NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F062747

Metagenome Family F062747

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F062747
Family Type Metagenome
Number of Sequences 130
Average Sequence Length 65 residues
Representative Sequence MANMNKKSPGQGKTPQQYTDSTRFAWYGVVGMTLLVILLTLLGGCATTHDTSKECCKSTKTSAE
Number of Associated Samples 75
Number of Associated Scaffolds 130

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 6.20 %
% of genes near scaffold ends (potentially truncated) 36.15 %
% of genes from short scaffolds (< 2000 bps) 75.38 %
Associated GOLD sequencing projects 69
AlphaFold2 3D model prediction Yes
3D model pTM-score0.36

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (70.769 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Strait → Unclassified → Seawater
(48.462 % of family members)
Environment Ontology (ENVO) Unclassified
(96.923 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Water (saline)
(99.231 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Transmembrane (alpha-helical) Signal Peptide: Yes Secondary Structure distribution: α-helix: 39.13%    β-sheet: 0.00%    Coil/Unstructured: 60.87%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.36
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 130 Family Scaffolds
PF10544T5orf172 17.69
PF13585CHU_C 1.54
PF11306DUF3108 1.54
PF00037Fer4 0.77
PF01467CTP_transf_like 0.77



 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms79.23 %
UnclassifiedrootN/A20.77 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000115|DelMOSum2011_c10138644All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium737Open in IMG/M
3300000115|DelMOSum2011_c10181426All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium599Open in IMG/M
3300000116|DelMOSpr2010_c10188809All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium669Open in IMG/M
3300000148|SI47jul10_100mDRAFT_c1047195All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium568Open in IMG/M
3300001346|JGI20151J14362_10098275All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1017Open in IMG/M
3300001450|JGI24006J15134_10010022All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium4691Open in IMG/M
3300001450|JGI24006J15134_10015810All Organisms → cellular organisms → Bacteria3570Open in IMG/M
3300001450|JGI24006J15134_10018982All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium3196Open in IMG/M
3300001450|JGI24006J15134_10019422All Organisms → Viruses → Predicted Viral3156Open in IMG/M
3300001450|JGI24006J15134_10047632All Organisms → Viruses → Predicted Viral1773Open in IMG/M
3300001450|JGI24006J15134_10065052All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1423Open in IMG/M
3300001450|JGI24006J15134_10130499All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium852Open in IMG/M
3300001589|JGI24005J15628_10005370All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes6264Open in IMG/M
3300001589|JGI24005J15628_10089718All Organisms → Viruses → Predicted Viral1059Open in IMG/M
3300001589|JGI24005J15628_10199041Not Available564Open in IMG/M
3300006484|Ga0070744_10146022All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium679Open in IMG/M
3300006735|Ga0098038_1008864All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes3986Open in IMG/M
3300006735|Ga0098038_1025504All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium2229Open in IMG/M
3300006737|Ga0098037_1093274All Organisms → Viruses → Predicted Viral1048Open in IMG/M
3300006737|Ga0098037_1283683All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium525Open in IMG/M
3300006749|Ga0098042_1161785Not Available545Open in IMG/M
3300006752|Ga0098048_1047955All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1348Open in IMG/M
3300006929|Ga0098036_1170342All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium663Open in IMG/M
3300006929|Ga0098036_1272209All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium511Open in IMG/M
3300009423|Ga0115548_1053177All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1432Open in IMG/M
3300009426|Ga0115547_1105229All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium927Open in IMG/M
3300009426|Ga0115547_1160320Not Available717Open in IMG/M
3300009433|Ga0115545_1326631All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium508Open in IMG/M
3300009435|Ga0115546_1135262All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium876Open in IMG/M
3300009436|Ga0115008_10607385All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium788Open in IMG/M
3300009472|Ga0115554_1447448Not Available503Open in IMG/M
