Basic Information | |
---|---|
Family ID | F062659 |
Family Type | Metagenome |
Number of Sequences | 130 |
Average Sequence Length | 43 residues |
Representative Sequence | VILGIVVLIYKFAPPLRMRYELVLSAALVALGVAYVMMA |
Number of Associated Samples | 110 |
Number of Associated Scaffolds | 130 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | No |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 6.92 % |
% of genes near scaffold ends (potentially truncated) | 90.77 % |
% of genes from short scaffolds (< 2000 bps) | 90.77 % |
Associated GOLD sequencing projects | 103 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.43 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (90.769 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil (16.923 % of family members) |
Environment Ontology (ENVO) | Unclassified (30.000 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (45.385 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 47.76% β-sheet: 0.00% Coil/Unstructured: 52.24% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.43 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 130 Family Scaffolds |
---|---|---|
PF04909 | Amidohydro_2 | 8.46 |
PF00296 | Bac_luciferase | 6.15 |
PF08334 | T2SSG | 5.38 |
PF00128 | Alpha-amylase | 4.62 |
PF01914 | MarC | 4.62 |
PF12697 | Abhydrolase_6 | 2.31 |
PF12681 | Glyoxalase_2 | 1.54 |
PF13649 | Methyltransf_25 | 1.54 |
PF08352 | oligo_HPY | 1.54 |
PF00144 | Beta-lactamase | 1.54 |
PF01546 | Peptidase_M20 | 1.54 |
PF00578 | AhpC-TSA | 1.54 |
PF00583 | Acetyltransf_1 | 1.54 |
PF13432 | TPR_16 | 1.54 |
PF00150 | Cellulase | 0.77 |
PF06348 | DUF1059 | 0.77 |
PF13414 | TPR_11 | 0.77 |
PF01591 | 6PF2K | 0.77 |
PF04961 | FTCD_C | 0.77 |
PF01638 | HxlR | 0.77 |
PF13673 | Acetyltransf_10 | 0.77 |
PF09365 | DUF2461 | 0.77 |
PF03706 | LPG_synthase_TM | 0.77 |
PF02518 | HATPase_c | 0.77 |
PF12840 | HTH_20 | 0.77 |
PF01266 | DAO | 0.77 |
PF13538 | UvrD_C_2 | 0.77 |
PF01370 | Epimerase | 0.77 |
PF01425 | Amidase | 0.77 |
PF13517 | FG-GAP_3 | 0.77 |
PF01740 | STAS | 0.77 |
PF05163 | DinB | 0.77 |
PF07978 | NIPSNAP | 0.77 |
PF08818 | DUF1801 | 0.77 |
PF00011 | HSP20 | 0.77 |
PF00596 | Aldolase_II | 0.77 |
PF00892 | EamA | 0.77 |
PF01243 | Putative_PNPOx | 0.77 |
PF04542 | Sigma70_r2 | 0.77 |
PF01220 | DHquinase_II | 0.77 |
PF02922 | CBM_48 | 0.77 |
PF04055 | Radical_SAM | 0.77 |
PF05378 | Hydant_A_N | 0.77 |
PF14226 | DIOX_N | 0.77 |
PF01541 | GIY-YIG | 0.77 |
COG ID | Name | Functional Category | % Frequency in 130 Family Scaffolds |
---|---|---|---|
COG2141 | Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase) | Coenzyme transport and metabolism [H] | 6.15 |
COG2095 | Small neutral amino acid transporter SnatA, MarC family | Amino acid transport and metabolism [E] | 4.62 |
COG0296 | 1,4-alpha-glucan branching enzyme | Carbohydrate transport and metabolism [G] | 4.62 |
COG0366 | Glycosidase/amylase (phosphorylase) | Carbohydrate transport and metabolism [G] | 4.62 |
COG3280 | Maltooligosyltrehalose synthase | Carbohydrate transport and metabolism [G] | 4.62 |
COG1523 | Pullulanase/glycogen debranching enzyme | Carbohydrate transport and metabolism [G] | 4.62 |
COG2367 | Beta-lactamase class A | Defense mechanisms [V] | 1.54 |
COG1686 | D-alanyl-D-alanine carboxypeptidase | Cell wall/membrane/envelope biogenesis [M] | 1.54 |
COG1680 | CubicO group peptidase, beta-lactamase class C family | Defense mechanisms [V] | 1.54 |
COG0145 | N-methylhydantoinase A/oxoprolinase/acetone carboxylase, beta subunit | Amino acid transport and metabolism [E] | 1.54 |
COG3934 | Endo-1,4-beta-mannosidase | Carbohydrate transport and metabolism [G] | 0.77 |
COG3404 | Formiminotetrahydrofolate cyclodeaminase | Amino acid transport and metabolism [E] | 0.77 |
COG4430 | Uncharacterized conserved protein YdeI, YjbR/CyaY-like superfamily, DUF1801 family | Function unknown [S] | 0.77 |
COG4941 | Predicted RNA polymerase sigma factor, contains C-terminal TPR domain | Transcription [K] | 0.77 |
COG5646 | Iron-binding protein Fra/YdhG, frataxin family (Fe-S cluster biosynthesis) | Posttranslational modification, protein turnover, chaperones [O] | 0.77 |
COG0071 | Small heat shock protein IbpA, HSP20 family | Posttranslational modification, protein turnover, chaperones [O] | 0.77 |
COG2730 | Aryl-phospho-beta-D-glucosidase BglC, GH1 family | Carbohydrate transport and metabolism [G] | 0.77 |
COG5649 | Uncharacterized conserved protein, DUF1801 domain | Function unknown [S] | 0.77 |
COG2318 | Bacillithiol/mycothiol S-transferase BstA/DinB, DinB/YfiT family (unrelated to E. coli DinB) | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.77 |
COG1733 | DNA-binding transcriptional regulator, HxlR family | Transcription [K] | 0.77 |
COG1595 | DNA-directed RNA polymerase specialized sigma subunit, sigma24 family | Transcription [K] | 0.77 |
COG1191 | DNA-directed RNA polymerase specialized sigma subunit | Transcription [K] | 0.77 |
COG0757 | 3-dehydroquinate dehydratase | Amino acid transport and metabolism [E] | 0.77 |
COG0568 | DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32) | Transcription [K] | 0.77 |
