| Basic Information | |
|---|---|
| Family ID | F062591 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 130 |
| Average Sequence Length | 39 residues |
| Representative Sequence | VGLGDVLFGRKKLKGANLERLFALSTAQITLETELGLKP |
| Number of Associated Samples | 121 |
| Number of Associated Scaffolds | 130 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 39.23 % |
| % of genes near scaffold ends (potentially truncated) | 98.46 % |
| % of genes from short scaffolds (< 2000 bps) | 94.62 % |
| Associated GOLD sequencing projects | 121 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.51 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (67.692 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (20.769 % of family members) |
| Environment Ontology (ENVO) | Unclassified (25.385 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (48.462 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 34.33% β-sheet: 0.00% Coil/Unstructured: 65.67% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.51 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 130 Family Scaffolds |
|---|---|---|
| PF01435 | Peptidase_M48 | 86.15 |
| PF04012 | PspA_IM30 | 1.54 |
| PF00034 | Cytochrom_C | 1.54 |
| PF00486 | Trans_reg_C | 0.77 |
| PF00583 | Acetyltransf_1 | 0.77 |
| PF01654 | Cyt_bd_oxida_I | 0.77 |
| PF03176 | MMPL | 0.77 |
| PF00903 | Glyoxalase | 0.77 |
| PF02653 | BPD_transp_2 | 0.77 |
| PF00440 | TetR_N | 0.77 |
| PF02403 | Seryl_tRNA_N | 0.77 |
| PF08282 | Hydrolase_3 | 0.77 |
| PF00753 | Lactamase_B | 0.77 |
| COG ID | Name | Functional Category | % Frequency in 130 Family Scaffolds |
|---|---|---|---|
| COG1842 | Phage shock protein A | Transcription [K] | 3.08 |
| COG0172 | Seryl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 0.77 |
| COG0560 | Phosphoserine phosphatase | Amino acid transport and metabolism [E] | 0.77 |
| COG0561 | Hydroxymethylpyrimidine pyrophosphatase and other HAD family phosphatases | Coenzyme transport and metabolism [H] | 0.77 |
| COG1033 | Predicted exporter protein, RND superfamily | General function prediction only [R] | 0.77 |
| COG1271 | Cytochrome bd-type quinol oxidase, subunit 1 | Energy production and conversion [C] | 0.77 |
| COG1877 | Trehalose-6-phosphate phosphatase | Carbohydrate transport and metabolism [G] | 0.77 |
| COG2217 | Cation-transporting P-type ATPase | Inorganic ion transport and metabolism [P] | 0.77 |
| COG2409 | Predicted lipid transporter YdfJ, MMPL/SSD domain, RND superfamily | General function prediction only [R] | 0.77 |
| COG3769 | Mannosyl-3-phosphoglycerate phosphatase YedP/MpgP, HAD superfamily | Carbohydrate transport and metabolism [G] | 0.77 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 67.69 % |
| All Organisms | root | All Organisms | 32.31 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000893|AP72_2010_repI_A001DRAFT_1067491 | Not Available | 563 | Open in IMG/M |
| 3300001305|C688J14111_10158924 | Not Available | 696 | Open in IMG/M |
| 3300003999|Ga0055469_10307924 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 514 | Open in IMG/M |
| 3300004157|Ga0062590_100972143 | Not Available | 804 | Open in IMG/M |
| 3300004157|Ga0062590_101923284 | Not Available | 611 | Open in IMG/M |
| 3300004463|Ga0063356_104141787 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 624 | Open in IMG/M |
| 3300005168|Ga0066809_10097621 | All Organisms → cellular organisms → Bacteria | 715 | Open in IMG/M |
| 3300005174|Ga0066680_10604145 | All Organisms → cellular organisms → Bacteria | 686 | Open in IMG/M |
| 3300005334|Ga0068869_100132962 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1914 | Open in IMG/M |
| 3300005334|Ga0068869_102114199 | Not Available | 506 | Open in IMG/M |
| 3300005450|Ga0066682_10966847 | Not Available | 504 | Open in IMG/M |
| 3300005536|Ga0070697_101368960 | All Organisms → cellular organisms → Bacteria | 632 | Open in IMG/M |
| 3300005542|Ga0070732_10195437 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 1209 | Open in IMG/M |
| 3300005598|Ga0066706_11301389 | Not Available | 550 | Open in IMG/M |