3300010148|Ga0098043_1120125All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium757Open in IMG/M
3300010149|Ga0098049_1198503All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium615Open in IMG/M
3300014959|Ga0134299_1050936Not Available596Open in IMG/M
3300017705|Ga0181372_1071179All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium588Open in IMG/M
3300017706|Ga0181377_1007116All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium2864Open in IMG/M
3300017706|Ga0181377_1010833All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium2184Open in IMG/M
3300017706|Ga0181377_1011401All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium2117Open in IMG/M
3300017706|Ga0181377_1013331Not Available1925Open in IMG/M
3300017706|Ga0181377_1023065Not Available1346Open in IMG/M
3300017708|Ga0181369_1005261All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium3454Open in IMG/M
3300017708|Ga0181369_1057827All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium857Open in IMG/M
3300017708|Ga0181369_1130383Not Available505Open in IMG/M
3300017709|Ga0181387_1001499All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes4870Open in IMG/M
3300017709|Ga0181387_1004835All Organisms → cellular organisms → Bacteria2649Open in IMG/M
3300017709|Ga0181387_1024844All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1170Open in IMG/M
3300017709|Ga0181387_1057568All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium777Open in IMG/M
3300017709|Ga0181387_1092674All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium616Open in IMG/M
3300017709|Ga0181387_1138324All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium503Open in IMG/M
3300017710|Ga0181403_1009662All Organisms → cellular organisms → Bacteria2083Open in IMG/M
3300017710|Ga0181403_1010983All Organisms → Viruses → Predicted Viral1953Open in IMG/M
3300017710|Ga0181403_1030408All Organisms → Viruses → Predicted Viral1140Open in IMG/M
3300017713|Ga0181391_1089662All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium699Open in IMG/M
3300017713|Ga0181391_1091834All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium689Open in IMG/M
3300017714|Ga0181412_1016490All Organisms → Viruses → Predicted Viral2121Open in IMG/M
3300017714|Ga0181412_1121352All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium602Open in IMG/M
3300017717|Ga0181404_1008999All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes2659Open in IMG/M
3300017719|Ga0181390_1071703All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium973Open in IMG/M
3300017720|Ga0181383_1111717Not Available734Open in IMG/M
3300017720|Ga0181383_1130564Not Available674Open in IMG/M
3300017727|Ga0181401_1090773Not Available785Open in IMG/M
3300017728|Ga0181419_1080963All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium812Open in IMG/M
3300017729|Ga0181396_1032202All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1044Open in IMG/M
3300017730|Ga0181417_1033777All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1260Open in IMG/M
3300017730|Ga0181417_1095230All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium720Open in IMG/M
3300017731|Ga0181416_1002148All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes4896Open in IMG/M
3300017731|Ga0181416_1020221All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1563Open in IMG/M
3300017732|Ga0181415_1063878All Organisms → cellular organisms → Bacteria834Open in IMG/M
3300017733|Ga0181426_1045952All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium861Open in IMG/M
3300017734|Ga0187222_1015968All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1833Open in IMG/M
3300017735|Ga0181431_1021933Not Available1486Open in IMG/M
3300017738|Ga0181428_1162954All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium521Open in IMG/M
3300017741|Ga0181421_1010671All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes2550Open in IMG/M
3300017742|Ga0181399_1116256All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium656Open in IMG/M
3300017744|Ga0181397_1037873Not Available1365Open in IMG/M
3300017744|Ga0181397_1160480All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium572Open in IMG/M
3300017746|Ga0181389_1125750All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium693Open in IMG/M
3300017749|Ga0181392_1096404Not Available885Open in IMG/M
3300017750|Ga0181405_1003699All Organisms → cellular organisms → Bacteria4682Open in IMG/M
3300017752|Ga0181400_1011387All Organisms → cellular organisms → Bacteria3070Open in IMG/M
3300017752|Ga0181400_1022360All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium2082Open in IMG/M
