Lentic | MKIEKKEVVCIRLPESIKKKVDAEAKKMYLAPSKLV |
B570J29586_10076993 | 3300002276 | Freshwater | MKKELKEKQVIMCIRLPETIKKKVDAEAKKMYLAPSKLVSIIVQKYYEKL* |
B570J29032_1092651861 | 3300002408 | Freshwater | KNMKVEKKEVVCIRLPESIKKKVDAEAKKMYLAASKLVSIIVQKYYESKN* |
B570J40625_10001289121 | 3300002835 | Freshwater | MKVEKKEVVCIRLPESIKKKVDAEAKKMYLAPSKLVSIIVQKYYEKL* |
B570J40625_10002448320 | 3300002835 | Freshwater | MKVEKKEVVCIRLPESIKKKVDAEAKKMYLAPSKLVSIIVQMYYEKL* |
B570J40625_1003605711 | 3300002835 | Freshwater | MKTEKKEVVCIRLPESIKKKVDAEAKKMYLAPSKLVSIIVQKYYESKN* |
JGI25909J50240_10291721 | 3300003393 | Freshwater Lake | VEKKEVVCIRLPESIKKKVDAEAKKMYLAPSKLVSIIVQMYYEKL* |
JGI25907J50239_10915591 | 3300003394 | Freshwater Lake | MKVEKKEVVCIRLPESTKKKVDAEAKKMYLAPSKLVSIIVQKYYESKN* |
Ga0007787_100673023 | 3300004240 | Freshwater Lake | MKVEKKEVVCIRLPESIKKKVDAEAKKMYLAPSKLVSIIVQKYYESKN* |
Ga0065861_100221512 | 3300004448 | Marine | MKVEKKEVVCIRLPESIKKKVDAEAKKMYLAPSKLVSIIVQKYYEPKNQ* |
Ga0065861_10920443 | 3300004448 | Marine | MKVEKKEVVCIRLPESIKKKVDAEAKKMYLAPSKLVSIIVQKYYETKNQ* |
Ga0049080_100793955 | 3300005582 | Freshwater Lentic | MKVEKKEVVCIRLPESIKKKVDAEAKKMYLAPSKLVSIIVQKYYEKP* |
Ga0049082_102403022 | 3300005584 | Freshwater Lentic | MKVEKKEVVCIRLPESIKKKVDTEAKKMYLAPSKLVSIIVQKYYESKN* |
Ga0079957_101562314 | 3300005805 | Lake | MKVEKKEVVCIRLPETIKKKVDAEAKKMYLAPSKLVSIIVQMYYEKI* |
Ga0070744_100350954 | 3300006484 | Estuarine | MKKELKEKQVIMCIRLPESIKKKVDAEAKKMYLAPSKLVSIIVQMYYEKL* |
Ga0070744_100470153 | 3300006484 | Estuarine | MKKELKEKQVIMCIRLPESIKKKVDAEAKKMYLAPSKLVSIIVQLYYEKL* |
Ga0070744_101615202 | 3300006484 | Estuarine | MKVEKKEVVCIRLPETIKKKVDAEAKKMYLAPSKLVSIIVQKYYEKP* |
Ga0070744_102447861 | 3300006484 | Estuarine | EVVCIRLPESIKKKVDAEAKKMYLAPSKLVSIIVQMYYEKL* |
Ga0075471_102343762 | 3300006641 | Aqueous | MKKEKQEVVCIRLPESIKKKVDAEAKKMYLAPSKLVSIIVQKYYESKN* |
Ga0070749_102365574 | 3300006802 | Aqueous | MKVEKKEVVCIRLPETIKKKVDAEAKKMYLAPSKLVSIIVQKYYEKL* |
Ga0070749_106375112 | 3300006802 | Aqueous | MKVEKKEVVCIRLPESIKKKVDAEAKKMYLAPSKLVSVIVQ |
Ga0075464_108389832 | 3300006805 | Aqueous | MKVEKKEVVCIRLPESIKKKVDAEAKKMYLAPSKLVSIIVQKYYEPKN* |