COG0392 | Predicted membrane flippase AglD2/YbhN, UPF0104 family | Cell wall/membrane/envelope biogenesis [M] | 0.77 |
COG0154 | Asp-tRNAAsn/Glu-tRNAGln amidotransferase A subunit or related amidase | Translation, ribosomal structure and biogenesis [J] | 0.77 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 90.77 % |
Unclassified | root | N/A | 9.23 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2228664022|INPgaii200_c0994832 | All Organisms → cellular organisms → Bacteria | 676 | Open in IMG/M |
3300000364|INPhiseqgaiiFebDRAFT_100342457 | Not Available | 514 | Open in IMG/M |
3300000364|INPhiseqgaiiFebDRAFT_105550928 | Not Available | 1181 | Open in IMG/M |
3300000443|F12B_10886535 | All Organisms → cellular organisms → Bacteria | 946 | Open in IMG/M |
3300000550|F24TB_11251318 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 647 | Open in IMG/M |
3300000559|F14TC_100066878 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 762 | Open in IMG/M |
3300000559|F14TC_101983653 | All Organisms → cellular organisms → Bacteria | 883 | Open in IMG/M |
3300000890|JGI11643J12802_11155396 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 707 | Open in IMG/M |
3300000956|JGI10216J12902_113105133 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 2572 | Open in IMG/M |
3300002908|JGI25382J43887_10063638 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1997 | Open in IMG/M |
3300004479|Ga0062595_101444161 | Not Available | 630 | Open in IMG/M |
3300005167|Ga0066672_10652153 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 679 | Open in IMG/M |
3300005177|Ga0066690_10872792 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 577 | Open in IMG/M |
3300005334|Ga0068869_100817173 | All Organisms → cellular organisms → Bacteria | 802 | Open in IMG/M |
3300005338|Ga0068868_101567386 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium 13_1_40CM_69_27 | 618 | Open in IMG/M |
3300005353|Ga0070669_100775553 | All Organisms → cellular organisms → Bacteria | 813 | Open in IMG/M |
3300005441|Ga0070700_101562530 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae | 563 | Open in IMG/M |
3300005445|Ga0070708_100032895 | All Organisms → cellular organisms → Bacteria | 4501 | Open in IMG/M |
3300005450|Ga0066682_10489596 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 779 | Open in IMG/M |
3300005539|Ga0068853_102078665 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae | 551 | Open in IMG/M |
3300005540|Ga0066697_10156961 | All Organisms → cellular organisms → Bacteria | 1345 | Open in IMG/M |
3300005557|Ga0066704_10253636 | All Organisms → cellular organisms → Bacteria | 1194 | Open in IMG/M |
3300005557|Ga0066704_10407881 | All Organisms → cellular organisms → Bacteria | 902 | Open in IMG/M |
3300005558|Ga0066698_10127108 | All Organisms → cellular organisms → Bacteria | 1705 | Open in IMG/M |
3300005558|Ga0066698_10295629 | All Organisms → cellular organisms → Bacteria | 1121 | Open in IMG/M |
3300005576|Ga0066708_10321686 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 992 | Open in IMG/M |
3300005586|Ga0066691_10003775 | All Organisms → cellular organisms → Bacteria | 6418 | Open in IMG/M |
3300005713|Ga0066905_101589512 | All Organisms → cellular organisms → Bacteria | 598 | Open in IMG/M |
3300005764|Ga0066903_101316597 | All Organisms → cellular organisms → Bacteria | 1351 | Open in IMG/M |
3300005764|Ga0066903_102358423 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1029 | Open in IMG/M |
3300006058|Ga0075432_10151935 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 890 | Open in IMG/M |
3300006755|Ga0079222_10299328 | All Organisms → cellular organisms → Bacteria | 1049 | Open in IMG/M |
3300006844|Ga0075428_100374064 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1528 | Open in IMG/M |
3300006847|Ga0075431_100705779 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Reyranellaceae → Reyranella → Reyranella massiliensis | 986 | Open in IMG/M |
3300006852|Ga0075433_11848728 | All Organisms → cellular organisms → Bacteria | 519 | Open in IMG/M |
3300006854|Ga0075425_102177344 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium RIFCSPLOWO2_02_FULL_62_17 | 618 | Open in IMG/M |
3300006871|Ga0075434_101428779 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → unclassified Anaerolineae → Anaerolineae bacterium | 701 | Open in IMG/M |
3300006880|Ga0075429_100181052 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1847 | Open in IMG/M |
3300006969|Ga0075419_11359559 | Not Available | 529 | Open in IMG/M |
3300007258|Ga0099793_10690533 | All Organisms → cellular organisms → Bacteria | 515 | Open in IMG/M |
3300009012|Ga0066710_100099493 | All Organisms → cellular organisms → Bacteria | 3883 | Open in IMG/M |
3300009012|Ga0066710_100604133 | All Organisms → cellular organisms → Bacteria | 1664 | Open in IMG/M |
3300009012|Ga0066710_101785126 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 930 | Open in IMG/M |
3300009143|Ga0099792_10894694 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium 13_1_40CM_69_27 | 587 | Open in IMG/M |
3300009147|Ga0114129_10427670 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1740 | Open in IMG/M |