3300017752|Ga0181400_1078208Not Available991Open in IMG/M
3300017756|Ga0181382_1164038Not Available574Open in IMG/M
3300017757|Ga0181420_1159760All Organisms → cellular organisms → Bacteria669Open in IMG/M
3300017759|Ga0181414_1026486Not Available1575Open in IMG/M
3300017759|Ga0181414_1093521Not Available792Open in IMG/M
3300017760|Ga0181408_1029920All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1490Open in IMG/M
3300017763|Ga0181410_1068092All Organisms → Viruses → Predicted Viral1065Open in IMG/M
3300017763|Ga0181410_1096488Not Available860Open in IMG/M
3300017763|Ga0181410_1129886All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium716Open in IMG/M
3300017764|Ga0181385_1007736All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes3528Open in IMG/M
3300017764|Ga0181385_1026708Not Available1837Open in IMG/M
3300017764|Ga0181385_1048839All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1318Open in IMG/M
3300017764|Ga0181385_1274161All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium504Open in IMG/M
3300017765|Ga0181413_1040895All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1445Open in IMG/M
3300017765|Ga0181413_1109922All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium838Open in IMG/M
3300017765|Ga0181413_1205224All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium588Open in IMG/M
3300017767|Ga0181406_1036714All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon1529Open in IMG/M
3300017767|Ga0181406_1059376All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1177Open in IMG/M
3300017767|Ga0181406_1103659All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium860Open in IMG/M
3300017767|Ga0181406_1221947All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium558Open in IMG/M
3300017768|Ga0187220_1062156All Organisms → Viruses → Predicted Viral1123Open in IMG/M
3300017769|Ga0187221_1087555Not Available962Open in IMG/M
3300017776|Ga0181394_1018502All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales2535Open in IMG/M
3300017781|Ga0181423_1021816All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium2621Open in IMG/M
3300020165|Ga0206125_10017455All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes4479Open in IMG/M
3300020165|Ga0206125_10029224All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium3044Open in IMG/M
3300020335|Ga0211690_1065961Not Available804Open in IMG/M
3300020358|Ga0211689_1019662All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium2256Open in IMG/M
3300020421|Ga0211653_10086528All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1397Open in IMG/M
3300020438|Ga0211576_10022954All Organisms → cellular organisms → Bacteria3753Open in IMG/M
3300020438|Ga0211576_10193113All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1087Open in IMG/M
3300020595|Ga0206126_10139897Not Available1161Open in IMG/M
3300020595|Ga0206126_10403104Not Available602Open in IMG/M
3300022164|Ga0212022_1003783All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1865Open in IMG/M
(restricted) 3300023109|Ga0233432_10492234All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium515Open in IMG/M
3300025086|Ga0208157_1016793All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium2292Open in IMG/M
3300025128|Ga0208919_1232668All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium541Open in IMG/M
3300025137|Ga0209336_10139268All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium650Open in IMG/M
3300025138|Ga0209634_1008632All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes6290Open in IMG/M
3300025138|Ga0209634_1010324All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium5655Open in IMG/M
3300025138|Ga0209634_1052720All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1999Open in IMG/M
3300025138|Ga0209634_1052841Not Available1996Open in IMG/M
3300025138|Ga0209634_1063025All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1775Open in IMG/M
3300025138|Ga0209634_1091638All Organisms → Viruses → Predicted Viral1367Open in IMG/M
3300025138|Ga0209634_1186573All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium807Open in IMG/M
3300025696|Ga0209532_1095306All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1033Open in IMG/M
3300025897|Ga0209425_10333029All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium748Open in IMG/M
3300028022|Ga0256382_1053566Not Available942Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SeawaterEnvironmental → Aquatic → Marine → Strait → Unclassified → Seawater48.46%
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine30.77%