| 3300005614|Ga0068856_100789065 | All Organisms → cellular organisms → Bacteria | 970 | Open in IMG/M |
| 3300005905|Ga0075269_10023607 | Not Available | 981 | Open in IMG/M |
| 3300006797|Ga0066659_10458880 | All Organisms → cellular organisms → Bacteria | 1014 | Open in IMG/M |
| 3300006806|Ga0079220_10494036 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 834 | Open in IMG/M |
| 3300006847|Ga0075431_100438918 | All Organisms → cellular organisms → Bacteria | 1302 | Open in IMG/M |
| 3300006852|Ga0075433_11158635 | All Organisms → cellular organisms → Bacteria | 671 | Open in IMG/M |
| 3300006914|Ga0075436_101376086 | Not Available | 535 | Open in IMG/M |
| 3300009036|Ga0105244_10504811 | All Organisms → cellular organisms → Bacteria | 557 | Open in IMG/M |
| 3300009038|Ga0099829_11628639 | Not Available | 532 | Open in IMG/M |
| 3300009093|Ga0105240_11229344 | Not Available | 792 | Open in IMG/M |
| 3300009093|Ga0105240_12146245 | Not Available | 580 | Open in IMG/M |
| 3300009100|Ga0075418_10293998 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1731 | Open in IMG/M |
| 3300009137|Ga0066709_102230643 | Not Available | 754 | Open in IMG/M |
| 3300009137|Ga0066709_104546283 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 507 | Open in IMG/M |
| 3300009148|Ga0105243_10140991 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 2056 | Open in IMG/M |
| 3300009163|Ga0114970_10175437 | Not Available | 1275 | Open in IMG/M |
| 3300009661|Ga0105858_1241700 | Not Available | 546 | Open in IMG/M |
| 3300009797|Ga0105080_1044052 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 547 | Open in IMG/M |
| 3300009812|Ga0105067_1003478 | All Organisms → cellular organisms → Bacteria | 1810 | Open in IMG/M |
| 3300009837|Ga0105058_1176600 | Not Available | 527 | Open in IMG/M |
| 3300009840|Ga0126313_10486290 | Not Available | 987 | Open in IMG/M |
| 3300010039|Ga0126309_10005194 | All Organisms → cellular organisms → Bacteria | 5026 | Open in IMG/M |
| 3300010043|Ga0126380_10114739 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1650 | Open in IMG/M |
| 3300010044|Ga0126310_10113370 | Not Available | 1667 | Open in IMG/M |
| 3300010101|Ga0127481_1037991 | Not Available | 739 | Open in IMG/M |
| 3300010104|Ga0127446_1103500 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 587 | Open in IMG/M |
| 3300010154|Ga0127503_10834424 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 931 | Open in IMG/M |
| 3300010320|Ga0134109_10505424 | Not Available | 500 | Open in IMG/M |
| 3300010359|Ga0126376_12716131 | Not Available | 544 | Open in IMG/M |
| 3300010359|Ga0126376_12891290 | Not Available | 530 | Open in IMG/M |
| 3300010366|Ga0126379_11658038 | Not Available | 744 | Open in IMG/M |
| 3300011003|Ga0138514_100158126 | Not Available | 505 | Open in IMG/M |
| 3300011415|Ga0137325_1030168 | Not Available | 1103 | Open in IMG/M |
| 3300011992|Ga0120146_1034056 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 889 | Open in IMG/M |
| 3300012022|Ga0120191_10047955 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 734 | Open in IMG/M |
| 3300012093|Ga0136632_10422180 | Not Available | 598 | Open in IMG/M |
| 3300012188|Ga0136618_10241130 | Not Available | 782 | Open in IMG/M |
| 3300012201|Ga0137365_10369081 | Not Available | 1060 | Open in IMG/M |
| 3300012211|Ga0137377_11163791 | Not Available | 701 | Open in IMG/M |
| 3300012212|Ga0150985_122364709 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → environmental samples → uncultured Solirubrobacteraceae bacterium | 998 | Open in IMG/M |
| 3300012285|Ga0137370_10957407 | Not Available | 528 | Open in IMG/M |
| 3300012350|Ga0137372_10753300 | All Organisms → cellular organisms → Bacteria | 701 | Open in IMG/M |
| 3300012386|Ga0134046_1036889 | Not Available | 918 | Open in IMG/M |
| 3300012469|Ga0150984_104768986 | Not Available | 534 | Open in IMG/M |
| 3300012469|Ga0150984_105647708 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1129 | Open in IMG/M |
| 3300012681|Ga0136613_10074783 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1940 | Open in IMG/M |