Ga0070748_13650682 | 3300006920 | Aqueous | MKKELKEKQVIMCIRLPETIKKKVDAEAKKMYLAPSKLVSIIVQKYYEKP* |
Ga0070747_12642382 | 3300007276 | Aqueous | MKKELKEKQVIMCIRLPETIKKKVDAEAKKMYLAPSKLVSIIVQKYYENYKL* |
Ga0102913_12258752 | 3300007560 | Estuarine | MKVEKKEVVCIRLPESNKKKVDAEAKKMYLAPSKLVSIIVQKYYESKN* |
Ga0102917_10838101 | 3300007590 | Estuarine | EKKEVVCIRLPESIKKKVDAEAKKMYLAPSKLVSIIVQKYYESKN* |
Ga0102871_10773453 | 3300007620 | Estuarine | MKVEKKEVVCIRLPESIKKKVDAEAKKMYLAPSKLVSIIVQMYYE |
Ga0105746_10339744 | 3300007973 | Estuary Water | MKVEKKEVVCIRLPESIKKKVDAEAKKMYLAPSKLVSIIVQKY |
Ga0114880_10232921 | 3300008450 | Freshwater Lake | VCIRLPETIKKKVDAEAKKMYLAPSKLVSIIVQKYYEKP* |
Ga0114880_10614482 | 3300008450 | Freshwater Lake | VLIYKTYKNQNMKVEKKEVVCIRLPETIKKKVDAEAKKMYLAPSKLVSIIVQKYYEKP* |
Ga0102810_12774042 | 3300009002 | Estuarine | MKVEKKEVVCIRLPESIKKKVDAEAKKMYLAPSKLVSISVQMYYEKL* |
Ga0102829_13361011 | 3300009026 | Estuarine | LCKTFNLMKVEKKEVVCIRLPESIKKKVDAEAKKMYLTPSKLVSIIVQKYYESKN* |
Ga0114962_101258794 | 3300009151 | Freshwater Lake | MKTEQKEVVCIRLPESIKKKVDAEAKRMYLAPSKLVSIIVQKYYEPKNQ* |
Ga0114963_1000900010 | 3300009154 | Freshwater Lake | MKTEKKEVVCIRLPESIKKKVDAEAKRMYLAPSKLVSIIVQKYYEPKNQ* |
Ga0114977_101092456 | 3300009158 | Freshwater Lake | MKVEKKEVVCIRLPETIKKKVDAEAKKMYLAPSKLVSIIVQ |
Ga0114978_100458912 | 3300009159 | Freshwater Lake | MKVEKKEVVCIRLPESIKKKVDAQAKKMYLAPSKLVSIIVEMYYIEKP* |
Ga0114978_101706844 | 3300009159 | Freshwater Lake | MKTEKKEVVCIRLPESIKKKIDAEAKKMYLAPSKLVSIIVQKYYESKN* |
Ga0114970_107470521 | 3300009163 | Freshwater Lake | MKKEKQEVVCIRLPQLIKKKVDAEAKKMYLAPSKLVSIIVQKYYESKN* |
Ga0114975_101055311 | 3300009164 | Freshwater Lake | HLKQNMKVEKKEVVCIRLPESIKKKVDAEAKKMYLAPSKLVSIIVQKYYEPKN* |
Ga0114975_106748041 | 3300009164 | Freshwater Lake | MKIEKKEVVCIRLPESIKKKVDAEAKKMYLAPSKLVSIIVQKYYETKNQ* |
Ga0114969_1000493912 | 3300009181 | Freshwater Lake | MKVEKKEVVCIRLPESIKKKVDAEAKKMYLASSKLVSIIVQKYYETKNQ* |
Ga0114969_1003140210 | 3300009181 | Freshwater Lake | MKVEKKEVVCIRLPESIKKKVDAEAKKMYLVPSKLLSIIVQKYYEPKNQ* |