Pelagic MarineEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine4.62%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine3.85%
SeawaterEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Seawater3.85%
Pelagic MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine2.31%
MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine2.31%
SeawaterEnvironmental → Aquatic → Marine → Inlet → Unclassified → Seawater0.77%
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous0.77%
MarineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Marine0.77%
MarineEnvironmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine0.77%
EstuarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine0.77%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000115Marine microbial communities from Delaware Coast, sample from Delaware MO Summer July 2011EnvironmentalOpen in IMG/M
3300000116Marine microbial communities from Delaware Coast, sample from Delaware MO Spring March 2010EnvironmentalOpen in IMG/M
3300000148Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - 47 07/07/10 100mEnvironmentalOpen in IMG/M
3300001346Pelagic Microbial community sample from North Sea - COGITO 998_met_01EnvironmentalOpen in IMG/M
3300001450Marine viral communities from the Pacific Ocean - LP-53EnvironmentalOpen in IMG/M
3300001589Marine viral communities from the Pacific Ocean - LP-40EnvironmentalOpen in IMG/M
3300006484Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535EnvironmentalOpen in IMG/M
3300006735Marine viral communities from the Subarctic Pacific Ocean - 5B_ETSP_OMZ_AT15132_CsCl metaGEnvironmentalOpen in IMG/M
3300006737Marine viral communities from the Subarctic Pacific Ocean - 5_ETSP_OMZ_AT15132 metaGEnvironmentalOpen in IMG/M
3300006749Marine viral communities from the Subarctic Pacific Ocean - 9_ETSP_OMZ_AT15188 metaGEnvironmentalOpen in IMG/M
3300006752Marine viral communities from the Subarctic Pacific Ocean - 13_ETSP_OMZ_AT15268 metaGEnvironmentalOpen in IMG/M
3300006929Marine viral communities from the Subarctic Pacific Ocean - 4_ETSP_OMZ_AT15127 metaGEnvironmentalOpen in IMG/M
3300009423Pelagic marine microbial communities from North Sea - COGITO_mtgs_100423EnvironmentalOpen in IMG/M
3300009426Pelagic marine microbial communities from North Sea - COGITO_mtgs_100420EnvironmentalOpen in IMG/M
3300009433Pelagic marine microbial communities from North Sea - COGITO_mtgs_100330EnvironmentalOpen in IMG/M
3300009435Pelagic marine microbial communities from North Sea - COGITO_mtgs_100413EnvironmentalOpen in IMG/M
3300009436Marine eukaryotic phytoplankton communities from Arctic Ocean - Fram Strait ARC3M MetagenomeEnvironmentalOpen in IMG/M
3300009472Pelagic marine microbial communities from North Sea - COGITO_mtgs_110404EnvironmentalOpen in IMG/M
3300010148Marine viral communities from the Subarctic Pacific Ocean - 9B_ETSP_OMZ_AT15188_CsCl metaGEnvironmentalOpen in IMG/M
3300010149Marine viral communities from the Subarctic Pacific Ocean - 13B_ETSP_OMZ_AT15268_CsCl metaGEnvironmentalOpen in IMG/M
3300014959Marine microbial communities to study oil droplet degradation from Trondheimsfjord, Norway - 0148 : 4 days incubationEnvironmentalOpen in IMG/M
3300017705Marine viral communities from the Subarctic Pacific Ocean - Lowphox_08 viral metaGEnvironmentalOpen in IMG/M
3300017706Marine viral communities from the Subarctic Pacific Ocean - Lowphox_13 viral metaGEnvironmentalOpen in IMG/M
3300017708Marine viral communities from the Subarctic Pacific Ocean - Lowphox_04 viral metaGEnvironmentalOpen in IMG/M
3300017709Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 10 SPOT_SRF_2010-04-27EnvironmentalOpen in IMG/M
3300017710Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 26 SPOT_SRF_2011-09-28EnvironmentalOpen in IMG/M
3300017713Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 14 SPOT_SRF_2010-08-11EnvironmentalOpen in IMG/M
3300017714Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 35 SPOT_SRF_2012-08-15EnvironmentalOpen in IMG/M
3300017717Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 27 SPOT_SRF_2011-10-25EnvironmentalOpen in IMG/M
3300017719Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 13 SPOT_SRF_2010-07-21EnvironmentalOpen in IMG/M
3300017720Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 6 SPOT_SRF_2009-12-23EnvironmentalOpen in IMG/M
3300017727Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 24 SPOT_SRF_2011-07-20EnvironmentalOpen in IMG/M
3300017728Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 42 SPOT_SRF_2013-04-24EnvironmentalOpen in IMG/M