3300009148|Ga0105243_11342407 | All Organisms → cellular organisms → Bacteria | 734 | Open in IMG/M |
3300009156|Ga0111538_10152380 | All Organisms → cellular organisms → Bacteria | 2937 | Open in IMG/M |
3300009162|Ga0075423_10615641 | All Organisms → cellular organisms → Bacteria | 1145 | Open in IMG/M |
3300009168|Ga0105104_10802046 | All Organisms → cellular organisms → Bacteria | 547 | Open in IMG/M |
3300009553|Ga0105249_10449902 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 1326 | Open in IMG/M |
3300009553|Ga0105249_11696971 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 704 | Open in IMG/M |
3300009792|Ga0126374_10592635 | All Organisms → cellular organisms → Bacteria | 817 | Open in IMG/M |
3300009792|Ga0126374_11859409 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 505 | Open in IMG/M |
3300009813|Ga0105057_1079271 | All Organisms → cellular organisms → Bacteria | 581 | Open in IMG/M |
3300010043|Ga0126380_10406101 | All Organisms → cellular organisms → Bacteria | 1014 | Open in IMG/M |
3300010046|Ga0126384_10184434 | All Organisms → cellular organisms → Bacteria | 1638 | Open in IMG/M |
3300010046|Ga0126384_10798185 | Not Available | 845 | Open in IMG/M |
3300010358|Ga0126370_10735371 | All Organisms → cellular organisms → Bacteria | 871 | Open in IMG/M |
3300010359|Ga0126376_11499141 | Not Available | 703 | Open in IMG/M |
3300010360|Ga0126372_11376194 | All Organisms → cellular organisms → Bacteria | 737 | Open in IMG/M |
3300010362|Ga0126377_13092839 | All Organisms → cellular organisms → Bacteria | 537 | Open in IMG/M |
3300010362|Ga0126377_13186153 | All Organisms → cellular organisms → Bacteria | 530 | Open in IMG/M |
3300010376|Ga0126381_102008502 | Not Available | 833 | Open in IMG/M |
3300010863|Ga0124850_1003711 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4654 | Open in IMG/M |
3300012096|Ga0137389_10178112 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1759 | Open in IMG/M |
3300012199|Ga0137383_11063403 | All Organisms → cellular organisms → Bacteria | 587 | Open in IMG/M |
3300012200|Ga0137382_10365684 | All Organisms → cellular organisms → Bacteria | 1013 | Open in IMG/M |
3300012203|Ga0137399_10558380 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 962 | Open in IMG/M |
3300012203|Ga0137399_11777396 | All Organisms → cellular organisms → Bacteria | 505 | Open in IMG/M |
3300012685|Ga0137397_10257703 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1300 | Open in IMG/M |
3300012685|Ga0137397_10435809 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → Actinomadura decatromicini | 976 | Open in IMG/M |
3300012923|Ga0137359_10692478 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 889 | Open in IMG/M |
3300012923|Ga0137359_11305867 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 614 | Open in IMG/M |
3300012930|Ga0137407_10719569 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 940 | Open in IMG/M |
3300012931|Ga0153915_10415793 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1524 | Open in IMG/M |
3300012948|Ga0126375_10378406 | All Organisms → cellular organisms → Bacteria | 1015 | Open in IMG/M |
3300012948|Ga0126375_10556408 | Not Available | 867 | Open in IMG/M |
3300012971|Ga0126369_13303556 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 528 | Open in IMG/M |
3300012975|Ga0134110_10111726 | All Organisms → cellular organisms → Bacteria | 1110 | Open in IMG/M |
3300014154|Ga0134075_10120887 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1112 | Open in IMG/M |
3300014326|Ga0157380_11539093 | All Organisms → cellular organisms → Bacteria | 719 | Open in IMG/M |
3300014861|Ga0180061_1038341 | All Organisms → cellular organisms → Bacteria | 763 | Open in IMG/M |
3300015053|Ga0137405_1289135 | All Organisms → cellular organisms → Bacteria | 3290 | Open in IMG/M |
3300015264|Ga0137403_10002604 | All Organisms → cellular organisms → Bacteria | 22027 | Open in IMG/M |
3300015264|Ga0137403_10058824 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3933 | Open in IMG/M |
3300018052|Ga0184638_1133980 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 901 | Open in IMG/M |
3300018076|Ga0184609_10493467 | All Organisms → cellular organisms → Bacteria | 558 | Open in IMG/M |
3300018422|Ga0190265_12049489 | All Organisms → cellular organisms → Bacteria | 677 | Open in IMG/M |
3300018482|Ga0066669_11502391 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 612 | Open in IMG/M |
3300019377|Ga0190264_10498987 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 831 | Open in IMG/M |
3300019789|Ga0137408_1444762 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 4619 | Open in IMG/M |
3300020004|Ga0193755_1169781 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 648 | Open in IMG/M |
3300022534|Ga0224452_1071767 | All Organisms → cellular organisms → Bacteria | 1044 | Open in IMG/M |
3300024283|Ga0247670_1090319 | All Organisms → cellular organisms → Bacteria | 563 | Open in IMG/M |
3300026295|Ga0209234_1160137 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 790 | Open in IMG/M |
3300026335|Ga0209804_1117613 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1208 | Open in IMG/M |