Ga0114969_100948767 | 3300009181 | Freshwater Lake | CIRLPESIKKKIDAEAKKMYLAPSKLVSIIVQKYYESKN* |
Ga0114969_101165955 | 3300009181 | Freshwater Lake | MKKEKQEVVCIRLPELIKKKVDAEAKKMYLAPSKLVSIIVQKYYESKN* |
Ga0114969_101181563 | 3300009181 | Freshwater Lake | MKVEKKEVVCIRLPESIKKKIDAEAKKMYLAPSKLVSIIVQKYYESKN* |
Ga0114958_100153209 | 3300009684 | Freshwater Lake | MKTEKKEIVCIRLPESIKKKVDAEAKKMYLAPSKLVSIIVQKYYESKN* |
Ga0114964_100256765 | 3300010157 | Freshwater Lake | MKTEKKEVVCIRLPESIKKKVDAEAKKMYLAPSKLVSIIVQKYYESKNQ* |
Ga0114964_106309431 | 3300010157 | Freshwater Lake | EVVCIRLPESIKKKVDAEAKKMYLAPSKLVSIIVQKYYEPKNQ* |
Ga0114960_104465663 | 3300010158 | Freshwater Lake | MKKEKQEVVCIRLPESIKKKVDAEAKKMYLAPSKLVSIIVLKYYESKN* |
Ga0114960_105278011 | 3300010158 | Freshwater Lake | CIRLPESIKKKVDAEAKKMYLAPSKLVSIIVQKYYESKN* |
Ga0114967_101799971 | 3300010160 | Freshwater Lake | KHLNQNMKVEKKEVVCIRLPESIKKKVDAEAKKMYLAPSKLVSIIVQKYYESKN* |
Ga0133913_113467434 | 3300010885 | Freshwater Lake | MKVEKKEVVCIRLPESTKKKVDAEAKKMYLAPSKLVSIIVQKYYETKNQ* |
Ga0133913_135693041 | 3300010885 | Freshwater Lake | MKVEKKEVVCIRLPESIKKKVDAEAKKMYLAPSKLVYIIVQKYYETKNQ* |
Ga0129318_100809653 | 3300011009 | Freshwater To Marine Saline Gradient | MKVEKKEVVCIRLPESIKKKVDAEAKKMYLAPSKLVSIIVQMYYVEKP* |
Ga0129318_100820684 | 3300011009 | Freshwater To Marine Saline Gradient | MKVEKKEVVCIRLPESIKKKVDAEAKKMYLAPSKLVSIIVQLYYEKL* |
Ga0151515_1073718 | 3300011114 | Freshwater | MKKEKQEVVCIRLPESIKKKVDAEAKKMYLASSKLVSIIVQKYYEPKN* |
Ga0151516_1055325 | 3300011116 | Freshwater | MKKEKQEVVCIRLPESIKKKVDAEAKKMYLASSKLVSII |
Ga0153801_10877731 | 3300012017 | Freshwater | MKTEKKEVVCIRLPESIKKKVDAEAKKMYLAPSKLVSIIVQKYYETKN* |
Ga0119960_10500811 | 3300014811 | Aquatic | MKTEKKEVVCIRLPESIKKKVDAEAKKMYLASSKLVSIIVQKYYESKN* |
Ga0119960_10599043 | 3300014811 | Aquatic | MKVEKKEVVCIRLPESIKKKVDAEAKKIYLAPSKLVSIIVQKYYESKN* |
Ga0181350_11150853 | 3300017716 | Freshwater Lake | YAKHLNQNMKTEKKAVVCIRLPESTKKKVDAEAKKMYLAPSKLVSIIVQKYYETKN |
Ga0181343_11550752 | 3300017766 | Freshwater Lake | MKTEKKEVVCIRLPESIKKKVDAEAKKMYLAPSKLVSIIVQMYYEKL |