3300017729Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 19 SPOT_SRF_2011-01-11EnvironmentalOpen in IMG/M
3300017730Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 40 SPOT_SRF_2013-02-13EnvironmentalOpen in IMG/M
3300017731Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 39 SPOT_SRF_2013-01-16EnvironmentalOpen in IMG/M
3300017732Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 38 SPOT_SRF_2012-12-11EnvironmentalOpen in IMG/M
3300017733Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 49 SPOT_SRF_2013-12-23EnvironmentalOpen in IMG/M
3300017734Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 4 SPOT_SRF_2009-09-24 (version 2)EnvironmentalOpen in IMG/M
3300017735Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 54 SPOT_SRF_2014-05-21EnvironmentalOpen in IMG/M
3300017738Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 51 SPOT_SRF_2014-02-12EnvironmentalOpen in IMG/M
3300017741Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 44 SPOT_SRF_2013-06-19EnvironmentalOpen in IMG/M
3300017742Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 22 SPOT_SRF_2011-05-21EnvironmentalOpen in IMG/M
3300017744Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 20 SPOT_SRF_2011-02-23EnvironmentalOpen in IMG/M
3300017746Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 12 SPOT_SRF_2010-06-29EnvironmentalOpen in IMG/M
3300017749Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 15 SPOT_SRF_2010-09-15EnvironmentalOpen in IMG/M
3300017750Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 28 SPOT_SRF_2011-11-29EnvironmentalOpen in IMG/M
3300017752Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 23 SPOT_SRF_2011-06-22EnvironmentalOpen in IMG/M
3300017756Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 5 SPOT_SRF_2009-10-22EnvironmentalOpen in IMG/M
3300017757Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 43 SPOT_SRF_2013-05-22EnvironmentalOpen in IMG/M
3300017759Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 37 SPOT_SRF_2012-11-28EnvironmentalOpen in IMG/M
3300017760Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 31 SPOT_SRF_2012-02-16EnvironmentalOpen in IMG/M
3300017763Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 33 SPOT_SRF_2012-06-20EnvironmentalOpen in IMG/M
3300017764Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 8 SPOT_SRF_2010-02-11EnvironmentalOpen in IMG/M
3300017765Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 36 SPOT_SRF_2012-09-28EnvironmentalOpen in IMG/M
3300017767Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 29 SPOT_SRF_2011-12-20EnvironmentalOpen in IMG/M
3300017768Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 6 SPOT_SRF_2009-12-23 (version 2)EnvironmentalOpen in IMG/M
3300017769Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 5 SPOT_SRF_2009-10-22 (version 2)EnvironmentalOpen in IMG/M
3300017776Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 17 SPOT_SRF_2010-11-23EnvironmentalOpen in IMG/M
3300017781Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 46 SPOT_SRF_2013-08-14EnvironmentalOpen in IMG/M
3300020165Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160331_1EnvironmentalOpen in IMG/M
3300020335Marine microbial communities from Tara Oceans - TARA_B100000768 (ERX556030-ERR599035)EnvironmentalOpen in IMG/M
3300020358Marine microbial communities from Tara Oceans - TARA_B100000768 (ERX555925-ERR599009)EnvironmentalOpen in IMG/M
3300020421Marine microbial communities from Tara Oceans - TARA_B100000902 (ERX556005-ERR599007)EnvironmentalOpen in IMG/M
3300020438Marine microbial communities from Tara Oceans - TARA_B100001094 (ERX555907-ERR598942)EnvironmentalOpen in IMG/M
3300020595Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160412_1EnvironmentalOpen in IMG/M
3300022164Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 (v2)EnvironmentalOpen in IMG/M
3300023109 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_122_August2016_10_MGEnvironmentalOpen in IMG/M
3300025086Marine viral communities from the Subarctic Pacific Ocean - 5_ETSP_OMZ_AT15132 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025128Marine viral communities from the Subarctic Pacific Ocean - 4_ETSP_OMZ_AT15127 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025137Marine viral communities from the Pacific Ocean - LP-32 (SPAdes)EnvironmentalOpen in IMG/M
3300025138Marine viral communities from the Pacific Ocean - LP-40 (SPAdes)EnvironmentalOpen in IMG/M
3300025696Pelagic Microbial community sample from North Sea - COGITO 998_met_02 (SPAdes)EnvironmentalOpen in IMG/M