3300026342|Ga0209057_1089083 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1281 | Open in IMG/M |
3300026342|Ga0209057_1199449 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 570 | Open in IMG/M |
3300026538|Ga0209056_10550521 | All Organisms → cellular organisms → Bacteria | 587 | Open in IMG/M |
3300026547|Ga0209156_10056601 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2059 | Open in IMG/M |
3300026550|Ga0209474_10234825 | All Organisms → cellular organisms → Bacteria | 1143 | Open in IMG/M |
3300026552|Ga0209577_10797551 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 528 | Open in IMG/M |
3300027717|Ga0209998_10140351 | Not Available | 617 | Open in IMG/M |
3300027821|Ga0209811_10240936 | All Organisms → cellular organisms → Bacteria | 689 | Open in IMG/M |
3300027874|Ga0209465_10596529 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 547 | Open in IMG/M |
3300027875|Ga0209283_10192260 | All Organisms → cellular organisms → Bacteria | 1356 | Open in IMG/M |
3300027880|Ga0209481_10067032 | All Organisms → cellular organisms → Bacteria | 1690 | Open in IMG/M |
3300027909|Ga0209382_10381000 | Not Available | 1574 | Open in IMG/M |
3300030006|Ga0299907_11087846 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 581 | Open in IMG/M |
3300031198|Ga0307500_10071051 | All Organisms → cellular organisms → Bacteria | 883 | Open in IMG/M |
3300031229|Ga0299913_10759407 | All Organisms → cellular organisms → Bacteria | 945 | Open in IMG/M |
3300031544|Ga0318534_10046150 | All Organisms → cellular organisms → Bacteria | 2430 | Open in IMG/M |
3300031668|Ga0318542_10202898 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1000 | Open in IMG/M |
3300031682|Ga0318560_10736763 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 532 | Open in IMG/M |
3300031720|Ga0307469_11595999 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 627 | Open in IMG/M |
3300031720|Ga0307469_12180807 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. Ec3.3 | 539 | Open in IMG/M |
3300031793|Ga0318548_10266097 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 843 | Open in IMG/M |
3300031824|Ga0307413_10598500 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 902 | Open in IMG/M |
3300031943|Ga0310885_10656322 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium 13_1_40CM_69_27 | 586 | Open in IMG/M |
3300031995|Ga0307409_102307390 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 567 | Open in IMG/M |
3300032005|Ga0307411_11928131 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 550 | Open in IMG/M |
3300032012|Ga0310902_10258771 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1052 | Open in IMG/M |
3300032043|Ga0318556_10165027 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1146 | Open in IMG/M |
3300032052|Ga0318506_10469684 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 558 | Open in IMG/M |
3300032066|Ga0318514_10255149 | All Organisms → cellular organisms → Bacteria | 924 | Open in IMG/M |
3300032174|Ga0307470_10220194 | Not Available | 1230 | Open in IMG/M |
3300032174|Ga0307470_10245535 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Variovorax → unclassified Variovorax → Variovorax sp. CF079 | 1179 | Open in IMG/M |
3300032180|Ga0307471_100836133 | Not Available | 1088 | Open in IMG/M |
3300032180|Ga0307471_103765895 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium 13_1_40CM_69_27 | 536 | Open in IMG/M |
3300034176|Ga0364931_0019863 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1886 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 16.92% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 13.08% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 10.77% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 10.00% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 6.15% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 4.62% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 4.62% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.85% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 3.85% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 3.08% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 2.31% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.54% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.54% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 1.54% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.54% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.54% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.54% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 0.77% |
Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 0.77% |
Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 0.77% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.77% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.77% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.77% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.77% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil | 0.77% |
Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 0.77% |
Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 0.77% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.77% |
Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.77% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.77% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.77% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.77% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2228664022 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
3300000443 | Amended soil microbial communities from Kansas Great Prairies, USA - BrdU F1.2B clc assemly | Environmental | Open in IMG/M |
3300000550 | Amended soil microbial communities from Kansas Great Prairies, USA - BrdU amended with acetate total DNA F2.4 TB clc assemly | Environmental | Open in IMG/M |
3300000559 | Amended soil microbial communities from Kansas Great Prairies, USA - control no BrdU total DNA F1.4 TC clc assemly | Environmental | Open in IMG/M |
3300000890 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
3300002908 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_40cm | Environmental | Open in IMG/M |
3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
3300005167 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 | Environmental | Open in IMG/M |
3300005177 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 | Environmental | Open in IMG/M |
3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Host-Associated | Open in IMG/M |
3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Host-Associated | Open in IMG/M |
3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Host-Associated | Open in IMG/M |
3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Environmental | Open in IMG/M |
3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
3300005450 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 | Environmental | Open in IMG/M |
3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Host-Associated | Open in IMG/M |
3300005540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 | Environmental | Open in IMG/M |
3300005557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 | Environmental | Open in IMG/M |
3300005558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 | Environmental | Open in IMG/M |
3300005576 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 | Environmental | Open in IMG/M |
3300005586 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 | Environmental | Open in IMG/M |
3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300006058 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Host-Associated | Open in IMG/M |
3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
3300006847 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Host-Associated | Open in IMG/M |
3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
3300006880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Host-Associated | Open in IMG/M |
3300006969 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 | Host-Associated | Open in IMG/M |
3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
3300009168 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 19-21cm September2015 | Environmental | Open in IMG/M |
3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
3300009813 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N3_10_20 | Environmental | Open in IMG/M |
3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
3300010863 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (PacBio error correction) | Environmental | Open in IMG/M |
3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012931 | Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 3 metaG | Environmental | Open in IMG/M |
3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
3300012975 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_11112015 | Environmental | Open in IMG/M |
3300014154 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09212015 | Environmental | Open in IMG/M |
3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Host-Associated | Open in IMG/M |
3300014861 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLIBT27_16_10D | Environmental | Open in IMG/M |
3300015053 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300018052 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b2 | Environmental | Open in IMG/M |
3300018076 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_coex | Environmental | Open in IMG/M |
3300018422 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 T | Environmental | Open in IMG/M |
3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
3300019377 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 112 T | Environmental | Open in IMG/M |
3300019789 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
3300020004 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1a2 | Environmental | Open in IMG/M |
3300022534 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_b1 | Environmental | Open in IMG/M |
3300024283 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK11 | Environmental | Open in IMG/M |
3300026295 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
3300026335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 (SPAdes) | Environmental | Open in IMG/M |
