| Basic Information | |
|---|---|
| Family ID | F062754 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 130 |
| Average Sequence Length | 45 residues |
| Representative Sequence | MKKLTKKEQEEIKMKLAYFDKIVKDTRELIKQGYTVPDLSSLVRPSR |
| Number of Associated Samples | 103 |
| Number of Associated Scaffolds | 130 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 34.62 % |
| % of genes near scaffold ends (potentially truncated) | 42.31 % |
| % of genes from short scaffolds (< 2000 bps) | 80.77 % |
| Associated GOLD sequencing projects | 99 |
| AlphaFold2 3D model prediction | No |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (50.000 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater (15.385 % of family members) |
| Environment Ontology (ENVO) | Unclassified (52.308 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (62.308 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 61.70% β-sheet: 0.00% Coil/Unstructured: 38.30% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 130 Family Scaffolds |
|---|---|---|
| PF00303 | Thymidylat_synt | 56.92 |
| PF00186 | DHFR_1 | 7.69 |
| PF07460 | NUMOD3 | 2.31 |
| PF01467 | CTP_transf_like | 2.31 |
| PF01521 | Fe-S_biosyn | 1.54 |
| PF01541 | GIY-YIG | 1.54 |
| PF00149 | Metallophos | 1.54 |
| PF02562 | PhoH | 0.77 |
| PF16363 | GDP_Man_Dehyd | 0.77 |
| PF07883 | Cupin_2 | 0.77 |
| PF07963 | N_methyl | 0.77 |
| PF01661 | Macro | 0.77 |
| PF01583 | APS_kinase | 0.77 |
| PF09643 | YopX | 0.77 |
| COG ID | Name | Functional Category | % Frequency in 130 Family Scaffolds |
|---|---|---|---|
| COG0207 | Thymidylate synthase | Nucleotide transport and metabolism [F] | 56.92 |
| COG0262 | Dihydrofolate reductase | Coenzyme transport and metabolism [H] | 7.69 |
| COG0316 | Fe-S cluster assembly iron-binding protein IscA | Posttranslational modification, protein turnover, chaperones [O] | 1.54 |
| COG4841 | Uncharacterized conserved protein YneR, related to HesB/YadR/YfhF family | Function unknown [S] | 1.54 |
| COG0529 | Adenylylsulfate kinase or related kinase | Inorganic ion transport and metabolism [P] | 0.77 |
| COG1702 | Phosphate starvation-inducible protein PhoH, predicted ATPase | Signal transduction mechanisms [T] | 0.77 |
| COG1875 | Predicted ribonuclease YlaK, contains NYN-type RNase and PhoH-family ATPase domains | General function prediction only [R] | 0.77 |
| COG2110 | O-acetyl-ADP-ribose deacetylase (regulator of RNase III), contains Macro domain | Translation, ribosomal structure and biogenesis [J] | 0.77 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 50.00 % |
| Unclassified | root | N/A | 50.00 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000882|FwDRAFT_10030499 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 1617 | Open in IMG/M |
| 3300002274|B570J29581_101992 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Demerecviridae → Markadamsvirinae → Tequintavirus | 1351 | Open in IMG/M |
| 3300002835|B570J40625_100020437 | Not Available | 11192 | Open in IMG/M |
| 3300002835|B570J40625_100432095 | All Organisms → cellular organisms → Bacteria | 1265 | Open in IMG/M |
| 3300003277|JGI25908J49247_10134824 | Not Available | 580 | Open in IMG/M |
| 3300003388|JGI25910J50241_10109694 | Not Available | 751 | Open in IMG/M |
| 3300003488|JGI25919J51413_1017588 | Not Available | 556 | Open in IMG/M |
| 3300004112|Ga0065166_10254046 | Not Available | 707 | Open in IMG/M |
| 3300005417|Ga0068884_1408215 | Not Available | 500 | Open in IMG/M |
| 3300005527|Ga0068876_10051456 | All Organisms → cellular organisms → Bacteria | 2510 | Open in IMG/M |
| 3300005581|Ga0049081_10146037 | Not Available | 867 | Open in IMG/M |
| 3300005581|Ga0049081_10341244 | Not Available | 509 | Open in IMG/M |
| 3300005582|Ga0049080_10284221 | Not Available | 535 | Open in IMG/M |
| 3300005662|Ga0078894_10501667 | Not Available | 1089 | Open in IMG/M |
| 3300005662|Ga0078894_10951092 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 742 | Open in IMG/M |
| 3300005662|Ga0078894_11219772 | Not Available | 636 | Open in IMG/M |
| 3300005662|Ga0078894_11767188 | Not Available | 505 | Open in IMG/M |
| 3300005805|Ga0079957_1259347 | Not Available | 802 | Open in IMG/M |
| 3300006484|Ga0070744_10047182 | Not Available | 1265 | Open in IMG/M |
| 3300006875|Ga0075473_10053093 | All Organisms → cellular organisms → Bacteria | 1570 | Open in IMG/M |
| 3300007555|Ga0102817_1125584 | Not Available | 569 | Open in IMG/M |
| 3300007590|Ga0102917_1005929 | All Organisms → Viruses → Predicted Viral | 4155 | Open in IMG/M |
| 3300007639|Ga0102865_1254623 | Not Available | 523 | Open in IMG/M |
| 3300007647|Ga0102855_1108936 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 742 | Open in IMG/M |
| 3300007973|Ga0105746_1103618 | Not Available | 936 | Open in IMG/M |
| 3300007973|Ga0105746_1333074 | Not Available | 529 | Open in IMG/M |
| 3300007973|Ga0105746_1333165 | Not Available | 528 | Open in IMG/M |
| 3300007974|Ga0105747_1309070 | Not Available | 536 | Open in IMG/M |
| 3300007992|Ga0105748_10301192 | Not Available | 680 | Open in IMG/M |
| 3300008107|Ga0114340_1142330 | All Organisms → cellular organisms → Bacteria | 896 | Open in IMG/M |
| 3300008107|Ga0114340_1188693 | Not Available | 709 | Open in IMG/M |