3300025897Pelagic Microbial community sample from North Sea - COGITO 998_met_05 (SPAdes)EnvironmentalOpen in IMG/M
3300028022Seawater viral communities from deep brine pools at the bottom of the Mediterranean Sea - LS1 750mEnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
DelMOSum2011_1013864443300000115MarineMENMNKKSKFKPGQGKTQKQYEDSTRFAWYGVVGMVLLVILLTLLGGCATTHDVSKECCKSEKTSAK*
DelMOSum2011_1018142633300000115MarineMANMNKKSPGQGKTPQQYTDSTRLAWYGVVGMTLLVILLTLLGGCATTNETPKKPCCKTEKKC*
DelMOSpr2010_1018880923300000116MarineMNKKSKFKPGQGKTQKQYEDSTRFAWYGVVGMVLLVILLTLLGGCATTHDVSKECCKSEKTSAK*
SI47jul10_100mDRAFT_104719523300000148MarineMNKKRKFKPGQGKTQKQYEDSAKFAWYGVVGMVLLVILLTLLGGCATTHDVSKECCKSEKTSAK*
JGI20151J14362_1009827533300001346Pelagic MarineMENMNKKRKFKPGQGKTQKQYTDSTRFAWYGVVGMVLLVILLTLLGGCATTHDVSKECCKTKEISAE*
JGI24006J15134_1001002253300001450MarineMENMNKKNKFKPGQGKTPQQYTDSTKFAWYGVVGMIVLLIIMTLLGGCAITHETSKECCKSKKTIEKCD*
JGI24006J15134_1001581033300001450MarineMESLNKKPEQGKTPQQYTDSTRLAWYGVVGMTLLLILLTLLGGCTTSKECCKKEQKQNYGSERTN*
JGI24006J15134_1001898243300001450MarineMVNMNKKHNFKPGQGKTQKQYTDSTRFAWYGVVGMIIILLLTSLLMGCATTHEISKECCKSKTISTE*
JGI24006J15134_1001942273300001450MarineMANTNKKSQRQGKTPQQYTDSTRLAWYGVVGMTLLVILLTLLGGCATTHDTSKECCKTKKISTK*
JGI24006J15134_1004763253300001450MarineMANMNKKSSRQGKTPQQYTDSTRFAWYGVVGMTLLVILLTLLGGCATTHETSKECCKSKKTIEKCD*
JGI24006J15134_1006505243300001450MarineMENSNKKRKFTPGQGKTPQQYRDSAKFAWYGVVGMTLLIILLTLLGGCATTHDTSKECCKTKKTSTK*
JGI24006J15134_1013049933300001450MarineMENMNKKRKFKPGQGKTQKQYTDSTRFAWYGVVGMVLLVILLTLLGGCATTHDVSKECCKTKTISTE*
JGI24005J15628_10005370103300001589MarineMENSNKKXKFTPGQGKTPQQYRDSAKFAWYGVVGMTLLIILLTLLGGCATTHDTSKECCKTKKTSTK*
JGI24005J15628_1008971823300001589MarineMANTNKKSSGQGKTPQQYTDSTRLAWYGVVGMTLLVILLTLLGGCATTHETSKKCCKSKTISAE*
JGI24005J15628_1019904113300001589MarineHLTYMENMNKKRKFKPGQGKTQKQYTDSTRFAWYGVVGMVLLVILLTLLGGCATTHDVSKECCKTKTISTE*
Ga0070744_1014602223300006484EstuarineMANLNKKLRQGKTPQQYTDSTRLAWYGVVGMTLLLILLTLLGGCTTSKECCKKEQKQNYGSERTN*
Ga0098038_100886473300006735MarineMASMNKKHKFKSGQGKTPQQYEDSARFAWYGVLGMVILLILTSLLTGCVTTQETSKECCKSQKTSTK*
Ga0098038_102550413300006735MarineMANMNKKSPGQGKTPQQYTDSTRFAWYGVVGMTLLVILLTLLGGCATTHDTSKECCKSTKTSAE*
Ga0098037_109327443300006737MarineMANMNKKSPGQGKTPQQYTDSTRFAWYGVVGMTLLIILLTLLGGCATTHETSKECCKSKEISK*
Ga0098037_128368333300006737MarineMANMNKKHKFKPGQGKTQQQYEDSTRFAWYGVVGMIILLILMTLLGGCAITQETPKE
Ga0098042_116178523300006749MarineKNKKHKFKPGQGKTQQQYEDSTRFAWYGVVGMIILLILMTLLGGCAITQETPKECCKSQKASTK*
Ga0098048_104795523300006752MarineMASMNKKHKFKSGQGKTPQQYEDSARFAWYGLLGMVILLILTSLLTGCVTTQETSKECCKSQKTSTK*
Ga0098036_117034233300006929MarineMANMNKKSPGQGKTPQQYTDSTRIAWYGVVGMTLLVILLTLLGGCATTNETPKKPCCKTEKKC*
Ga0098036_127220933300006929MarineMASMNKKHKFKSGQGKTPQQYEDSARFAWYGVLGMVILLILTSLLTGCVTTQETSKECC
Ga0115548_105317723300009423Pelagic MarineMNKKRKFKPGQGKTQKQYTDSTRFAWYGVIGMTLLVILLSLLGGCATTHSTSKECCKKEQKQSYGSERTN*
Ga0115547_110522933300009426Pelagic MarineMNKKHKFKPGQGKTQKQYTDSTRFAWYGVVGMILLVILLTLLGGCATTHDTSKECCKTKKISTK*
Ga0115547_116032013300009426Pelagic MarineMNKKRKFKPGQGKTQKQYTDSTRFAWYGVVGMVLLVILLTLLGGCATTHDVSKECCKTKEISAE*
Ga0115545_132663123300009433Pelagic MarineMNKKHKFKPGQGKTQKQYTDSTRFAWYGVVGMVLLVILLTLLGGCATTHDVSKECCKTKEISA
Ga0115546_113526213300009435Pelagic MarineMNKKSPGQGKTPQQYTDSTRFAWYGVVGMTLLVILLSLLGGCATTQPTKKCCEKTHVIT
Ga0115008_1060738533300009436MarineMNKKSPGQGKTPQQYTDSTRFAWYGVVGMTLLVILLTLLGGCATTHDISKECCKAKEIPAE*
Ga0115554_144744823300009472Pelagic MarineMNKKHKFKPGQGKTQKQYTDSTRFAWYGIVGMILLVILLTLLGGCATTHDTSKECCKTKKISTK*
Ga0098043_112012523300010148MarineMNKKHKFKSGQGKTPQQYEDSARFAWYGVLGMVILLILTSLLTGCVTTQETSKECCKSQKTSTK*
Ga0098049_119850323300010149MarineMNKKHKFKSGQGKTPQQYEDSARFAWYGVLGMVISLILTSLLTGCVTTQETSKECCKSQKTSTK*
Ga0134299_105093623300014959MarineYMANMNKKSSRQGKTPQQYTDSTRFAWYGVVGMTLLVILLTLLGGCATTHETSKECCKSKKTIEKCD*
Ga0181372_107117923300017705MarineMENMNKKSPGQGKTQKQYEDSARFAWYGVVGMTLLVILLTLLGGCATTNETPKKPCCKTEKKC
Ga0181377_100711643300017706MarineMANTNKKLPGQGKTPQQYTDSTKLAWYGVVGMTLLVILLTLLGGCATTHETSKECCKSKEIFK
Ga0181377_101083323300017706MarineMENMSKKSPGQGKTQQQYTDSTRFAWYGVVGMTLLVILLTLLGGCATTHDTSKECCKSTKTSAE
Ga0181377_101140113300017706MarineMENMNKKNKFKPGQGKTPQQYTDSTKFAWYGVVGMIILLIIMTLLGGCAITHETSKECCKSKKTIEKCD
Ga0181377_101333153300017706MarineMENMNNQGKRPGQYTDSTRFAWYGVVCMTLLVILLSLLGGCAITHDVSKECCKSKTISAE
Ga0181377_102306513300017706MarineQGKTPQQYTDSTRFAWYGVVGMTLLVILLTLLGGCATTNETPKKPCCKTEKKC
Ga0181369_100526163300017708MarineMANMNKKSPGQGKTPQQYTDSTRFAWYGVVGMTLLVILLTLLGGCATTHDTSKECCKSTKTSAE