3300026342 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 (SPAdes) | Environmental | Open in IMG/M |
3300026538 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes) | Environmental | Open in IMG/M |
3300026547 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 (SPAdes) | Environmental | Open in IMG/M |
3300026550 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 (SPAdes) | Environmental | Open in IMG/M |
3300026552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes) | Environmental | Open in IMG/M |
3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) | Host-Associated | Open in IMG/M |
3300027821 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300027874 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes) | Environmental | Open in IMG/M |
3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 (SPAdes) | Host-Associated | Open in IMG/M |
3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
3300030006 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT152D67 | Environmental | Open in IMG/M |
3300031198 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 14_S | Environmental | Open in IMG/M |
3300031229 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT155D38 | Environmental | Open in IMG/M |
3300031544 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26 | Environmental | Open in IMG/M |
3300031668 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23 | Environmental | Open in IMG/M |
3300031682 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22 | Environmental | Open in IMG/M |
3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
3300031793 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f21 | Environmental | Open in IMG/M |
3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Host-Associated | Open in IMG/M |
3300031943 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D2 | Environmental | Open in IMG/M |
3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Host-Associated | Open in IMG/M |
3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Host-Associated | Open in IMG/M |
3300032012 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D3 | Environmental | Open in IMG/M |
3300032043 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f24 | Environmental | Open in IMG/M |
3300032052 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f19 | Environmental | Open in IMG/M |
3300032066 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f18 | Environmental | Open in IMG/M |
3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
3300034176 | Sediment microbial communities from East River floodplain, Colorado, United States - 21_j17 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
INPgaii200_09948321 | 2228664022 | Soil | SLWWAVILGIVVLVYKLAPPLRMRYELVLSAALVAFGVAYVMMA |
INPhiseqgaiiFebDRAFT_1003424571 | 3300000364 | Soil | MSSLWWAVILGFVALIYKWAPPLRLRYELALSAALVALGVAYVMTA* |
INPhiseqgaiiFebDRAFT_1055509281 | 3300000364 | Soil | SLWWAVILGVVVLIYKLAPPLRIRDELVLSLALAALGVAYVRMA* |
F12B_108865352 | 3300000443 | Soil | GIVVLIYKLAPPLRMRYELVLSAALLALGVAYVMMKA* |
F24TB_112513181 | 3300000550 | Soil | GMSSLWWAVLLGTVVLIYKLAPPLRMRYELVLSAALVALGVAYLMMA* |
F14TC_1000668781 | 3300000559 | Soil | GLVVLVYKLAPPLRMREELVLSTALAALGVAYVVMR* |
F14TC_1019836532 | 3300000559 | Soil | GIVVLIYKFAPPLRMRYELVLSAALVAFGVAYVMMA* |
JGI11643J12802_111553961 | 3300000890 | Soil | GIVVLVYKLAPPLRLRYELVLSATLVALGLAYFMMA* |
JGI10216J12902_1131051332 | 3300000956 | Soil | VILGIVVLIYKFAPPLQMRYELVLSVALVALGVAYLMMA* |
JGI25382J43887_100636383 | 3300002908 | Grasslands Soil | WWAVILGIVVLIYKFAPPLRMRYELVLSAALVAFGVAYVMMA* |
Ga0062595_1014441611 | 3300004479 | Soil | VILGVVVLVYKLARPLRWRYDLALSAAMVALGVAYVLMA* |
Ga0066672_106521532 | 3300005167 | Soil | VILGIVVLIYKLAPPLRMRYELVLSAALVAFGVAYVMMA* |
Ga0066690_108727922 | 3300005177 | Soil | WWVVILSIVVLVYKFAPPLRMRYELVLSAAMVALGVAYLMMA* |
Ga0068869_1008171732 | 3300005334 | Miscanthus Rhizosphere | LGMSSLWWAVLLGIVVLVYKLVPPLRMRYELVLSAALVALGAAYLMMA* |
Ga0068868_1015673861 | 3300005338 | Miscanthus Rhizosphere | SSLWWAVVLSIVILIYKLAPPLRLRYELVLSAALVALGVAYVM* |
Ga0070669_1007755531 | 3300005353 | Switchgrass Rhizosphere | LLGMTSLWWAVILSIVIHIYKLAPPLRMHYELVLSAALVALGVAYVLTT* |
Ga0070700_1015625301 | 3300005441 | Corn, Switchgrass And Miscanthus Rhizosphere | GMSSLWWAVILGIVVLTYKLAPPLRLGYELALSLALVALGVAYFRVA* |
Ga0070708_1000328952 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | VILGIVVLTYKLAPPLRWRYELALSLALVALGVAYFRVA* |
Ga0066682_104895961 | 3300005450 | Soil | GVILGIVVLIYKLAPPLRLRHELVLSLALVALGVAYIKLA* |
Ga0068853_1020786651 | 3300005539 | Corn Rhizosphere | VLIGMSSLWWAVILGIVVLTYKLAPPLRLGYELALSLALVALGVAYFRVA* |
Ga0066697_101569611 | 3300005540 | Soil | LGMSSLWWAVILGIVVLIYKLAPPLRMRYELVLSAALVAFGVAYVMMA* |
Ga0066704_102536361 | 3300005557 | Soil | VVLIYKFAPPLRMRYELVLSAALVALGVAYVMMA* |
Ga0066704_104078812 | 3300005557 | Soil | GIVVLIYKFAPPLRMRYELVLSAALVALGVAYVMMA* |
Ga0066698_101271081 | 3300005558 | Soil | VVLIYKFAPPLRMRYELVLSAAFVALGVAYVMMA* |
Ga0066698_102956292 | 3300005558 | Soil | LLGMSSLWWAVILGIVVLIYKLAPPLRMRYELVLSAALVAFGVAYVMMA* |
Ga0066708_103216862 | 3300005576 | Soil | LGMSSLWWAVILGIVVLIYKLAPPLRLRYELVLSLALVALAVAYIKMA* |