| 3300008113|Ga0114346_1036758 | Not Available | 6498 | Open in IMG/M |
| 3300008113|Ga0114346_1181152 | All Organisms → cellular organisms → Bacteria | 864 | Open in IMG/M |
| 3300008113|Ga0114346_1196220 | Not Available | 810 | Open in IMG/M |
| 3300008113|Ga0114346_1311089 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla | 536 | Open in IMG/M |
| 3300008259|Ga0114841_1017699 | All Organisms → Viruses → Predicted Viral | 3747 | Open in IMG/M |
| 3300008259|Ga0114841_1201228 | Not Available | 719 | Open in IMG/M |
| 3300008259|Ga0114841_1290899 | Not Available | 500 | Open in IMG/M |
| 3300008261|Ga0114336_1059218 | All Organisms → cellular organisms → Bacteria | 4803 | Open in IMG/M |
| 3300008265|Ga0114361_1043885 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 1795 | Open in IMG/M |
| 3300008267|Ga0114364_1016670 | Not Available | 3164 | Open in IMG/M |
| 3300008950|Ga0102891_1065348 | All Organisms → Viruses → Predicted Viral | 1118 | Open in IMG/M |
| 3300009026|Ga0102829_1174031 | Not Available | 694 | Open in IMG/M |
| 3300009051|Ga0102864_1023634 | Not Available | 1615 | Open in IMG/M |
| 3300009085|Ga0105103_10067862 | All Organisms → Viruses → Predicted Viral | 1819 | Open in IMG/M |
| 3300009155|Ga0114968_10634975 | Not Available | 563 | Open in IMG/M |
| 3300009163|Ga0114970_10065469 | All Organisms → Viruses → Predicted Viral | 2310 | Open in IMG/M |
| 3300009165|Ga0105102_10145593 | All Organisms → Viruses → Predicted Viral | 1151 | Open in IMG/M |
| 3300009168|Ga0105104_10015550 | All Organisms → Viruses → Predicted Viral | 4595 | Open in IMG/M |
| 3300009183|Ga0114974_10381484 | Not Available | 811 | Open in IMG/M |
| 3300011268|Ga0151620_1064515 | Not Available | 1189 | Open in IMG/M |
| 3300011336|Ga0153703_1482 | Not Available | 13422 | Open in IMG/M |
| 3300011381|Ga0102688_1657291 | All Organisms → Viruses → Predicted Viral | 1535 | Open in IMG/M |
| 3300013004|Ga0164293_10778249 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 608 | Open in IMG/M |
| (restricted) 3300013126|Ga0172367_10008488 | Not Available | 11475 | Open in IMG/M |
| (restricted) 3300013127|Ga0172365_10062787 | All Organisms → Viruses → Predicted Viral | 2433 | Open in IMG/M |
| (restricted) 3300013127|Ga0172365_10117435 | All Organisms → Viruses → Predicted Viral | 1685 | Open in IMG/M |
| (restricted) 3300013130|Ga0172363_10186150 | All Organisms → Viruses → Predicted Viral | 1414 | Open in IMG/M |
| (restricted) 3300013131|Ga0172373_10096126 | Not Available | 2259 | Open in IMG/M |
| (restricted) 3300013131|Ga0172373_10183704 | All Organisms → Viruses → Predicted Viral | 1443 | Open in IMG/M |
| (restricted) 3300013133|Ga0172362_10129559 | All Organisms → cellular organisms → Bacteria | 1877 | Open in IMG/M |
| (restricted) 3300013137|Ga0172375_10763192 | Not Available | 601 | Open in IMG/M |
| 3300014801|Ga0119946_1010603 | Not Available | 967 | Open in IMG/M |
| 3300014962|Ga0134315_1050292 | Not Available | 642 | Open in IMG/M |
| 3300017788|Ga0169931_10124619 | Not Available | 2387 | Open in IMG/M |
| 3300017788|Ga0169931_10134329 | All Organisms → Viruses → Predicted Viral | 2263 | Open in IMG/M |
| 3300019784|Ga0181359_1060462 | All Organisms → Viruses → Predicted Viral | 1451 | Open in IMG/M |
| 3300019784|Ga0181359_1073446 | All Organisms → Viruses → Predicted Viral | 1292 | Open in IMG/M |
| 3300020074|Ga0194113_10187500 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 1672 | Open in IMG/M |
| 3300020151|Ga0211736_10271529 | Not Available | 531 | Open in IMG/M |
| 3300020160|Ga0211733_10752994 | Not Available | 836 | Open in IMG/M |
| 3300020161|Ga0211726_10675062 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 1395 | Open in IMG/M |
| 3300020162|Ga0211735_10455899 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla | 1067 | Open in IMG/M |
| 3300020162|Ga0211735_11346520 | Not Available | 525 | Open in IMG/M |
| 3300020506|Ga0208091_1001288 | Not Available | 4016 | Open in IMG/M |
| 3300020519|Ga0208223_1007305 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 1884 | Open in IMG/M |
| 3300020528|Ga0208224_1009659 | All Organisms → Viruses → Predicted Viral | 1507 | Open in IMG/M |
| 3300020530|Ga0208235_1009231 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Demerecviridae → Markadamsvirinae → Tequintavirus | 1280 | Open in IMG/M |
| 3300020530|Ga0208235_1018546 | Not Available | 859 | Open in IMG/M |
| 3300021140|Ga0214168_1030814 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 1385 | Open in IMG/M |
| 3300021961|Ga0222714_10025153 | All Organisms → Viruses → Predicted Viral | 4550 | Open in IMG/M |
| 3300021961|Ga0222714_10599095 | Not Available | 550 | Open in IMG/M |
| 3300021962|Ga0222713_10331598 | Not Available | 958 | Open in IMG/M |
| 3300021963|Ga0222712_10277106 | Not Available | 1061 | Open in IMG/M |
| 3300022179|Ga0181353_1133138 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 585 | Open in IMG/M |
| 3300022190|Ga0181354_1206580 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 582 | Open in IMG/M |
| 3300023179|Ga0214923_10009946 | Not Available | 9825 | Open in IMG/M |
| 3300023179|Ga0214923_10378065 | Not Available | 735 | Open in IMG/M |