Ga0181369_105782713300017708MarineMANMNKKHKFKPGQGKTQQQYEDSTRFAWYGVVGMIILLILMTLLGGCAITQETSKECCKSQKTSTK
Ga0181369_113038313300017708MarineLKHLIYMANTNKKLPGQGKTPQQYTDSTKLAWYGVVGMTLLIILLTLLGGCATTHETSKECCKSKEISK
Ga0181387_100149923300017709SeawaterMENMNKKLKFKPGQGKTQKQYTDSTRFAWYGVVGMVLLVILLTLLGGCAITHDVSKECCKTKEISAE
Ga0181387_100483523300017709SeawaterMANTNKKSPGQGKTPQQYTDSTRFAWYGVVGMTLLVILLSLLGGCATTHDVSKECCKSKTISAE
Ga0181387_102484433300017709SeawaterMANMNKQGKTNKQYQDSAKFAWYGVVGMTLLVILLTLLGGCTTSKECCKKEQKQSYGSERTN
Ga0181387_105756813300017709SeawaterMASMNKKHKFKPGQGKTPQQYEDSARFAWYGVLGMIILLILTSLLTGCVTTQEISKECCKSQKTSTK
Ga0181387_109267413300017709SeawaterMNKKLGQGKTPHQYKDSARFAWYGVVGMVVILILTSLLMGCATTNETPKKPCCKTEKKC
Ga0181387_113832423300017709SeawaterMANMNKKQPGQGKTPQQYTDSTRFAWYGVVGMTLLVILLTLLGGCATTHDISKECCKSKAISAE
Ga0181403_100966223300017710SeawaterMANMNKKQPGQGKTPQQYTDSTKLAWYGVVGMTLLVILLTLLGGCATTHDISKECCKSKAISAE
Ga0181403_101098343300017710SeawaterMANMNKKSPGQGKTPQQYTDSTRFAWYGVVGMTLLVILLSLLGGCATTNETPQKPCCKTEKNVK
Ga0181403_103040833300017710SeawaterMANTNKKSSGQGKTPQQYTDSTRLAWYGVVGMTLLVILLTLLGGCTTTHETSKKCCKSKTISAE
Ga0181391_108966233300017713SeawaterLQNLNQNQLKHLIYMANMNKKSPGQGKTPQQYTDSTRFAWYGVVGMTLLVILLSLLGGCATTNETPQKPCCKTEKNVK
Ga0181391_109183423300017713SeawaterMANMNKKRKFTPGQGKTPQQYTDSTRFAWYGVVGMTLLVILLTLLGGCATTHETSKKCCKSKTISAE
Ga0181412_101649053300017714SeawaterMANMNKKSPGQGKTPQQYTDSTRFAWYGVVGMTLLVILLSLLGGCATTQPTKKCCEK
Ga0181412_112135213300017714SeawaterMANTNKKRKFKPGQGKTQQQYTDSTRFAWYGVVGMTLLVILLSLLGGCATTHETSKECCKSKKTSTK
Ga0181404_100899933300017717SeawaterMENMNKKHKFKPGQGKTQKQYNDSTRFAWYGVVGMILLVILLTLLGGCATTHDTSKECCKTKKTSTK
Ga0181390_107170343300017719SeawaterQNLNQNQLKHLIYMANMNKKSPGQGKTPQQYTDSTRFAWYGVVGMTLLVILLSLLGGCATTNETPQKPCCKTEKNVK
Ga0181383_111171733300017720SeawaterYMANTNKKSPGQGKTPQQYTDSTRFAWYGVVGMTLLVILLSLLGGCATTHDVSKECCKSKTISAE
Ga0181383_113056413300017720SeawaterMANTNKKSPGQGKTPQQYTDSTRFAWYGVVGMTLLVILLTLLGGCATTKETPKECCKSEKAC
Ga0181401_109077333300017727SeawaterYMASMNKKHKFKPGQGKTPQQYEDSARFAWYGVLGMIILLILTSLLTGCVTTQEISKECCKSQKTSTK
Ga0181419_108096323300017728SeawaterMANMNKKHKFKPGQGKTPQQYEDSARFAWYGVLGMIILLILTSLLTGCVTTQEISKECCKSQKTSTK
Ga0181396_103220233300017729SeawaterMENMNKKNKFKPGQGKTPQQYTDSTKFAWYGVVGMIILLIIMTLLGGCAITHETSKECCKSKKTIKKCD
Ga0181417_103377733300017730SeawaterMANTNKKRKFKPGQGKTQQQYTDSTRLAWYGVVGMTLLVILLTLLGGCTTTHETSKKCCKSKTISAE
Ga0181417_109523013300017730SeawaterMNKQGKTNKQYQDSAKFAWYGVVGMTLLVILLTLLGGCTTSKECCKKEQKQSYGSERTN
Ga0181416_100214843300017731SeawaterMENMNKKHKFKPGQGKTQKQYTDSTRFAWYGVVGMILLVILLTLLGGCATTHDISKECCKTKKTSTK
Ga0181416_102022133300017731SeawaterMANMNKKSPGQGKTSQQYTDSTRFAWYGVVGMTLLVILLSLLGGCATTQPTKK
Ga0181415_106387823300017732SeawaterMNKQGKTDKQYQDSAKFAWYGVVGMTLLVILLTLLGGCTTSKECCKKEQKQSYGSERTN
Ga0181426_104595213300017733SeawaterHLIYMANMNKKSPGQGKTPQQYTDSTRFAWYGVVGMTLLVILLSLLGGCATTNETPQKPCCKTEKNVK
Ga0187222_101596853300017734SeawaterMAYMNKKQPGQGKTPQQYTDSTKLAWYGVVGMTLLVILLTLLGGCATTHDISKECCKSKAISAE
Ga0181431_102193343300017735SeawaterLHHLNQNQLKHLTYMENMNKKHKFKPGQGKTQKQYTDSTRFAWYGVVGMILLVILLTLLGGCATTHDTSKECCKTKKTSTK
Ga0181428_116295423300017738SeawaterMANMNKKRKFTPGQGKTPQQYTDSTRFAWYGVVGMTLLVILLTLLGGCTTSKECCKKEQKQSYGSERTN
Ga0181421_101067133300017741SeawaterMANMNKQGKTDKQYQDSAKFAWYGVVGMTLLVILLTLLGGCTTSKECCKKEQKQSYGSERTN
Ga0181399_111625633300017742SeawaterMENMNKKHKFKPGQGKTQKQYTDSTRFAWYGVVGMILLVILLTLLGGCATTHDPSKECCKTK
Ga0181397_103787343300017744SeawaterKLRNLNQNQLKHLTYMENMNKKLKFKPGQGKTQKQYTDSTRFAWYGVVGMVLLVILLTLLGGCAITHDVSKECCKTKEISAE
Ga0181397_116048023300017744SeawaterMANMNKKSPGQGKTSQQYTDSTRFAWYGVVGMTLLVILLSLLGGCATTQPTKKCCEK
Ga0181389_112575013300017746SeawaterNQLKHLIYMANMNKKSPGQGKTPQQYTDSTRFAWYGVVGMTLLVILLSLLGGCATTNETPQKPCCKTEKNVK
Ga0181392_109640433300017749SeawaterSPGQGKTPQQYTDSTRLAWYGVVGMTLLVILLTLLGGCTTTHETSKKCCKSKTISAE
Ga0181405_1003699103300017750SeawaterNQLKHLTYMENMNKKSPGQGKTPQQYTDSTRFAWYGVVGMTLLVILLTLLGGCATTNETPKKPCCKTEKKC
Ga0181400_101138713300017752SeawaterLTYMENMNKKSPGQGKTPQQYTDSTRFAWYGVVGMTLLVILLTLLGGCATTNETPKKPCCKTEKKC
Ga0181400_102236033300017752SeawaterMANTNKKSPVKGKTPQQYTDSTRFAWYGVVGMTLLVILLSLLGGCATTHDVSKECCKSKTISAE
Ga0181400_107820813300017752SeawaterQLKHLTYMENMNKKHKFKPGQGKTQKQYTDSTRFAWYGVVGMILLVILLTLLGGCATTHDTSKECCKTKKTSTK
Ga0181382_116403813300017756SeawaterTNKKRKFKPGQGKTQQQYTDSTRFAWYGVVGMTLLVILLSLLGGCATTHETSKECCKSKKTSTK
Ga0181420_111637713300017757SeawaterQQYTDSTRFAWYGVVGMTLLVILLSLLGGCATTNETPQKPCCKTEKNVK
Ga0181420_115976023300017757SeawaterMANTNKKSPGQGKTPQQYTDSTKLAWYGVVGMTLLVILLTLLGGCATTQPTKKCCDKTVS
Ga0181414_102648613300017759SeawaterKHLTYMENMNKKLKFKPGQGKTQKQYTDSTRFAWYGVVGMVLLVILLTLLGGCAITHDVSKECCKTKEISAE