Ga0066691_100037751 | 3300005586 | Soil | LWWAVILGIVVLIYKFAPPLPMRYELLLSAALVALGVAYLMMA* |
Ga0066905_1015895122 | 3300005713 | Tropical Forest Soil | MSSLWWAVILGLVVLVYKLAPSFDTRYELVLSAALVALGVAYAMTA* |
Ga0066903_1013165973 | 3300005764 | Tropical Forest Soil | LLGMSSLWWAVVLGFVVLVYKWAPPLRMRYELALSAVLVTLGVLYVTMA* |
Ga0066903_1023584234 | 3300005764 | Tropical Forest Soil | VVLVYKWAPPLRMRYELVLSAVLMAVGVAYVMTA* |
Ga0075432_101519352 | 3300006058 | Populus Rhizosphere | VVIVYKLAPPLRIREELVLSAALVALGVTYLVMR* |
Ga0079222_102993282 | 3300006755 | Agricultural Soil | VILVYKLTPPLRIRYELALSAALVALGVAYVMMA* |
Ga0075428_1003740641 | 3300006844 | Populus Rhizosphere | MASLWWAVLLGIVVLIYKLAPPLRMRYELILSAALVALGVAYILTA* |
Ga0075431_1007057793 | 3300006847 | Populus Rhizosphere | SLWWTVILAIVVLLYKLAPPLRMPYELLLSATLVALGVAYVMTA* |
Ga0075433_118487282 | 3300006852 | Populus Rhizosphere | VAMVLLGMASLWWAVLLGIVVLIYKLAPPLRMRYELILSAALMALGVAYILTA* |
Ga0075425_1021773441 | 3300006854 | Populus Rhizosphere | IVVLIYKLAPPLRLRYELFLSLALVALAVAYLKMA* |
Ga0075434_1014287792 | 3300006871 | Populus Rhizosphere | GMSSLWWAVILGIVVVIYKLAPPLPMRYELLLSAALVALGVAHVMMAGSTT* |
Ga0075429_1001810521 | 3300006880 | Populus Rhizosphere | IGMSSLWWAVILGIVVLVYKLAPPLQLRYEVALSLGLVALGVAYLRMA* |
Ga0075419_113595592 | 3300006969 | Populus Rhizosphere | GIVVLVYKLAPPLQLRYEVALSLGLVALGVAYLRMA* |
Ga0099793_106905331 | 3300007258 | Vadose Zone Soil | AVILGIVVLIYKFAPPLPMRYELLLSAALVALGVAYLMMA* |
Ga0066710_1000994933 | 3300009012 | Grasslands Soil | MVLIGMSTLWWAVILGIVVLIYKLAPPLRMRYELVFSLALAALGVAYLMAGQ |
Ga0066710_1006041332 | 3300009012 | Grasslands Soil | WVVILGIVVLIYKLAPPLRMRDELVLSLALVALGAAYLKMAI |
Ga0066710_1017851262 | 3300009012 | Grasslands Soil | LGMSSLWWAVILGIVVLIYKLAPPLRMRYELVLSAALVALGVAYLMMA |
Ga0099792_108946941 | 3300009143 | Vadose Zone Soil | LGIVILIYKLAPPLRMRYELVLSAALVALGVAYVIW* |
Ga0114129_104276701 | 3300009147 | Populus Rhizosphere | SLWWAVILGVVVLIYKFAPPLRLRDELVLSAALVALGVAYVMMA* |
Ga0105243_113424071 | 3300009148 | Miscanthus Rhizosphere | VLLGVVVLVYKLVPPLRMRYELVLSAALVALGAAYLMMA* |
Ga0111538_101523805 | 3300009156 | Populus Rhizosphere | LGTVVLIYKFAPPLRMRSELVLSAALVALGVAYVMVA* |
Ga0075423_106156413 | 3300009162 | Populus Rhizosphere | TLSIVVLVYKFAPPLRMRYELLLSAALVALGVAYLMTA* |
Ga0105104_108020462 | 3300009168 | Freshwater Sediment | LGMSSLWWAVILGIVVLIYKLAPPLRMRYELVLSAALVALGVAYVIVA* |
Ga0105249_104499021 | 3300009553 | Switchgrass Rhizosphere | VILGTVVLIYKFAPPLRMRYELVLSAALVALGVAYVMMA* |
Ga0105249_116969712 | 3300009553 | Switchgrass Rhizosphere | WWAVILGIVVLVYKLAPPLRLRYELVLSLALVVLGVAYVVMA* |
Ga0126374_105926351 | 3300009792 | Tropical Forest Soil | WAVILGIVTLIYKLAPPLRTRYELVLVAFLVALGVAYLAMA* |
Ga0126374_118594091 | 3300009792 | Tropical Forest Soil | SLWWAVILGLVVLIYKLAPPLRMRDELVLAIALVALGVAYVKMA* |
Ga0105057_10792712 | 3300009813 | Groundwater Sand | VILGIVVLIYKLAPPLRMRHELVLSLALAALGVVFATTAIP* |
Ga0126380_104061012 | 3300010043 | Tropical Forest Soil | VLVYKFAPPLPMRYELALSAALVALGVAYIIGTR* |
Ga0126384_101844343 | 3300010046 | Tropical Forest Soil | LGMSSLWWAVILGLVVLFYKWASPLLMRSGLALSASLVALGVVYAMMA* |
Ga0126384_107981853 | 3300010046 | Tropical Forest Soil | IVLFYKWAPPLRMRYELALSAALVALGVVYAMTA* |
Ga0126370_107353713 | 3300010358 | Tropical Forest Soil | IYKFVPPLPIRYELGLSAALVGLGVAYAMMARGGP* |
Ga0126376_114991412 | 3300010359 | Tropical Forest Soil | WWAAILSIVVLVYKFAPPLRLGYELILSLALAALGVAYVMTA* |
Ga0126372_113761942 | 3300010360 | Tropical Forest Soil | GWTVILGLVVVIYKLAPPLPTRYELALSAVLVALGVLHVMMA* |
Ga0126377_130928391 | 3300010362 | Tropical Forest Soil | ILGLVVVIYKLAPPLPTRYELALSGALVALGVAYVMMA* |
Ga0126377_131861532 | 3300010362 | Tropical Forest Soil | LWWAVILGLVVLVYKLAPPLRMREELILSAALVALGMAYFVCSS* |
Ga0126381_1020085021 | 3300010376 | Tropical Forest Soil | MSSLWWGVILSLVVLIYKFVPPLPIRYELALSAALVALGVAYVMMARGGP* |
Ga0124850_10037112 | 3300010863 | Tropical Forest Soil | VVILSLVVLVYKFAPPLPMRYELALSAALVALGVAYVIGTR* |
Ga0137389_101781125 | 3300012096 | Vadose Zone Soil | LWWAVILSIVVLVYKFAPPLRMRYELVLSTAMVALGVAYLMMA* |
Ga0137383_110634032 | 3300012199 | Vadose Zone Soil | GMSSLWWGVILGIVVLIYKLAPPLRMRDELVLALALVALGVAYIRMA* |
Ga0137382_103656842 | 3300012200 | Vadose Zone Soil | SSLSWAVILGIVILIYKLAPPLRMRYELVLSAALVALGVAYVIW* |
Ga0137399_105583802 | 3300012203 | Vadose Zone Soil | VILGIVVLIYKLAPPLRMRYELVLSLALVALGVAYLIVA* |
Ga0137399_117773961 | 3300012203 | Vadose Zone Soil | AVILGLVVLVYKLAPPLRMRYELALSAALVALGLAYVIGTR* |
Ga0137397_102577032 | 3300012685 | Vadose Zone Soil | MQCGAHGAMVLIGMVSLWWTVILGIVVVIYKLAPPLRMRHELVLSLAVAALGVACMTMA* |
Ga0137397_104358093 | 3300012685 | Vadose Zone Soil | GIVALVYKFAPPLRMRYELVLSAALVALGVAYVMMA* |
Ga0137359_106924783 | 3300012923 | Vadose Zone Soil | LWWGVILGIVVLIYKLAPPLRMRDELVLSLALVALGVAYIRMA* |
Ga0137359_113058672 | 3300012923 | Vadose Zone Soil | LWWGVILGIVVLIYKLAPPLRMRYELVLSAALVALGVTHLMMA* |
Ga0137407_107195693 | 3300012930 | Vadose Zone Soil | WGVILGVVVFIYKLAPPLRMRDELFLSLALVALGVTYIRMA* |
Ga0153915_104157932 | 3300012931 | Freshwater Wetlands | GMSSLWWGMILGIVVLIYKLAPPLRMRDELVLSLALMALGVAYIRIA* |
Ga0126375_103784063 | 3300012948 | Tropical Forest Soil | VVLIYKFVPPLPIRYELALSAALVGLGVAYVMMA* |