| 3300025732|Ga0208784_1040999 | All Organisms → Viruses → Predicted Viral | 1445 | Open in IMG/M |
| 3300026931|Ga0209850_1013323 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 679 | Open in IMG/M |
| 3300027121|Ga0255074_1015134 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Demerecviridae → Markadamsvirinae → Tequintavirus | 1001 | Open in IMG/M |
| 3300027123|Ga0255090_1005286 | All Organisms → Viruses → Predicted Viral | 2822 | Open in IMG/M |
| 3300027129|Ga0255067_1022493 | Not Available | 927 | Open in IMG/M |
| 3300027156|Ga0255078_1036323 | All Organisms → Viruses → Predicted Viral | 1033 | Open in IMG/M |
| 3300027393|Ga0209867_1023133 | Not Available | 896 | Open in IMG/M |
| 3300027593|Ga0255118_1068327 | Not Available | 587 | Open in IMG/M |
| 3300027608|Ga0208974_1118495 | Not Available | 693 | Open in IMG/M |
| 3300027659|Ga0208975_1038136 | All Organisms → Viruses → Predicted Viral | 1510 | Open in IMG/M |
| 3300027659|Ga0208975_1130458 | Not Available | 712 | Open in IMG/M |
| 3300027721|Ga0209492_1225800 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 638 | Open in IMG/M |
| 3300027754|Ga0209596_1053478 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 2097 | Open in IMG/M |
| 3300027754|Ga0209596_1315722 | Not Available | 616 | Open in IMG/M |
| 3300027782|Ga0209500_10443037 | Not Available | 513 | Open in IMG/M |
| 3300027793|Ga0209972_10005785 | All Organisms → cellular organisms → Archaea | 8996 | Open in IMG/M |
| 3300027804|Ga0209358_10057208 | All Organisms → cellular organisms → Bacteria | 2281 | Open in IMG/M |
| 3300027836|Ga0209230_10388389 | Not Available | 800 | Open in IMG/M |
| 3300027971|Ga0209401_1052659 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 1836 | Open in IMG/M |
| 3300028178|Ga0265593_1029065 | Not Available | 1688 | Open in IMG/M |
| (restricted) 3300028569|Ga0247843_1001211 | Not Available | 54199 | Open in IMG/M |
| 3300029930|Ga0119944_1003422 | All Organisms → cellular organisms → Bacteria | 2656 | Open in IMG/M |
| 3300031758|Ga0315907_10219730 | All Organisms → Viruses → Predicted Viral | 1586 | Open in IMG/M |
| 3300031758|Ga0315907_10461039 | All Organisms → Viruses → Predicted Viral | 1013 | Open in IMG/M |
| 3300031784|Ga0315899_10047393 | All Organisms → Viruses → Predicted Viral | 4504 | Open in IMG/M |
| 3300031857|Ga0315909_10288245 | All Organisms → cellular organisms → Bacteria | 1235 | Open in IMG/M |
| 3300031857|Ga0315909_10306375 | Not Available | 1184 | Open in IMG/M |
| 3300031857|Ga0315909_11004761 | Not Available | 503 | Open in IMG/M |
| 3300031951|Ga0315904_10477258 | All Organisms → cellular organisms → Bacteria | 1107 | Open in IMG/M |
| 3300031951|Ga0315904_10687027 | Not Available | 863 | Open in IMG/M |
| 3300032050|Ga0315906_10344185 | Not Available | 1322 | Open in IMG/M |
| 3300033233|Ga0334722_10322408 | All Organisms → Viruses → Predicted Viral | 1124 | Open in IMG/M |
| 3300034061|Ga0334987_0262473 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Demerecviridae → Markadamsvirinae → Tequintavirus | 1169 | Open in IMG/M |
| 3300034062|Ga0334995_0470097 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 765 | Open in IMG/M |
| 3300034066|Ga0335019_0849690 | Not Available | 511 | Open in IMG/M |
| 3300034082|Ga0335020_0122377 | All Organisms → Viruses → Predicted Viral | 1319 | Open in IMG/M |
| 3300034101|Ga0335027_0554900 | Not Available | 708 | Open in IMG/M |
| 3300034102|Ga0335029_0166182 | All Organisms → cellular organisms → Bacteria | 1496 | Open in IMG/M |
| 3300034106|Ga0335036_0523189 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 735 | Open in IMG/M |
| 3300034110|Ga0335055_0132924 | All Organisms → Viruses → Predicted Viral | 1129 | Open in IMG/M |
| 3300034119|Ga0335054_0668336 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Dependentiae → unclassified Candidatus Dependentiae → Candidatus Dependentiae bacterium | 561 | Open in IMG/M |
| 3300034279|Ga0335052_0231867 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Demerecviridae → Markadamsvirinae → Tequintavirus | 1049 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 15.38% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 13.08% |
| Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 9.23% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 6.92% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 6.92% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 5.38% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 5.38% |
| Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 4.62% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 3.85% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 3.85% |
| Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 3.85% |
| Estuary Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water | 3.85% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 3.08% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 3.08% |
| Aquatic | Environmental → Aquatic → Freshwater → Drinking Water → Unclassified → Aquatic | 1.54% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 1.54% |
| Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Sand | 1.54% |
| Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater And Sediment | 0.77% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 0.77% |
| Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Lake | 0.77% |
| Freshwater | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater | 0.77% |
| Freshwater | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater | 0.77% |
| Freshwater And Marine | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater And Marine | 0.77% |
| Surface Water | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Surface Water | 0.77% |
| Estuarine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine | 0.77% |
| Saline Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Water | 0.77% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000882 | Freshwater microbial communities from the Columbia River | Environmental | Open in IMG/M |
| 3300002274 | Freshwater microbial communities from Lake Mendota, WI - 12OCT2012 deep hole epilimnion | Environmental | Open in IMG/M |
| 3300002835 | Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605) | Environmental | Open in IMG/M |
| 3300003277 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD | Environmental | Open in IMG/M |
| 3300003388 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.SN | Environmental | Open in IMG/M |
| 3300003488 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM110.DN | Environmental | Open in IMG/M |
| 3300004112 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 2) | Environmental | Open in IMG/M |
| 3300005417 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel6S_1000h metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005527 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG | Environmental | Open in IMG/M |
| 3300005581 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF | Environmental | Open in IMG/M |
| 3300005582 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF | Environmental | Open in IMG/M |
| 3300005662 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 4) | Environmental | Open in IMG/M |
| 3300005805 | Microbial and algae communities from Cheney Reservoir in Wichita, Kansas, USA | Environmental | Open in IMG/M |
| 3300006484 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535 | Environmental | Open in IMG/M |
| 3300006875 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_>0.8_DNA | Environmental | Open in IMG/M |
| 3300007555 | Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.555 | Environmental | Open in IMG/M |
| 3300007590 | Estuarine microbial communities from the Columbia River estuary - metaG 1562A-02 | Environmental | Open in IMG/M |
| 3300007639 | Estuarine microbial communities from the Columbia River estuary - metaG 1449C-02 | Environmental | Open in IMG/M |
| 3300007647 | Estuarine microbial communities from the Columbia River estuary - metaG 1370B-02 | Environmental | Open in IMG/M |
| 3300007973 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460A_0.2um | Environmental | Open in IMG/M |
| 3300007974 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460C_0.2um | Environmental | Open in IMG/M |
| 3300007992 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1461AB_0.2um | Environmental | Open in IMG/M |
| 3300008107 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-3-NA | Environmental | Open in IMG/M |
| 3300008113 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0050-3-NA | Environmental | Open in IMG/M |
| 3300008259 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0132-C-NA | Environmental | Open in IMG/M |
| 3300008261 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0024-C-NA | Environmental | Open in IMG/M |
| 3300008265 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample HABS-E2014-0126-100-LTR | Environmental | Open in IMG/M |
| 3300008267 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0024-100-LTR | Environmental | Open in IMG/M |
| 3300008950 | Estuarine microbial communities from the Columbia River estuary - metaG 1552A-02 | Environmental | Open in IMG/M |
| 3300009026 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.575 | Environmental | Open in IMG/M |
| 3300009051 | Estuarine microbial communities from the Columbia River estuary - metaG 1449B-02 | Environmental | Open in IMG/M |
| 3300009085 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 10-12cm September2015 | Environmental | Open in IMG/M |
| 3300009155 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG | Environmental | Open in IMG/M |
| 3300009163 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140205_XF_MetaG | Environmental | Open in IMG/M |
| 3300009165 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 1-3cm September2015 | Environmental | Open in IMG/M |
| 3300009168 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 19-21cm September2015 | Environmental | Open in IMG/M |
| 3300009183 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG | Environmental | Open in IMG/M |
| 3300011268 | Sub-surface freshwater microbial communities from San Francisco Estuary Delta, California, USA . Combined Assembly of Gp0173482, Gp0175554, Gp0175555 | Environmental | Open in IMG/M |
| 3300011336 | Lotic viral community from Han River, Hwacheon, Gangwon-do, South Korea - Paldang | Environmental | Open in IMG/M |