| 3300012910|Ga0157308_10085253 | Not Available | 902 | Open in IMG/M |
| 3300013100|Ga0157373_10499677 | Not Available | 878 | Open in IMG/M |
| 3300013297|Ga0157378_12620545 | Not Available | 557 | Open in IMG/M |
| 3300013308|Ga0157375_12879102 | Not Available | 575 | Open in IMG/M |
| 3300013765|Ga0120172_1064970 | Not Available | 919 | Open in IMG/M |
| 3300014150|Ga0134081_10011328 | All Organisms → cellular organisms → Bacteria | 2396 | Open in IMG/M |
| 3300015372|Ga0132256_100254003 | All Organisms → cellular organisms → Bacteria | 1828 | Open in IMG/M |
| 3300015373|Ga0132257_101455274 | Not Available | 873 | Open in IMG/M |
| 3300017654|Ga0134069_1229243 | Not Available | 641 | Open in IMG/M |
| 3300017695|Ga0180121_10229710 | Not Available | 694 | Open in IMG/M |
| 3300017789|Ga0136617_10077741 | All Organisms → cellular organisms → Bacteria | 2895 | Open in IMG/M |
| 3300018071|Ga0184618_10053711 | All Organisms → cellular organisms → Bacteria | 1473 | Open in IMG/M |
| 3300018072|Ga0184635_10311189 | Not Available | 614 | Open in IMG/M |
| 3300018465|Ga0190269_10205190 | Not Available | 1072 | Open in IMG/M |
| 3300018481|Ga0190271_11222514 | Not Available | 873 | Open in IMG/M |
| 3300019377|Ga0190264_10080720 | Not Available | 1448 | Open in IMG/M |
| 3300020020|Ga0193738_1124241 | Not Available | 717 | Open in IMG/M |
| 3300021078|Ga0210381_10215639 | Not Available | 673 | Open in IMG/M |
| 3300023064|Ga0247801_1064805 | Not Available | 577 | Open in IMG/M |
| 3300023072|Ga0247799_1048700 | Not Available | 701 | Open in IMG/M |
| 3300025167|Ga0209642_10331668 | Not Available | 861 | Open in IMG/M |
| 3300025314|Ga0209323_10212635 | Not Available | 1255 | Open in IMG/M |
| 3300025327|Ga0209751_11350301 | Not Available | 508 | Open in IMG/M |
| 3300025901|Ga0207688_10160365 | Not Available | 1333 | Open in IMG/M |
| 3300025921|Ga0207652_11267536 | Not Available | 639 | Open in IMG/M |
| 3300025928|Ga0207700_10288944 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1413 | Open in IMG/M |
| 3300025936|Ga0207670_11361590 | Not Available | 602 | Open in IMG/M |
| 3300025941|Ga0207711_10228220 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1705 | Open in IMG/M |
| 3300025944|Ga0207661_11992985 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 526 | Open in IMG/M |
| 3300026095|Ga0207676_12127267 | Not Available | 559 | Open in IMG/M |
| 3300026324|Ga0209470_1347568 | Not Available | 533 | Open in IMG/M |
| 3300027273|Ga0209886_1009119 | Not Available | 1424 | Open in IMG/M |
| 3300027461|Ga0207601_100285 | All Organisms → cellular organisms → Bacteria | 1946 | Open in IMG/M |
| 3300027561|Ga0209887_1051800 | Not Available | 883 | Open in IMG/M |
| 3300027637|Ga0209818_1048850 | Not Available | 1019 | Open in IMG/M |
| 3300027748|Ga0209689_1373149 | Not Available | 546 | Open in IMG/M |
| 3300027873|Ga0209814_10104745 | Not Available | 1201 | Open in IMG/M |
| 3300027907|Ga0207428_10196040 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1521 | Open in IMG/M |
| 3300028705|Ga0307276_10117402 | Not Available | 656 | Open in IMG/M |
| 3300028712|Ga0307285_10181891 | Not Available | 584 | Open in IMG/M |
| 3300028715|Ga0307313_10001336 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 5212 | Open in IMG/M |
| 3300028717|Ga0307298_10040670 | Not Available | 1258 | Open in IMG/M |
| 3300028719|Ga0307301_10071376 | Not Available | 1083 | Open in IMG/M |
| 3300028720|Ga0307317_10126660 | Not Available | 853 | Open in IMG/M |
| 3300028722|Ga0307319_10230826 | Not Available | 608 | Open in IMG/M |
| 3300028771|Ga0307320_10238568 | Not Available | 715 | Open in IMG/M |
| 3300028784|Ga0307282_10006857 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 4471 | Open in IMG/M |
| 3300028784|Ga0307282_10293740 | Not Available | 783 | Open in IMG/M |
| 3300028803|Ga0307281_10268528 | Not Available | 630 | Open in IMG/M |
| 3300028819|Ga0307296_10418538 | Not Available | 732 | Open in IMG/M |
| 3300028819|Ga0307296_10661080 | Not Available | 571 | Open in IMG/M |