Ga0181355_11343494 | 3300017785 | Freshwater Lake | MKVEKKEVVCIRLPESIKKKVDAEAKKMYLAPSKLVSIIVQK |
Ga0181355_11374774 | 3300017785 | Freshwater Lake | KVEKKEVVCIRLPESIKKKVDAEAKKMYLAPSKLVSIIVQKYYEKL |
Ga0211736_106624333 | 3300020151 | Freshwater | MKKELKEKQVIMCIRLPESIKKKVDAEAKKMYLAPSK |
Ga0211734_105817971 | 3300020159 | Freshwater | PESIKKKVDAEAKKMYLAPSKLVSIIVQKYYESKN |
Ga0194037_100153132 | 3300020164 | Anoxic Zone Freshwater | MKKEKQEVVCIRLPESIKKKVDAEAKKMYLAPSKLVSIIVQKYYESKN |
Ga0194037_10185892 | 3300020164 | Anoxic Zone Freshwater | MKVEKKEVVCIRLPESIKKKVDAEAKKMYLAPSKLVSIIVQKYYEPKNQ |
Ga0211729_110632533 | 3300020172 | Freshwater | MKKELKEKQVIMCIRLPESIKKKVDAEAKKMYLAPSKLVSIIVQMYYEKL |
Ga0208852_10061234 | 3300020560 | Freshwater | MKKELKEKQVIMCIRLPETIKKKVDAEAKKMYLAPSKLVSIIVQKYYEKL |
Ga0194047_100795711 | 3300021354 | Anoxic Zone Freshwater | MKVEKKEVVCIRLPESIKKKVDVEAKKMYLAPSKLVSIIVQKYYETKNQ |
Ga0194047_101210172 | 3300021354 | Anoxic Zone Freshwater | MKTEKKEVVCIRLPESIKKKVDAEAKKMYLAPSKLVSIIVQKYYESKN |
Ga0194048_1000018810 | 3300021519 | Anoxic Zone Freshwater | MKVEKKEVVCIRLPESIKKKVDAEAKKMYLAPSKLVSIIVQKYYETKNQ |
Ga0194059_12429512 | 3300021600 | Anoxic Zone Freshwater | MKVEKKEVVCIRLPESIKKKVDAEAKKMYLAPSKLVSIIVQKYYESKNQ |
Ga0194060_1000355319 | 3300021602 | Anoxic Zone Freshwater | MKVEKKEVVCIRLPESIKKKVDAEAKKMYLAPSKLVSLIIQKYYEKP |
Ga0213921_10369773 | 3300021952 | Freshwater | MKKEKQEVVCIRLPESIKKKVDAEAKKMYLAPSKLVSIIVQKNYEPKN |
Ga0222714_100888914 | 3300021961 | Estuarine Water | MKVEKKEVVCIRLPESIKKKVDAEAKKMYLAPSKLVSVIVQKYYEKP |
Ga0222714_101286524 | 3300021961 | Estuarine Water | MKVEKKEVVCIRLPESIKKKVDAEAKKMYLAPSKLVSIIVQMYYVEKP |
Ga0222712_103056851 | 3300021963 | Estuarine Water | MKTEKKEVVCIRLPESIKKKIDAEAKKMYLAPSKLVSIIVQKYYESKN |
Ga0181354_12185002 | 3300022190 | Freshwater Lake | TKHLNQNMKVEKKEVVCIRLPESIKKKVDAEAKKMYLAPSKLVSIIVQKYYESKN |
Ga0244777_102584974 | 3300024343 | Estuarine | MKTEKKEVVCIRLPELIKKKVDAEAKKMYLAPSKLVSIIVQKYYESKN |
Ga0244775_109299542 | 3300024346 | Estuarine | VCIRLPESIKKKVDAEAKKMYLAPSKLVSIIVQLYYEKL |
Ga0255143_10313944 | 3300024500 | Freshwater | MKKEKQEVLCIRLPESIKKKVDAEAKKMYLAPSKLVSIIVQKNYEPKN |