| 3300011381 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel7S_1600h metaT (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300013004 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES118 metaG | Environmental | Open in IMG/M |
| 3300013126 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_022012_10m | Environmental | Open in IMG/M |
| 3300013127 (restricted) | Sediment microbial communities from Lake Kivu, Rwanda - Sediment site 48cm | Environmental | Open in IMG/M |
| 3300013130 (restricted) | Sediment microbial communities from Lake Kivu, Rwanda - Sediment s2_kivu2a2 | Environmental | Open in IMG/M |
| 3300013131 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_10m | Environmental | Open in IMG/M |
| 3300013133 (restricted) | Sediment microbial communities from Lake Kivu, Rwanda - Sediment s1_kivu2a2 | Environmental | Open in IMG/M |
| 3300013137 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_11.1m | Environmental | Open in IMG/M |
| 3300014801 | Aquatic microbial communities from drinking water treatment system in Nanjing, China - Filtered water - FW | Environmental | Open in IMG/M |
| 3300014962 | Surface water microbial communities from Bangladesh - BaraHaldiaSW0309 | Environmental | Open in IMG/M |
| 3300017788 | Freshwater microbial communities from Lake Kivu, Western Province, Rwanda to study Microbial Dark Matter (Phase II) - Kivu_15m_20L | Environmental | Open in IMG/M |
| 3300019784 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D | Environmental | Open in IMG/M |
| 3300020074 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015017 Mahale Deep Cast 200m | Environmental | Open in IMG/M |
| 3300020151 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_202 megahit1 | Environmental | Open in IMG/M |
| 3300020160 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_105 megahit1 | Environmental | Open in IMG/M |
| 3300020161 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_101 megahit1 | Environmental | Open in IMG/M |
| 3300020162 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_201 megahit1 | Environmental | Open in IMG/M |
| 3300020506 | Freshwater microbial communities from Lake Mendota, WI - 26OCT2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020519 | Freshwater microbial communities from Lake Mendota, WI - 07OCT2009 deep hole epilimnion ns (SPAdes) | Environmental | Open in IMG/M |
| 3300020528 | Freshwater microbial communities from Lake Mendota, WI - 26OCT2009 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020530 | Freshwater microbial communities from Lake Mendota, WI - 22OCT2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300021140 | Freshwater microbial communities from Lake Mendota, WI - Practice 29OCT2010 epilimnion | Environmental | Open in IMG/M |
| 3300021961 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_3D | Environmental | Open in IMG/M |
| 3300021962 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649D | Environmental | Open in IMG/M |
| 3300021963 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_657D | Environmental | Open in IMG/M |
| 3300022179 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.D.N | Environmental | Open in IMG/M |
| 3300022190 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.N | Environmental | Open in IMG/M |
| 3300023179 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1510 | Environmental | Open in IMG/M |
| 3300025732 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300026931 | Groundwater microbial communities from the Columbia River, Washington, USA, for microbe roles in carbon and contaminant biogeochemistry - GW-RW metaG T2_23-Sept-14 (SPAdes) | Environmental | Open in IMG/M |
| 3300027121 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Yuk_RepC_8h | Environmental | Open in IMG/M |
| 3300027123 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Yuk_RepA_8d | Environmental | Open in IMG/M |
| 3300027129 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Cont_RepB_8h | Environmental | Open in IMG/M |
| 3300027156 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Atlam_RepA_8h | Environmental | Open in IMG/M |
| 3300027393 | Groundwater microbial communities from the Columbia River, Washington, USA, for microbe roles in carbon and contaminant biogeochemistry - GW-RW metaG T4_4-Nov-14 (SPAdes) | Environmental | Open in IMG/M |
| 3300027593 | Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Atlam_RepB_8h | Environmental | Open in IMG/M |
| 3300027608 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF (SPAdes) | Environmental | Open in IMG/M |
| 3300027659 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF (SPAdes) | Environmental | Open in IMG/M |
| 3300027721 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm May2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300027754 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027782 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027793 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel1S_2200h metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027804 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027836 | Freshwater and sediment microbial communities from Lake Ontario - Sta 18 epilimnion Metagenome (SPAdes) | Environmental | Open in IMG/M |