| 3300028824|Ga0307310_10231847 | Not Available | 881 | Open in IMG/M |
| 3300028880|Ga0307300_10000823 | All Organisms → cellular organisms → Bacteria | 7579 | Open in IMG/M |
| 3300030006|Ga0299907_10356780 | Not Available | 1182 | Open in IMG/M |
| 3300030619|Ga0268386_10653286 | Not Available | 693 | Open in IMG/M |
| 3300030830|Ga0308205_1027648 | Not Available | 682 | Open in IMG/M |
| 3300030990|Ga0308178_1020166 | Not Available | 1050 | Open in IMG/M |
| 3300030993|Ga0308190_1041400 | Not Available | 856 | Open in IMG/M |
| 3300031228|Ga0299914_10962209 | Not Available | 699 | Open in IMG/M |
| 3300031228|Ga0299914_11532892 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 518 | Open in IMG/M |
| 3300031229|Ga0299913_11269419 | Not Available | 694 | Open in IMG/M |
| 3300031422|Ga0308186_1028221 | Not Available | 571 | Open in IMG/M |
| 3300031474|Ga0170818_107560890 | Not Available | 573 | Open in IMG/M |
| 3300031753|Ga0307477_10777771 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 637 | Open in IMG/M |
| 3300031908|Ga0310900_11014414 | Not Available | 683 | Open in IMG/M |
| 3300031938|Ga0308175_101328195 | Not Available | 801 | Open in IMG/M |
| 3300032174|Ga0307470_10486391 | Not Available | 897 | Open in IMG/M |
| 3300033550|Ga0247829_10418174 | Not Available | 1104 | Open in IMG/M |
| 3300034115|Ga0364945_0186768 | Not Available | 630 | Open in IMG/M |
| 3300034644|Ga0370548_062219 | Not Available | 689 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 20.77% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 4.62% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 4.62% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 4.62% |
| Polar Desert Sand | Environmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand | 3.85% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 3.85% |
| Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 3.85% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 3.08% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 2.31% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 2.31% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 2.31% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil | 2.31% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.54% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.54% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.54% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.54% |
| Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 1.54% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.54% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.54% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.54% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.54% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.54% |
| Soil | Environmental → Terrestrial → Soil → Loam → Unclassified → Soil | 1.54% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.54% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.54% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.54% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.54% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 1.54% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.77% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 0.77% |
| Soil | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil | 0.77% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 0.77% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 0.77% |
| Terrestrial | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial | 0.77% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.77% |
| Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 0.77% |
| Permafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil | 0.77% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.77% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.77% |
| Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 0.77% |