Ga0126375_105564082 | 3300012948 | Tropical Forest Soil | AMVLIGMSSLWWAVILGIIVLIYKLAPPLRMRDELVLAIALVALGVAYVKVA* |
Ga0126369_133035561 | 3300012971 | Tropical Forest Soil | MVLLGMSSLWWGVTLGLVVLIYKFVPPLPIRYELALSAALVALGVAYVMMA* |
Ga0134110_101117261 | 3300012975 | Grasslands Soil | LWWAVILGLVVLIYKFAPPLRMRYELALSAALVALGVAYVIGTR* |
Ga0134075_101208872 | 3300014154 | Grasslands Soil | LWWAVILGIVVLTYKLAPPLRLRYELVLSLALVALAVAYIKMA* |
Ga0157380_115390931 | 3300014326 | Switchgrass Rhizosphere | IVVLTYKLAPPLRLGYELALSLALVALGVAYFRVA* |
Ga0180061_10383412 | 3300014861 | Soil | AMVLLGMSSLWWAVILGLVVLIYKLAPPLSMRYELALSAALVALGVAYVMMA* |
Ga0137405_12891354 | 3300015053 | Vadose Zone Soil | MMAMVLIGMSSLGWAVILGIVVLIYKLAPPLRMRYELVLSLALVALGVAYLIVA* |
Ga0137403_1000260424 | 3300015264 | Vadose Zone Soil | VVLIYKFAPPLRMRYELVLSAALVAFGVAYVMMA* |
Ga0137403_100588244 | 3300015264 | Vadose Zone Soil | VVLIYKFAPPLRMRYELVLSAALVALGAAYVMMA* |
Ga0184638_11339801 | 3300018052 | Groundwater Sediment | LGIVVLVYKLAPPLRMRNELVLSLALAALGVVYVTTA |
Ga0184609_104934672 | 3300018076 | Groundwater Sediment | GMSSLWWAVILGVVVLLYKLAPALQMRYEVVLSLALVALGVVYATTP |
Ga0190265_120494893 | 3300018422 | Soil | VILGIVVLIYKLVPPLRMRDELVLSLALVALGVAYIRMA |
Ga0066669_115023912 | 3300018482 | Grasslands Soil | VILGIVVLIYKLAPPLRMRYELVLSAALVAFGVAYVMMA |
Ga0190264_104989872 | 3300019377 | Soil | VLGVVVLIYKLAPLLHMRHELVLAAALVALGVAYVVMA |
Ga0137408_14447627 | 3300019789 | Vadose Zone Soil | VILGIVVLIYKLAPPLRMRYELGLSAALVALGLAYVMMA |
Ga0193755_11697812 | 3300020004 | Soil | LWWAVILSIVILIYKLAPPLRMRYELVLSAALVALGVTYLMMA |
Ga0224452_10717671 | 3300022534 | Groundwater Sediment | MSSLWWAVILGIVVLIYKFAPPLRMRYELLLSAAPVALGVAYVMMA |
Ga0247670_10903191 | 3300024283 | Soil | LLGMSSFWWAVILGFVVLIYKLAPPLRMRYELALSAALVALGVAYVTMA |
Ga0209234_11601371 | 3300026295 | Grasslands Soil | MSSLWWAVIMGIVVLIYKFAPPLRMRYELVLSAALVVLGVAYVMMRETDKA |
Ga0209804_11176132 | 3300026335 | Soil | IVVLIYKFAPPLRMRYELVLSAALVALGVAYVMMA |
Ga0209057_10890833 | 3300026342 | Soil | VILGIVVLIYKFAPPLRMRYELVLSAALVALGVAYVMMA |
Ga0209057_11994492 | 3300026342 | Soil | GMSSLWWVVILGIVVLIYKLAPPLRMRYELVLSAALVAFGVAYVMMA |
Ga0209056_105505212 | 3300026538 | Soil | LGIVVLVYKFAPPLRMRYELVLSAALVALGVAYVMMA |
Ga0209156_100566013 | 3300026547 | Soil | VVILGIVVLIYKLAPPLRMRYELVLSAALVAFGVAYVMMA |
Ga0209474_102348253 | 3300026550 | Soil | GIVVLIYKLAPPLRMRYELVLSAALVAFGVAYVMMA |
Ga0209577_107975511 | 3300026552 | Soil | MSSLWWAVIMGIVVLIYKFAPPLRMRYELVLSAALVVLGVAYVMMRETDKAR |
Ga0209998_101403512 | 3300027717 | Arabidopsis Thaliana Rhizosphere | AMVLLGMASLGWSVLLGLVVLVYKLAPPLRMREELALAVALVALGVAYVVMA |
Ga0209811_102409361 | 3300027821 | Surface Soil | AFIVAIYKLAPPLQTRYELALSLALAALGVVYATTA |
Ga0209465_105965291 | 3300027874 | Tropical Forest Soil | WWGVILGLVVLIYKFVPPLPIRYELALSAALVALGVAYVMMA |
Ga0209283_101922602 | 3300027875 | Vadose Zone Soil | LGIVVLIYKLAPPLRMRNELVLSLALAALGVVYVTTA |
Ga0209481_100670323 | 3300027880 | Populus Rhizosphere | WAVILGLVVLAYKLAPPLQTRYELVLSAALVALGVVYVMVA |
Ga0209382_103810001 | 3300027909 | Populus Rhizosphere | IGMSSLWWAVILGIVVLVYKLAPPLQLRYEVALSLGLVALGVAYLRMA |
Ga0299907_110878461 | 3300030006 | Soil | LLGMSSLWWAVLLGIVVLVYKLSPPLPLRYELALSAALVALGVAYVMVA |
Ga0307500_100710511 | 3300031198 | Soil | GMSSLWWAVILSIVILIYKLAPPLRMRYELVLSAALVALGVAYVIW |
Ga0299913_107594071 | 3300031229 | Soil | MSSLWWAVLLGIVVLVYKLSPPLPLRYELALSAALVALGVAYVMGA |
Ga0318534_100461504 | 3300031544 | Soil | WGVTLGFVVLIYKFVPPLPIRYELALSAALVGLGVAYVMMA |
Ga0318542_102028982 | 3300031668 | Soil | AMSSLWWAVVLGVVVLVYKWAPPLRMRYELVLSAALVALGAAYVMTA |
Ga0318560_107367632 | 3300031682 | Soil | WWAVVLGVVVLVYKWAPPLRMRYELVLSAALVALGAAYVMTA |
Ga0307469_115959992 | 3300031720 | Hardwood Forest Soil | VLLGMSSLWWAVVLGIVVLIYKLAPPLRMRHELILSAALVALGVVYVAMA |
Ga0307469_121808071 | 3300031720 | Hardwood Forest Soil | LGVVVLIYKLAPPLRMRYELVLSAALVAFGVTYILTA |
Ga0318548_102660972 | 3300031793 | Soil | SLWWAVVLGVVVLVYKWAPPLRMRYELVLSAALVALGAAYVMTA |
Ga0307413_105985002 | 3300031824 | Rhizosphere | AVILAIVILVYKLAPPLRMRHELVLSAPLAAVGVGYLMMA |
Ga0310885_106563222 | 3300031943 | Soil | SSLWWAVILSIVILIYKLAPPLRMRYELVLSAALVAFGVAYVI |
Ga0307409_1023073901 | 3300031995 | Rhizosphere | AILGIVVLIYKLVPPLRMRYELVLSAALMALGAAYLMMA |
Ga0307411_119281312 | 3300032005 | Rhizosphere | AAILGIVVLIYKLVPPLRMRYELVLSAALMALGAAYLMMA |
Ga0310902_102587711 | 3300032012 | Soil | VLLGMSSLWWAVILGIVVLVYKLVPPLRMRYELILSATLVALGAAYIMLA |
Ga0318556_101650271 | 3300032043 | Soil | MSSLWWAVVLGVVVLVYKWAPPLRMRYELVLSAALVALGAAYVMTA |
Ga0318506_104696842 | 3300032052 | Soil | LGVVVLVYKWAPPLRMRYELVLSAALVALGAAYVMTA |
Ga0318514_102551493 | 3300032066 | Soil | LWWGVTLGFVVLIYKFVPPLPIRYELALSAALVGLGVAYVMMA |
Ga0307470_102201941 | 3300032174 | Hardwood Forest Soil | IGMSSLWWAVILGIVVLIYKVAPPLRFRSELALSLALVALGVAYVRMA |
Ga0307470_102455353 | 3300032174 | Hardwood Forest Soil | LGIVVLIYKLAPPLRIRYELVLSAALVALGVAYVIVA |
Ga0307471_1008361332 | 3300032180 | Hardwood Forest Soil | LVALIYKWAPPLRLRYELALSAALVALGVAYVMTA |
Ga0307471_1037658952 | 3300032180 | Hardwood Forest Soil | VLLGMSSLWWAVILSIVILMYKLAPPLRMRYELVLSAALVAFGAAYVIW |
Ga0364931_0019863_3_116 | 3300034176 | Sediment | LGLVVLIYKFAPPLRMRYELALSAALVALGVAYVMMA |
⦗Top⦘ |