| 3300027971 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300028178 | Saline water microbial communities from Sakinaw Lake, British Columbia, Canada - sak_2011_5_24_36m | Environmental | Open in IMG/M |
| 3300028569 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2017_8m | Environmental | Open in IMG/M |
| 3300029930 | Aquatic microbial communities from drinking water treatment plant in Pearl River Delta area, China - influent_20120727 | Environmental | Open in IMG/M |
| 3300031758 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123 | Environmental | Open in IMG/M |
| 3300031784 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA112 | Environmental | Open in IMG/M |
| 3300031857 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125 | Environmental | Open in IMG/M |
| 3300031951 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA120 | Environmental | Open in IMG/M |
| 3300032050 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA122 | Environmental | Open in IMG/M |
| 3300033233 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C3_bottom | Environmental | Open in IMG/M |
| 3300034061 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Sep2004-rr0028 | Environmental | Open in IMG/M |
| 3300034062 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Jul2012-rr0045 | Environmental | Open in IMG/M |
| 3300034066 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME11Jul2017-rr0087 | Environmental | Open in IMG/M |
| 3300034082 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME05Jun2015-rr0088 | Environmental | Open in IMG/M |
| 3300034101 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME19Sep2005-rr0107 | Environmental | Open in IMG/M |
| 3300034102 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jul2002-rr0112 | Environmental | Open in IMG/M |
| 3300034106 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23Aug2013-rr0131 | Environmental | Open in IMG/M |
| 3300034110 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME01Jun2009D10-rr0171 | Environmental | Open in IMG/M |
| 3300034119 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME21Jul2015-rr0166 | Environmental | Open in IMG/M |
| 3300034279 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jul2014-rr0163 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| FwDRAFT_100304997 | 3300000882 | Freshwater And Marine | SSMKKLTKKEQEEIKMKLAYFDKIVKDTRELIKQGYTMPNLSCLVVPRQ* |
| B570J29581_1019921 | 3300002274 | Freshwater | MKKQNKKEKEEIKMKLAYFDRLVKQTRELIKQGYTVPXLSSLVXPSR* |
| B570J40625_1000204373 | 3300002835 | Freshwater | MKKQNKKEKEEIKMKLAYFDRLVKQTRELIKQGYTVPDLSSLVRPSR* |
| B570J40625_1004320951 | 3300002835 | Freshwater | MKKQTKKEKEEIKMKLAYFDRLVKQTRELIKQGYTVPDLSSLVRPSR* |
| JGI25908J49247_101348241 | 3300003277 | Freshwater Lake | MKKLTKKEQEEIKMKLAYFDKIVKDTRELIKQGYTMPNLSCLV |
| JGI25910J50241_101096942 | 3300003388 | Freshwater Lake | MKKLTKKEQEEIKMKLAYFDKIVKDTRELIKQGYTMPNLSCLVVPIQ* |
| JGI25919J51413_10175881 | 3300003488 | Freshwater Lake | MKKLTKKEQEEIKMKLAYFDKIVKDTRELIKQGYTMPNLSCLVVPR |
| Ga0065166_102540462 | 3300004112 | Freshwater Lake | MKKLTKKEKEEIKMKLAYFDRLVKQTRELIKQGYTVPDLSSLVRPSR* |
| Ga0068884_14082152 | 3300005417 | Freshwater Lake | MKKLTKKDREDIKMKLFYFDKIVKETRELIKQGYTLPDLSGFIIHRP* |
| Ga0068876_100514562 | 3300005527 | Freshwater Lake | MKKLTKKEREEIKMKLAYFDKIVKDTRELIKQGYTMPNLSGLMMHKQ* |
| Ga0049081_101460371 | 3300005581 | Freshwater Lentic | MKKQTKKEKEEIKMKLAYFDRLVKQTRELIKQGYTMPNLSCLVVPRQ* |
| Ga0049081_103412442 | 3300005581 | Freshwater Lentic | MKKQTKKEKEEIKMKLAYFDRLVKQTRELIKQGYTVPDLTSLVRPSR* |
| Ga0049080_102842213 | 3300005582 | Freshwater Lentic | MKNLTKKEQEEIKMKLAYFDKIVKDTSELIKQGYTMSNLSCLVVPRQ* |
| Ga0078894_105016673 | 3300005662 | Freshwater Lake | MKKLTKKEKEEIKMKLAYFDRLVKQTRELIKQGYTVPDL |
| Ga0078894_109510923 | 3300005662 | Freshwater Lake | KKEKEEIKMKLAYFDRLVKQTRELIKQGYTVPDLTSLVRPSR* |
| Ga0078894_112197723 | 3300005662 | Freshwater Lake | MKKQTKKEKEEIKMKLAYFDKIVKDTRELIKQGYTMPNLSCLVIPRQ* |
| Ga0078894_117671882 | 3300005662 | Freshwater Lake | MKKLTKKEQEEIKMKLAYFDKIVKDTRELIKQGYTVPDLSSLVLPSR* |
| Ga0079957_12593472 | 3300005805 | Lake | MKKLTKKEREEIKMKLAYFDKIVKDTRELIKQGYTMPNLSGLVVPRR* |
| Ga0070744_100471823 | 3300006484 | Estuarine | MKKLTKKEQEEIKMKLAYFDKIVKDTRELIKQGYTMPNLSCLVVPRQ* |
| Ga0075473_100530937 | 3300006875 | Aqueous | CSCMKKQTKKEKEEIKMKLAYFDRLVKQTRELIKQGYTVPDLSSLVRPSR* |
| Ga0102817_11255841 | 3300007555 | Estuarine | SSMKKLTKKEQEEIKMKLAYFDKIVKDNRELIKQGYTMPNLSCLVVPRQ* |
| Ga0102917_10059292 | 3300007590 | Estuarine | MKNLTKKEQEEIKMKLAYFDKIVKDTRELIKQGYTMPNLSCLVVPRQ* |
| Ga0102865_12546233 | 3300007639 | Estuarine | TKKEQEEIKMKLAYFDKIVKDTRELIKQGYTMPNLSCLVVPIQ* |
| Ga0102855_11089363 | 3300007647 | Estuarine | KLTKKEQEEIKMKLAYFDKIVKDTRELIKQGYTMPNLSCLVVPIQ* |
| Ga0105746_11036182 | 3300007973 | Estuary Water | MKKLTKKEQEEIKMKLAYFDKIVKDTRELIKQGYTMPNLSCLVVP |
| Ga0105746_13330741 | 3300007973 | Estuary Water | TKKEQEEIKMKLAYFDKIVKDTRELIKQGYTMPNLSCLVVPRQ* |
| Ga0105746_13331652 | 3300007973 | Estuary Water | MKKQTKKEKEEIKMKLAYFDRLVKQTRELIKQGYTVPDLSGLVRPSR* |