| Soil | Environmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil | 0.77% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.77% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.77% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.77% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.77% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.77% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.77% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.77% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.77% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.77% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000893 | Forest soil microbial communities from Amazon forest - Pasture72 2010 replicate I A001 | Environmental | Open in IMG/M |
| 3300001305 | Grasslands soil microbial communities from Hopland, California, USA | Environmental | Open in IMG/M |
| 3300003999 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleA_D2 | Environmental | Open in IMG/M |
| 3300004157 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2 | Environmental | Open in IMG/M |
| 3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
| 3300005168 | Soil and rhizosphere microbial communities from Laval, Canada - mgLPC | Environmental | Open in IMG/M |
| 3300005174 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 | Environmental | Open in IMG/M |
| 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Host-Associated | Open in IMG/M |
| 3300005450 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 | Environmental | Open in IMG/M |
| 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
| 3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
| 3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
| 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Host-Associated | Open in IMG/M |
| 3300005905 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_5C_0N_105 | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300006847 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Host-Associated | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
| 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Host-Associated | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009163 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140205_XF_MetaG | Environmental | Open in IMG/M |
| 3300009661 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil DNA_2013-062 | Environmental | Open in IMG/M |
| 3300009797 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S2_10_20 | Environmental | Open in IMG/M |
| 3300009812 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N2_50_60 | Environmental | Open in IMG/M |
| 3300009837 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_20_30 | Environmental | Open in IMG/M |
| 3300009840 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105A | Environmental | Open in IMG/M |
| 3300010039 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot56 | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010044 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot60 | Environmental | Open in IMG/M |
| 3300010101 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_20_5_24_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010104 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_40_2_16_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010154 | Soil microbial communities from Willow Creek, Wisconsin, USA - WC-WI-TBF metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010320 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_11112015 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300011003 | Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t9i015 | Environmental | Open in IMG/M |
| 3300011415 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT469_2 | Environmental | Open in IMG/M |
| 3300011992 | Permafrost microbial communities from Nunavut, Canada - A23_65cm_12M | Environmental | Open in IMG/M |
| 3300012022 | Terrestrial microbial communites from a soil warming plot in Okalahoma, USA - C6 | Environmental | Open in IMG/M |
| 3300012093 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ611 (21.06) | Environmental | Open in IMG/M |
| 3300012188 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ330 (21.06) | Environmental | Open in IMG/M |