Ga0181414_109352113300017759SeawaterHLNQNQLKPLTYMANTNKKSQRQGKTPQQYTDSTRLAWYGVVGMVLLVILLTLLGGCATTHDTSKECCKTKKTSTK
Ga0181408_102992053300017760SeawaterKHLTYMANMNKKSPGQGKTPQQYTDSTRFAWYGVVGMTLLVILLSLLGGCATTNETPQKPCCKTEKNVK
Ga0181410_106809213300017763SeawaterKHLIYMANMNKKSPGQGKTPQQYTDSTRFAWYGVVGMTLLVILLSLLGGCATTNETPQKPCCKTEKNVK
Ga0181410_109648813300017763SeawaterGQGKTQQQYTDSTRFAWYGVVGMTLLVILLSLLGGCATTHETSKECCKSKKTSTK
Ga0181410_112988633300017763SeawaterMANTNKKSSGQGKTPQQYTDSTKFAWYGVVGMIILLIIMTLLGGCAITHETSKECCKSKKTIEKCD
Ga0181385_100773613300017764SeawaterKKSPGQGKTPQQYTDSTRFAWYGVVGMTLLVILLTLLGGCATTNETPKKPCCKTEKKC
Ga0181385_102670863300017764SeawaterLNQNQLKHLTYMANMNKKRKFTPGQGKTPQQYTDSTRFAWYGVVGMTLLVILLTLLGGCATTHETSKKCCKSKTISAE
Ga0181385_104883933300017764SeawaterMANMNKKSPGQGKTPQQYTDSTRFAWYGVVGMTLLVILLTLLGGCATTKETPKECCKSEKAC
Ga0181385_127416123300017764SeawaterMANMNKKSPGQGKTPQQYTDSTRLAWYGVVGMTLLVILLTLLGGCATTNETPKKPCCKTEKKC
Ga0181413_104089523300017765SeawaterMANMNKKQPGQGKTPQQYTDSTKLAWYGVVGMTPLVILLTLLGGCATTHDISKECCKSKAISAE
Ga0181413_110992233300017765SeawaterMANTNKKSPGQGKTPQQYTDSTKFAWYGVVGMTLLVILLSLLGGCATTHDVSKECCKSKTISAE
Ga0181413_120522423300017765SeawaterMANTNKKSPGQGKIPQQYTDSTKFAWYGVVGMIILLIIMTLLGGCAITHETSKECCKSKKTIEKCD
Ga0181406_103671413300017767SeawaterHLTYMANMNKKQPGQGKTPQQYTDSTKLAWYGVVGMTLLVILLTLLGGCATTKETPKECCKSEKAC
Ga0181406_105937633300017767SeawaterMANMNKKSPGQGKTSQQYTDSTRFAWYGVVGMTLLVILLSLLGGCATTQPTKKCC
Ga0181406_110365913300017767SeawaterNQNQLKHLIYMANMNKKSPGQGKTPQQYTDSTRFAWYGVVGMTLLVILLSLLGGCATTNETPQKPCCKTEKNVK
Ga0181406_122194713300017767SeawaterGKTPQQYTDSTRFAWYGVVGMTLLVILLTLLGGCATTNETPKKPCCKTEKKC
Ga0187220_106215613300017768SeawaterMENMNKKYKFKPGQGKTPQQYTDSTRFAWYGVVGMTLLVILLTLLGGCATTHDVSKECCKSKEISK
Ga0187221_108755513300017769SeawaterMENTNKKSPGQGKTPQQYTDSTRFAWYGVVGMTLLVILLTLLGGCATTKETPKECCKSEKAC
Ga0181394_101850213300017776SeawaterNLNQNQLKHLTYMENMNKKHKFKPGQGKTQKQYTDSTRFAWYGVVGMILLVILLTLLGGCATTHDTSKECCKTKKTSTK
Ga0181423_102181653300017781SeawaterMENMNKKNKFKPGQGKTPQQYTDSTKFAWYGVVGMIILLIIMTLLGGCAITHETSKECCK
Ga0206125_1001745553300020165SeawaterMENMNKKHKFKPGQGKTQKQYTDSTRFAWYGVVGMILLVILLTLLGGCATTHDTSKECCKTKKISTK
Ga0206125_1002922453300020165SeawaterMANMNKKSSRQGKTPQQYTDSTRFAWYGVVGMTLLVILLTLLGGCATTHETSKECCKSKKTIEKCD
Ga0211690_106596113300020335MarinePGQGKTPQQYRDSAKFAWYGVVGMTLLIILLTLLGGCATTHDTSKECCKTKKTSTK
Ga0211689_101966243300020358MarineMENSNKKRKFTPGQGKTPQQYRDSAKFAWYGVVGMTLLIILLTLLGGCATTHDTSKECCKTKKTSTK
Ga0211653_1008652833300020421MarineMANTNKKLPRRGKTPQQYTDSTRFAWYGVVGMTLLVILLSLLGGCATTHDVSKECCKSKTISAE
Ga0211576_1002295493300020438MarineMENMNKKSPGQGKTPQQYTDSTRFAWYGVVGMTLLVILLTLLGGCATTNETPKKPCCKTEKKC
Ga0211576_1019311333300020438MarineMENMNKKHKFKPGQGKTQKQYTDSTRFAWYGVVGMILLVILLTLLGGCATTHDTSKECCKTKKTSTK
Ga0206126_1013989733300020595SeawaterMENMNKKRKFKPGQGKTQKQYTDSTRFAWYGVIGMTLLVILLSLLGGCATTHSTSKECCKKEQKQSYGSERTN
Ga0206126_1040310433300020595SeawaterHLTYMENMNKKRKFKPGQGKTQKQYTDSTRFAWYGVVGMVLLVILLTLLGGCATTHDVSKECCKTKEISAE
Ga0212022_100378353300022164AqueousMENMNKKSKFKPGQGKTQKQYEDSTRFAWYGVVGMVLLVILLTLLGGCATTHDVSKECCKSEKTSAK
(restricted) Ga0233432_1049223423300023109SeawaterMENMNKKRKFKPGQGKTQKQYEDSAKFAWYGVVGMVLLVILLTLLGGCATTHDVSKECCKSEKTSAK
Ga0208157_101679343300025086MarineMASMNKKHKFKSGQGKTPQQYEDSARFAWYGVLGMVILLILTSLLTGCVTTQETSKECCKSQKTSTK
Ga0208919_123266823300025128MarineMANMNKKHKFKPGQGKTQQQYEDSTRFAWYGVVGMIILLILMTLLGGCAITQETPKECCKSQKASTK
Ga0209336_1013926813300025137MarineMENSNKKRKFTPGQGKTPQQYRDSAKFAWYGVVGMTLLIILLTLLGGCVTTHDTSKECCKIKKTSTK
Ga0209634_100863283300025138MarineMANTNKKSQRQGKTPQQYTDSTRLAWYGVVGMTLLVILLTLLGGCATTHDTSKECCKTKKISTK
Ga0209634_101032443300025138MarineMENMNKKNKFKPGQGKTPQQYTDSTKFAWYGVVGMIVLLIIMTLLGGCAITHETSKECCKSKKTIEKCD
Ga0209634_105272053300025138MarineMANTNKKSSGQGKTPQQYTDSTRLAWYGVVGMTLLVILLTLLGGCATTHETSKKCCKSKTISAE
Ga0209634_105284123300025138MarineMENMNKKRKFKPGQGKTQKQYTDSTRFAWYGVVGMVLLVILLTLLGGCATTHDVSKECCKTKTISTE
Ga0209634_106302533300025138MarineMVNMNKKHNFKPGQGKTQKQYTDSTRFAWYGVVGMIIILLLTSLLMGCATTHEISKECCKSKTISTE
Ga0209634_109163833300025138MarineMESLNKKPEQGKTPQQYTDSTRLAWYGVVGMTLLLILLTLLGGCTTSKECCKKEQKQNYGSERTN
Ga0209634_118657313300025138MarineMENSNKKFKFTPGQGKTPQQYRDSAKFAWYGVVGMTLLIILLTLLGGCVTTHDTSKECCKIKKTSTK
Ga0209532_109530633300025696Pelagic MarineMENMNKKRKFKPGQGKTQKQYTDSTRFAWYGVVGMVLLVILLTLLGGCATTHDVSKECCKTKEISAE
Ga0209425_1033302923300025897Pelagic MarineMENMNKKHKFKPGQGKTQKQYTDSTRFAWYGVVGMVLLVILLTLLGGCATTHDVSKECCKTKEISAE
Ga0256382_105356613300028022SeawaterLLNQNQLKHLTYMENMNNQGKTPQQYEDSTKFAWYGVVGMTILVILLSLLGGCATTQETSKECCKSKKITEKCD


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.