| Ga0105747_13090701 | 3300007974 | Estuary Water | LTKKEQEEIKMKLAYFDKIVKDTRELIKQGYTMPNLSCLVVPRQ* |
| Ga0105748_103011922 | 3300007992 | Estuary Water | MKKQTKKEKEEIKMKLAYFDRLVKQTRELIKQGYTVPDLSSLVLPSR* |
| Ga0114340_11423302 | 3300008107 | Freshwater, Plankton | MKKQTKKEKEEIKMKLAYFDRLVKQTRELIKQGYTVPDLNSLVRINR* |
| Ga0114340_11886932 | 3300008107 | Freshwater, Plankton | MKKLTKKEREDIKMKLFYFDKIVKETRELIKQGYTVPDLSNLVRPSR* |
| Ga0114346_103675812 | 3300008113 | Freshwater, Plankton | MKKLTKKEREEIKMKLAYFDKIVKDTRELIKQGYTMPKNT* |
| Ga0114346_11811522 | 3300008113 | Freshwater, Plankton | MKKLTKKEKEEIKMKLAYFDRLVKQTRELIKQGYTVPDLSNLVRPSR* |
| Ga0114346_11962202 | 3300008113 | Freshwater, Plankton | MKKQTKKEKEEIKMKLAYFDRLVKETRELIKQGYTVPDLSGLVRPSR* |
| Ga0114346_13110891 | 3300008113 | Freshwater, Plankton | MKKLTKKEREEIKMKLAYFDKIVKDTRELIKQGYTMP |
| Ga0114841_101769912 | 3300008259 | Freshwater, Plankton | MKKQTKKVKEEIKMKLAYFDRLVKETRELIKQGYTVPDLSGLVRPSR* |
| Ga0114841_12012282 | 3300008259 | Freshwater, Plankton | MKKQTKKEKEEIKMKLAYFDRLVKETRELIKQGYTVPDLSSLVRPSR* |
| Ga0114841_12908992 | 3300008259 | Freshwater, Plankton | MKKLTKKEQEEIKMKLAYFDKIVKDTRELIKQGYTVPDLSSLVRPSR* |
| Ga0114336_10592189 | 3300008261 | Freshwater, Plankton | MKKLTKKERGEIKMKLAYFDKIVKDTRELIKQGYTMPNLSGLMMH |
| Ga0114361_10438857 | 3300008265 | Freshwater, Plankton | MKKLTKKEREEIKMKLAYFDKIVKDTRELIKQGYTMPNLSGLLMHKQ* |
| Ga0114364_10166705 | 3300008267 | Freshwater, Plankton | MKKLTKKEQEEIKMKLAYFDRLVKQTRELIKQGYTVPDLSNLVRPSI* |
| Ga0102891_10653481 | 3300008950 | Estuarine | MKNLTKKEQEEIKMKLAYFDKIVKDTRELIKQGYTMPNLSCLVVPIQ* |
| Ga0102829_11740311 | 3300009026 | Estuarine | MKKLTKKEREEIKMKLAYFDKIVKDTRELIKQGYTMPNL |
| Ga0102864_10236344 | 3300009051 | Estuarine | MKKQTKKEKEEIKMKLAYFDRLVKQTRELIKQGYTVPDLSS* |
| Ga0105103_100678622 | 3300009085 | Freshwater Sediment | MKKQTKKEKEEIKMKLAYFDRLVKQTRELIKQGYTVPDLSGLVLPSR* |
| Ga0114968_106349751 | 3300009155 | Freshwater Lake | MKKLTKKEQEEIKMKLAYFDKIVKDTRELIKQGYTMPNLSCLVIPRQ* |
| Ga0114970_100654691 | 3300009163 | Freshwater Lake | KLTKKEQEEIKMKLAYFDKIVKDTRELIKQGYTMPNLSCLVIPRQ* |
| Ga0105102_101455932 | 3300009165 | Freshwater Sediment | MKKQTKKEREEIKMKLAYFDRLVKQTRELIKQGYTVPDLSSLVLPSR* |
| Ga0105104_100155505 | 3300009168 | Freshwater Sediment | MKKQTKKEKEEIKMKLAYFDRLVTQTRELIKQGYTVPDLSGLVLPSR* |
| Ga0114974_103814842 | 3300009183 | Freshwater Lake | MKKLTKKEQEEIKMKLAYFDKIVKDTRELIKQGYT |
| Ga0151620_10645152 | 3300011268 | Freshwater | MKKQTKKEKEEIKMKLAYFDRLVKQTRELIKQGYTMPNLSGLMMHKQ* |
| Ga0153703_148215 | 3300011336 | Freshwater | MKKLTKKEREEIKIKLAYFDKIVKNTRELIKQGYTMPNLSGLMMHKQ* |
| Ga0102688_16572913 | 3300011381 | Freshwater Lake | MKKLTKKDREDIKMKLFYFDKIVKETRELIKQGYTLPDLSDL* |
| Ga0164293_107782491 | 3300013004 | Freshwater | YMKKQTKKEKEEIKMKLAYFDRLVKQTRELIKQGYTVPDLSSLVLPSR* |
| (restricted) Ga0172367_100084884 | 3300013126 | Freshwater | MKRLTKKEREDIKMRLEYFDKIVKETRELIKQGYTLPDLSNLVIPRQ* |
| (restricted) Ga0172365_100627872 | 3300013127 | Sediment | MKRLTKKDREDIKMRLEYFDKIVKETRELIKRGYTLPDLSSLVIPRQ* |
| (restricted) Ga0172365_101174352 | 3300013127 | Sediment | MKRLTKKEREDIKMRLEYFDKIVKETRELIKQGYTLPDLSSLLIPRQ* |
| (restricted) Ga0172363_101861501 | 3300013130 | Sediment | MKRLTKKEREDIKMRLEYFDKIVKETRELIKQGYTLPDLSSL |
| (restricted) Ga0172373_100961264 | 3300013131 | Freshwater | MKRLTKKEREDIKMRLEYFDKIVKETRELIKQGYTLP |
| (restricted) Ga0172373_101837041 | 3300013131 | Freshwater | MKRLTKKEREDIKMRLEYFDKIVKETRELIKQGYTLPD |
| (restricted) Ga0172362_101295592 | 3300013133 | Sediment | MKRLTKKEREDIKMRLEYFDKIVKETRELIKQGYTLPDLSSLVIPRQ* |
| (restricted) Ga0172375_107631922 | 3300013137 | Freshwater | MKRLTKKEREDIKMRLEYFDKIVKETRELIKRGYTLPDLSSLVIPRQ* |
| Ga0119946_10106032 | 3300014801 | Aquatic | MKKLTKKEREDIKMRLAYFDKIVKETRELIKQGYTLPDLSGFIIHRP* |
| Ga0134315_10502922 | 3300014962 | Surface Water | MKKLTKKEREDVKMKLFYFDKIVKETRELIKQGYTLPDLSGFIIHRP* |
| Ga0169931_101246192 | 3300017788 | Freshwater | MKRLTKKEREDIKMRLEYFDKIVKETRELIKQGYTLPDLSSLLIPRQ |
| Ga0169931_101343292 | 3300017788 | Freshwater | MKRLTKKDREDIKMRLEYFDKIVKETRELIKRGYTLPDLSSLVIPRQ |
| Ga0181359_10604624 | 3300019784 | Freshwater Lake | MKKLTKKEQEEIKMKLAYFDKIVKDTRELIKQGYTMPNLSCLVVPRQ |
| Ga0181359_10734466 | 3300019784 | Freshwater Lake | MKKQTKKEKEEIKMKLAYFDRLVKQTRELIKQGYTVPDLSSLVRPSR |
| Ga0194113_101875002 | 3300020074 | Freshwater Lake | MKRLTKKEREDIKMRLEYFDKIVKETRELIKQGYTLPDLSSLVIPRQ |
| Ga0211736_102715292 | 3300020151 | Freshwater | MKKLTKKEREEIKIKLAYFDKIVKDTRELIKQGYTMPNLSCLVVPIQ |
| Ga0211733_107529944 | 3300020160 | Freshwater | MKKLTKKEREEIKIKLAYFDKIVKDTRELIKQGYTMPNLSGLMMHKQ |
| Ga0211726_106750621 | 3300020161 | Freshwater | MKKLTKKEREEIKMKLAYFDKIVKDTRELIKQGYTM |
| Ga0211735_104558991 | 3300020162 | Freshwater | MKNLTKKEREEIKMKLAYFDKIVKDTRELIKQGYTM |
| Ga0211735_113465202 | 3300020162 | Freshwater | MKKLTKKEREEIKIKLAYFDKIVKDTRELIKQGYTMPNLSCLVVPRQ |
| Ga0208091_10012884 | 3300020506 | Freshwater | MKKQNKKEKEEIKMKLAYFDRLVKQTRELIKQGYTVPDLSSLVRPSR |
| Ga0208223_10073057 | 3300020519 | Freshwater | MKKQTKKEKEEIKMKLAYFDRLVKQTRELIKQGYTVPDLSGLVLPSR |
| Ga0208224_10096593 | 3300020528 | Freshwater | MKKQTKKEKEEIKMKLAYFDRLVKQTRELIKQGYTVPDLSSLVLPSR |
| Ga0208235_10092311 | 3300020530 | Freshwater | MKKQNKKEKEEIKMKLAYFDRLVKQTRELIKQGYTVP |