| 3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012350 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012386 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_24_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
| 3300012681 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ272 (21.06) | Environmental | Open in IMG/M |
| 3300012910 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S198-509B-2 | Environmental | Open in IMG/M |
| 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Host-Associated | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
| 3300013765 | Permafrost microbial communities from Nunavut, Canada - A30_80cm_6M | Environmental | Open in IMG/M |
| 3300014150 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300017654 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300017695 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ540 (21.06) (version 2) | Environmental | Open in IMG/M |
| 3300017789 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ322 (21.06) | Environmental | Open in IMG/M |
| 3300018071 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_b1 | Environmental | Open in IMG/M |
| 3300018072 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b2 | Environmental | Open in IMG/M |
| 3300018465 | Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 IS | Environmental | Open in IMG/M |
| 3300018481 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 T | Environmental | Open in IMG/M |
| 3300019377 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 112 T | Environmental | Open in IMG/M |
| 3300020020 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2a1 | Environmental | Open in IMG/M |
| 3300021078 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5_coex redo | Environmental | Open in IMG/M |
| 3300023064 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S001-104B-6 | Environmental | Open in IMG/M |
| 3300023072 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S151-409C-6 | Environmental | Open in IMG/M |
| 3300025167 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 19_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025314 | Soil microbial communities from Rifle, Colorado, USA - sediment 19ft 2 | Environmental | Open in IMG/M |
| 3300025327 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 13_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026324 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 (SPAdes) | Environmental | Open in IMG/M |
| 3300027273 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N2_40_50 (SPAdes) | Environmental | Open in IMG/M |
| 3300027461 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-ROWE15-E (SPAdes) | Environmental | Open in IMG/M |
| 3300027561 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_30_40 (SPAdes) | Environmental | Open in IMG/M |
| 3300027637 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS200 (SPAdes) | Environmental | Open in IMG/M |
| 3300027748 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 (SPAdes) | Environmental | Open in IMG/M |
| 3300027873 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027907 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028705 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_115 | Environmental | Open in IMG/M |
| 3300028712 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_139 | Environmental | Open in IMG/M |
| 3300028715 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_203 | Environmental | Open in IMG/M |
| 3300028717 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_158 | Environmental | Open in IMG/M |
| 3300028719 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_182 | Environmental | Open in IMG/M |
| 3300028720 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_357 | Environmental | Open in IMG/M |
| 3300028722 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_368 | Environmental | Open in IMG/M |
| 3300028771 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_369 | Environmental | Open in IMG/M |
| 3300028784 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_121 | Environmental | Open in IMG/M |