Ga0255156_10976463 | 3300026478 | Freshwater | QEVLCIRLPESIKKKVDAEAKKMYLAPSKLVSIIVQKNYEPKN |
Ga0209850_10045875 | 3300026931 | Sand | MKVEKKEVVCIRLPESIKKKVDAEAKKMYLAPSKLVSIIVQKYYE |
Ga0255067_10043089 | 3300027129 | Freshwater | QESYKTFNLMKTEKKEVVCIRLPESIKKKVDAEAKKMYLAPSKLVSIIVQKYYESKN |
Ga0255070_10062511 | 3300027133 | Freshwater | MKTEKKEVVCIRLPESIKKKVDAEAKKMYLAPSKLVSI |
Ga0208554_10079692 | 3300027212 | Estuarine | MKVEKKEVVCIRLPESIKKKVDAQAKKMYLAPSKLVSIIVQKYYEKP |
Ga0208440_10408341 | 3300027281 | Estuarine | CIRLPESIKKKVDAEAKKMYLAPSKLVSIIVQKYYESKN |
Ga0208133_10146458 | 3300027631 | Estuarine | KKEVVCIRLPESIKKKVDAEAKKMYLAPSKLVSIIVQKYYEKL |
Ga0208133_10601861 | 3300027631 | Estuarine | IRLPESIKKKVDAEAKKMYLAPSKLVSIIVQKYYESKN |
Ga0209033_10956021 | 3300027697 | Freshwater Lake | MKVEKKEVVCIRLPESIKKKVDAEAKKMYLAPSKLV |
Ga0209499_10601334 | 3300027712 | Freshwater Lake | MKTEKKEIVCIRLPESIKKKVDAEAKKMYLAPSKLVSIIVQKYYESKN |
Ga0209297_10360341 | 3300027733 | Freshwater Lake | NLMKVEKKEVVCIRLPESIKKKVDAEAKKMYLAPSKLVSIIVQKYYEPKN |
Ga0209297_13748081 | 3300027733 | Freshwater Lake | MKVEKKEVVCIRLPESIKKKVDAEAKKMYLAPSKLVSIIVQ |
Ga0209087_10226355 | 3300027734 | Freshwater Lake | MKVEKKEVVCIRLPESIKKKVDAEAKKMYLAPSKLVSIIVQKYYEPKN |
Ga0209085_10644954 | 3300027741 | Freshwater Lake | MKTEKKEVVCIRLPESIKKKVDAEAKRMYLAPSKLVSIIVQKYYEPKNQ |
Ga0209084_10102034 | 3300027749 | Freshwater Lake | MKKEKQEVVCIRLPESIKKKVDAEAKKMYLAPSKLVSIIVLKYYESKN |
Ga0209084_13404813 | 3300027749 | Freshwater Lake | QEVVCIRLPESIKKKVDAEAKKMYLAPSKLVSIIVQKYYESKN |
Ga0209596_100028225 | 3300027754 | Freshwater Lake | MKVEKKEVVCIRLPESIKKKVDAEAKKMYLASSKLVSIIVQKYYETKNQ |
Ga0209596_10009574 | 3300027754 | Freshwater Lake | MKKEKQEVVCIRLPELIKKKVDAEAKKMYLAPSKLVSIIVQKYYESKN |
Ga0209596_10220248 | 3300027754 | Freshwater Lake | MKVEKKEVVCIRLPESIKKKIDAEAKKMYLAPSKLVSIIVQKYYESKN |
Ga0209134_103099372 | 3300027764 | Freshwater Lake | VVCIRLPESIKKKVDAEAKKMYLAPSKLVSIIVQKYYESKN |
Ga0209829_102137781 | 3300027777 | Freshwater Lake | MKTEKKEVVCIRLPESIKKKVDAEAKKMYLAPSKLVSIIVQKYYEPKNQ |