| Ga0208235_10185461 | 3300020530 | Freshwater | MKKQTKKEKEEIKMKLAYFDRLVKQTRELIKQGYTVP |
| Ga0214168_10308143 | 3300021140 | Freshwater | MKKQNKKEKEEIKMKLAYFDRLVKQTRELIKQGYTVPDLSGLVLPIR |
| Ga0222714_100251533 | 3300021961 | Estuarine Water | MKKLTKKQREDIKMRLSYFDKIVKETRELIKQGYTLPDLSGFIIHRP |
| Ga0222714_105990952 | 3300021961 | Estuarine Water | MKKQTKKEKEEIKMKLAYFDRLVKQTRELIKQGYTMPNLSGLMMHKQ |
| Ga0222713_103315982 | 3300021962 | Estuarine Water | MKKQTKKEKEEIKMKLAYFDRLVKETRELIKQGYTVPDLSNLIRPSR |
| Ga0222712_102771064 | 3300021963 | Estuarine Water | MKKLTKKEQEEIKMKLAYFDKIVKDTRELIKQGYTMPNLSGLMMQKQ |
| Ga0181353_11331381 | 3300022179 | Freshwater Lake | SCMKKQTKKEKEEIKMKLAYFDRLVKQTRELIKQGYTVPDLSSLVRPSR |
| Ga0181354_12065801 | 3300022190 | Freshwater Lake | MKKQTKKEKEEIKMKLAYFDRLVKQTRELIKQGYTVPDLTSLVRPSR |
| Ga0214923_100099462 | 3300023179 | Freshwater | MKKLTKKEQEEIKMKLAYFDKIVKDTRELIKQGYTMPNLSCLVVPIQ |
| Ga0214923_103780651 | 3300023179 | Freshwater | MKKQTKKEKEEIKMKLAYFDRLVKQTRELIKQGYTV |
| Ga0208784_10409993 | 3300025732 | Aqueous | MKKQTKKEKEEIKMKLAYFDRLVKQTRELIKQGYTVPD |
| Ga0209850_10133231 | 3300026931 | Sand | CMKKLTKKEQEEIKMKLAYFDKIVKDTRELIKQGYTMPNLSCLVVPRQ |
| Ga0255074_10151341 | 3300027121 | Freshwater | MKKQTKKEKEEIKMKLAYFDRLVKQTRELIKQGYTVPDLSSL |
| Ga0255090_10052862 | 3300027123 | Freshwater | MKKQTKKEKEEIKMKLAYFDRLVKQTRELIKQGYTMPNLSCLVVPRQ |
| Ga0255067_10224932 | 3300027129 | Freshwater | MKKQTKKEKEEIKMKLAYFDRLVKQTRELIKQGYTMPNLS |
| Ga0255078_10363231 | 3300027156 | Freshwater | KEKEEIKMKLAYFDRLVKQTRELIKQGYTMPNLSCLVVPRQ |
| Ga0209867_10231332 | 3300027393 | Sand | MKKLTKKEQEEIKMKLAYFDKIVKDTRELIKQGYTMPNLQITCI |
| Ga0255118_10683271 | 3300027593 | Freshwater | LTKKEQEEIKMKLAYFDKIVKDTRELIKQGYTMPNLSCLVVPRQ |
| Ga0208974_11184952 | 3300027608 | Freshwater Lentic | MKKQTKKEKEEIKMKLAYFDRLVKQTRELIKQGYT |
| Ga0208975_10381361 | 3300027659 | Freshwater Lentic | MKKLTKKEQEEIKMKLAYFDKIVKDTRELIKQGYTM |
| Ga0208975_11304582 | 3300027659 | Freshwater Lentic | MKKLTKKEQEEIKMKLAYFDKIVKDTRELIKQGYTMPNL |
| Ga0209492_12258002 | 3300027721 | Freshwater Sediment | MKKQTKKEKEEIKMKLAYFDRLVKQTRELIKQGYTVPDLSGLVRPSR |
| Ga0209596_10534786 | 3300027754 | Freshwater Lake | MKKLTKKEQEEIKMKLAYFDKIVKDTRELIKQGYTMPNLSCLVIPRQ |
| Ga0209596_13157221 | 3300027754 | Freshwater Lake | MKKLTKKEQEEIKMKLAYFDKIVKDTRELIKQGYTMPNLSCL |
| Ga0209500_104430371 | 3300027782 | Freshwater Lake | KLTKKEQEEIKMKLAYFDKIVKDTRELIKQGYTMPNLSCLVVPIQ |
| Ga0209972_100057859 | 3300027793 | Freshwater Lake | MKKLTKKDREDIKMKLFYFDKIVKETRELIKQGYTLPDLSGFIIHRP |
| Ga0209358_100572085 | 3300027804 | Freshwater Lake | MKKLTKKEQEEIKMKLAYFDKIVKDTRELIKQGYTVPDLSSLVRPSR |
| Ga0209230_103883891 | 3300027836 | Freshwater And Sediment | MKKLTKKEQEEIKMKLAYFDKIVKDTRELIKQGYTMPNLSC |
| Ga0209401_10526598 | 3300027971 | Freshwater Lake | KKLTKKEQEEIKMKLAYFDKIVKDTRELIKQGYTMPNLSCLVVPIQ |
| Ga0265593_10290651 | 3300028178 | Saline Water | MKKLTKKEQEEIKMKLAYFDKIVKDTRELIKQGYTMPN |
| (restricted) Ga0247843_100121172 | 3300028569 | Freshwater | MKKLTKKEREDIKMRLEYFDKIVKDTRELIKQGYTLPDLSSLVIPRR |
| Ga0119944_10034223 | 3300029930 | Aquatic | MKKLTKKEREDIKMKLFYFDKIVKETRELIKQGYTLPDLSGFIIHRP |
| Ga0315907_102197302 | 3300031758 | Freshwater | MKKLTKKEREDIKMKLFYFDKIVKETRELIKQGYTVPDLSNLVRPSR |
| Ga0315907_104610392 | 3300031758 | Freshwater | MKKQTKKEKEEIKMKLAYFDRLVKQTRELIKQGYTVPDLSNLVRPSR |
| Ga0315899_100473932 | 3300031784 | Freshwater | MKKQTKKEKEEIKMKLAYFDRLVKQTRELIKQGYTVPDLNSLVRINR |
| Ga0315909_102882453 | 3300031857 | Freshwater | SRCSCMKKQTKKEKEEIKMKLAYFDRLVKQTRELIKQGYTVPDLNSLVRINR |
| Ga0315909_103063751 | 3300031857 | Freshwater | MKKLTKKERGEIKMKLAYFDKIVKDTRELIKQGYTMPNLSGLMMHKQ |
| Ga0315909_110047612 | 3300031857 | Freshwater | MKKQTKKEKEEIKMKLAYFDRLVKETRELIKQGYTVPDLSSLVRPSR |
| Ga0315904_104772581 | 3300031951 | Freshwater | MKKQTKKEKEEIKMKLAYFDRLVKETRELIKQGYTVPDLNSLVRINR |
| Ga0315904_106870272 | 3300031951 | Freshwater | MKKQTKKEKEEIKMKLAYFDRLVKETRELIKQGYTVPDLSGLVRP |
| Ga0315906_103441853 | 3300032050 | Freshwater | MKKQTKKEKEEIKMKLAYFDRLVKETRELIKQGYTVPDLSGLVRPSR |
| Ga0334722_103224081 | 3300033233 | Sediment | KKLTKKEQEEIKMKLAYFDKIVKDTRELIKQGYTMPNLSCLVVPRQ |
| Ga0334987_0262473_1050_1169 | 3300034061 | Freshwater | MKKQNKKEKEEIKMKLAYFDRLVKQTRELIKQGYTVPDLS |
| Ga0334995_0470097_645_764 | 3300034062 | Freshwater | KEEIKMKLAYFDRLVKQTRELIKQGYTVPDLSCLMIQKQ |
| Ga0335019_0849690_3_134 | 3300034066 | Freshwater | MKKQTKKEKEEIKMKLAYFDRLVKQTRELIKQGYTVPDLSSLVR |
| Ga0335020_0122377_3_122 | 3300034082 | Freshwater | MKKLTKKEQEEIKMKLAYFDKIVKDTRELIKQGYTMPNLS |
| Ga0335027_0554900_572_706 | 3300034101 | Freshwater | MKKQTKKEKEEIKMKLAYFDRLVKQTRELIKQGYTVPDLSSLVLP |
| Ga0335029_0166182_23_166 | 3300034102 | Freshwater | MKKLTKKEKEEIKMKLAYFDRLVKQTRELIKQGYTVPDLSSLVLPSR |
| Ga0335036_0523189_608_733 | 3300034106 | Freshwater | KEQEEIKMKLAYFDKIVKDTRELIKQGYTMPNLSCLVVPRQ |
| Ga0335055_0132924_224_367 | 3300034110 | Freshwater | MKKQTKKEREEIKMKLAYFDRLVKQTRELIKQGYTVPDLNSLVLPSR |
| Ga0335054_0668336_420_554 | 3300034119 | Freshwater | MKKQTKKEREEIKMKLAYFDKIVKDTRELIKQGYTVPDLSSLMI |
| Ga0335052_0231867_2_139 | 3300034279 | Freshwater | MKKQNKKEKEEIKMKLAYFDRLVKQTRELIKQGYTVPDLSSLVRPS |
| ⦗Top⦘ |