| 3300028803 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_120 | Environmental | Open in IMG/M |
| 3300028819 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_153 | Environmental | Open in IMG/M |
| 3300028824 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_197 | Environmental | Open in IMG/M |
| 3300028880 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_181 | Environmental | Open in IMG/M |
| 3300030006 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT152D67 | Environmental | Open in IMG/M |
| 3300030619 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT150D86 (Novaseq) | Environmental | Open in IMG/M |
| 3300030830 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_368 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030990 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_149 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030993 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_185 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031228 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT153D57 | Environmental | Open in IMG/M |
| 3300031229 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT155D38 | Environmental | Open in IMG/M |
| 3300031422 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_181 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031474 | Fir Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
| 3300031908 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D1 | Environmental | Open in IMG/M |
| 3300031938 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1 | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300033550 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day4 | Environmental | Open in IMG/M |
| 3300034115 | Sediment microbial communities from East River floodplain, Colorado, United States - 29_s17 | Environmental | Open in IMG/M |
| 3300034644 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_123 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| AP72_2010_repI_A001DRAFT_10674911 | 3300000893 | Forest Soil | VGLADVLFGRKKLKGPAGERLFAISTARITLESELD |
| C688J14111_101589241 | 3300001305 | Soil | VGLRDVLFGRKQLKEAAGERLFAISTARITLETELD |
| Ga0055469_103079242 | 3300003999 | Natural And Restored Wetlands | MGLWNILSGGRKLRGPKRDRLFALSTAQVTLEGELGLRPAG |
| Ga0062590_1009721432 | 3300004157 | Soil | LGLGDVLFGRKKLKGANLDRLFALSTAQITLETELGLKPAGVA |
| Ga0062590_1019232841 | 3300004157 | Soil | VGLRDVLLGRKQLKDAAGERLFAISTARITLETELDLKPA |
| Ga0063356_1041417871 | 3300004463 | Arabidopsis Thaliana Rhizosphere | LGLADVLFGRKKLKAPEKERLFALATAGVTLSVELGLHAVA |
| Ga0066809_100976212 | 3300005168 | Soil | LGLGDVLFGRKRLRRANVDRLFALSTAQVTLQAELGLTSAGVAT |
| Ga0066680_106041452 | 3300005174 | Soil | MGLTDILFGRKKLKGPAEERLFALSTAAVTLQTDLNLTTA |
| Ga0068869_1001329623 | 3300005334 | Miscanthus Rhizosphere | LGLGNVLFGRKKLKDAAGERLFAISTARITLEAELGLKST |
| Ga0068869_1021141991 | 3300005334 | Miscanthus Rhizosphere | LGLRDILSGRKKLKDPARERLFAISTARITLQTELDLKPS |
| Ga0066682_109668471 | 3300005450 | Soil | VGLANVLFGRKKLKAPARERLFALSTAGVTLDTELGLKPVSAAVVFK |
| Ga0070697_1013689601 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | LGLTDVLFGRKRLKPPAEDRLFALATATVTLQTELGLKPAGV |
| Ga0070732_101954371 | 3300005542 | Surface Soil | LGLGDVLFGRKKLKAPAAERLFAISTAAVTLDTACSL |
| Ga0066706_113013892 | 3300005598 | Soil | MGLTDILFGRKKLKGPAEERLFALSTAAVTLQTDLNLTTAGVA |
| Ga0068856_1007890652 | 3300005614 | Corn Rhizosphere | VGLRDVLFGRKKLKDPARERLFAISTARITLETEL |
| Ga0075269_100236072 | 3300005905 | Rice Paddy Soil | VPLLDVLFGRKKLKDASEERIFALSTAQVTLQTELGL |
| Ga0066659_104588802 | 3300006797 | Soil | LGLRDVLFGRKKVKDPVRERLFAISTARITLESELDL |
| Ga0079220_104940362 | 3300006806 | Agricultural Soil | VGLTDVLFGRKKLKGPNEDSLFALTTACVTLQSELGLK |
| Ga0075431_1004389181 | 3300006847 | Populus Rhizosphere | VGLTDVLFGGRKRLKGAKLDKLFALSTAQITLETELGL |
| Ga0075433_111586351 | 3300006852 | Populus Rhizosphere | VGFTDVLFGRKKLKSPAGERLFALSTARVTLDAELGLKS |
| Ga0075436_1013760861 | 3300006914 | Populus Rhizosphere | VGLLDVLFGRKRLKDASVERLFALSTAQVTLDVDLG |