Ga0209500_100148655 | 3300027782 | Freshwater Lake | MKVEKKEVVCIRLPESIKKKVDAQAKKMYLAPSKLVSIIVEMYYIEKP |
Ga0209246_100421584 | 3300027785 | Freshwater Lake | MKVEKKEVVCIRLPESTKKKVDAEAKKMYLAPSKLVSIIVQKYYESKN |
Ga0209354_100177951 | 3300027808 | Freshwater Lake | MKTEKKAVVCIRLPESTKKKVDAEAKKMYLAPSKLVSIIVQKYYETKN |
Ga0209777_105101612 | 3300027896 | Freshwater Lake Sediment | MKTEKTEVVCIRLPESIKKKVDAEAKKMYLAPSKLVSIIVQKYYEPKNQ |
Ga0209668_101524561 | 3300027899 | Freshwater Lake Sediment | MKVEKKEVVCIRLPESIKKKVDAEAKKMYLAPSKLVSIIVQM |
Ga0209191_10365259 | 3300027969 | Freshwater Lake | EKKEVVCIRLPESIKKKVDAEAKKMYLAPSKLVSIIVQKYYEPKN |
Ga0304729_101144011 | 3300028392 | Freshwater Lake | MKTEKKEVVCIRLPESIKKKVDAEAKKMYLAPSKLVSIIVQKYYESKNQ |
Ga0315291_104999712 | 3300031707 | Sediment | MKVEKKEVVCIRLAESIKKKVDAEAKKMYLAPSKLVSIIVQKYYESKN |
Ga0315285_104046941 | 3300031885 | Sediment | IRLPESIKKKVDAEAKKMYLAPSKLVSIIVQMYYEKL |
Ga0315274_107204301 | 3300031999 | Sediment | NQNMKVEKKEVVCIRLPESIKKKVDAESKKMYLAPSKLVSIIVQKYYESKN |
Ga0315277_102393561 | 3300032118 | Sediment | EKKEVVCIRLPESIKKKVDAEAKKMYLAPSKLVSIIVQKYYESKN |
Ga0334992_0169939_1_111 | 3300033992 | Freshwater | MKVEKKEVVCIRLPESIKKKVDAEAKKMYLAPSKLVS |
Ga0334979_0521695_34_177 | 3300033996 | Freshwater | MKVEKKEVVCIRLPESIKKKVDAEAKKMYLAPSKLVSIIVQMYYEKP |
Ga0335005_0150223_123_275 | 3300034022 | Freshwater | MKKELKEKQVIMCIRLPESIKKKVDAEAKKMYLAPSKLVSIIVQKYYEKL |
Ga0335024_0498237_476_595 | 3300034051 | Freshwater | VCIRLPESIKKKVDAEAKKMYLAPSKLVSIIVQKYYEKL |
Ga0334990_0533958_483_620 | 3300034068 | Freshwater | VEKKEVVCIRLPESIKKKVDAEAKKMYLAPSKLVSIIVQMYYEKP |
Ga0335020_0344091_3_122 | 3300034082 | Freshwater | VCIRLPETIKKKVDAEAKKMYLAPSKLVSIIVQKYYEKP |
Ga0335029_0236092_1054_1188 | 3300034102 | Freshwater | EKKEVVCIRLPESIKKKVDAEAKKMYLAPSKLVSIIVQKYYEKL |
Ga0335029_0488792_18_164 | 3300034102 | Freshwater | MKVEKKEVVCIRLPESIKKKVDAEAKKMYLAPSKLVSIIVKMYYVEKP |
Ga0335037_0725087_284_436 | 3300034107 | Freshwater | MKKELKEKQVIMCIRLPESIKKKVDAEAKKMYLAPSKLVSIIVQKYYEKP |
Ga0335068_0186651_954_1094 | 3300034116 | Freshwater | MKTEKKEVVCIRLPESIKKKVDAEAKKMYLAPSKLVSIIVQKYYESK |
⦗Top⦘ |