| Ga0105244_105048112 | 3300009036 | Miscanthus Rhizosphere | LGLRDVLFGRKKLKDPARERLFAISTARITLETEL |
| Ga0099829_116286391 | 3300009038 | Vadose Zone Soil | MGLGNVLFGRKQLKGPNEDTLFALTTACVTLQTELGLTPAGVGAVTYKS |
| Ga0105240_112293442 | 3300009093 | Corn Rhizosphere | MGLTDVLFGRKKLKGPNQDSLFALTTACVTLQTEL |
| Ga0105240_121462452 | 3300009093 | Corn Rhizosphere | VGLTDVLFGRKKLKGPNEDSLFALTTACVTLQSELGLKPA |
| Ga0075418_102939983 | 3300009100 | Populus Rhizosphere | LGLADVLFGRKKLKKADEQKLFAIATARITLETELGLK |
| Ga0066709_1022306432 | 3300009137 | Grasslands Soil | VGLTDVLFGRKRLKGAARDRLFALSTARVTLELEGVK |
| Ga0066709_1045462832 | 3300009137 | Grasslands Soil | MGLRDVLFGRNKLKDPARERLFAISTARITMQAELNLK |
| Ga0105243_101409913 | 3300009148 | Miscanthus Rhizosphere | LGLGNVLFGRKKLKDAAGERLFAISTARITLETELELRP |
| Ga0114970_101754371 | 3300009163 | Freshwater Lake | VGVFDVMFGRKRLKGAAQDRLFALATAQVTLEVELALKP |
| Ga0105858_12417001 | 3300009661 | Permafrost Soil | VALRDVLFGRKKLPGPREDRLFALSTASVTLETECGLTTAG |
| Ga0105080_10440522 | 3300009797 | Groundwater Sand | VGLGSILFGGRKRLKGAKLDKIFALSSAQVQLEAELGLK |
| Ga0105067_10034783 | 3300009812 | Groundwater Sand | VGLTDVLFGGRKRLKGARLDKLFALSTAQITLQTELGLDSAGVAAVVFK |
| Ga0105058_11766001 | 3300009837 | Groundwater Sand | VGLGNILFGGRKRLKGAKLDKIFALSSAQVQLEAELGLKPAGVAAV |
| Ga0126313_104862902 | 3300009840 | Serpentine Soil | LGLTNVLFGRKKLKKAVQERLFALATARISLETELGLK |
| Ga0126309_100051941 | 3300010039 | Serpentine Soil | VGLTDILFGRKRLKGAKLDKLFALSTAQVTLDAEL |
| Ga0126380_101147393 | 3300010043 | Tropical Forest Soil | VGLADVLFGRKKLKGPAGERLFAISTARITLETELD |
| Ga0126310_101133701 | 3300010044 | Serpentine Soil | VGLTDILFGRKKLKGAVREQLFAISTAHVTMEVELGLRFAR |
| Ga0127481_10379911 | 3300010101 | Grasslands Soil | VGLADILLGRKKLKGPAQDRLFALSTARVTLDAEL |
| Ga0127446_11035002 | 3300010104 | Grasslands Soil | VGLGDVLFGRKKLKGANLDRLFALSTAQITLETGTSLRTGVRS* |
| Ga0127503_108344241 | 3300010154 | Soil | VGLRDVLSGRKKLQDPAQDRLFAISTARITLETDLDLKSAGS |
| Ga0134109_105054241 | 3300010320 | Grasslands Soil | VGLRDVLLGRKKLQAPAGERLFAISTARITLATELDL |
| Ga0126376_127161312 | 3300010359 | Tropical Forest Soil | VGLADVLFGRKKLKGPAGERLFAISTARITLETELDLK |
| Ga0126376_128912902 | 3300010359 | Tropical Forest Soil | VGLGNILFGRKKLKAAASERLFALSTAQVTLDVELGLK |
| Ga0126379_116580381 | 3300010366 | Tropical Forest Soil | VGLADVLFGRKKLKGPNEDSLFALTTACVTLQTELGLTP |
| Ga0138514_1001581262 | 3300011003 | Soil | LGLGNVLFGRKKLKDAAGERLFAISTARITLEAELGLK |
| Ga0137325_10301681 | 3300011415 | Soil | VGLGDVLFGRKRLKGAKLDKLFALSTAQITLETELGLRTAGV |
| Ga0120146_10340561 | 3300011992 | Permafrost | LGFRDVLFGRKQLKEAAAERLFALSTARVTLDSD* |
| Ga0120191_100479551 | 3300012022 | Terrestrial | MGLGDVLFGRKKLKEPSGDRIFALSTARITLETELGL |
| Ga0136632_104221802 | 3300012093 | Polar Desert Sand | VGFTDILFGRKRLKEASGERLFALSTARITLETDLGLTPAESGLKHTAAV |
| Ga0136618_102411301 | 3300012188 | Polar Desert Sand | VGFTDILFGRKRLKEASGERLFALSTARITLETDL |
| Ga0137365_103690812 | 3300012201 | Vadose Zone Soil | VGLADVLFGRKKLKDPARARLFALRTARVTLEAERGLKPAGV |
| Ga0137377_111637911 | 3300012211 | Vadose Zone Soil | LGLRDVLSGRKQLKAPAAERLFAMSTAAITLDVSCGLR |
| Ga0150985_1223647091 | 3300012212 | Avena Fatua Rhizosphere | VGLTDILFGRKRLSKPKADRLFALSTAAITLDTELG |
| Ga0137370_109574071 | 3300012285 | Vadose Zone Soil | VGLTDVLFGRKKLKGPSEDSLFALTTACVTLQTELGLKP |
| Ga0137372_107533001 | 3300012350 | Vadose Zone Soil | VGLRDVLFGRKQLKAAKGERLFALSTAAVTLDVAL |
| Ga0134046_10368891 | 3300012386 | Grasslands Soil | VGLADILLGRKKLKGPAQDRLFALSTARVTMDTELGLK |
| Ga0150984_1047689862 | 3300012469 | Avena Fatua Rhizosphere | VGLGDVLFGRRKLKEASRERIFALSTATITLETELG |
| Ga0150984_1056477081 | 3300012469 | Avena Fatua Rhizosphere | LGFTDVLFGRKKLKSPAQERLFALSTARVTLEGELGLKSAGAGG |
| Ga0136613_100747831 | 3300012681 | Polar Desert Sand | VGFTDILFGRKRLKEASGERLFALSTARITLETDLG |
| Ga0157308_100852531 | 3300012910 | Soil | VGLRDVLFGRKQLKDAAGERLFAISTARITLETELDLKPAGAA |
| Ga0157373_104996772 | 3300013100 | Corn Rhizosphere | VGLADVLFGRKKLKGPAGERLFAISTARITLEIELDL |
| Ga0157378_126205451 | 3300013297 | Miscanthus Rhizosphere | LGLGDVLFGRKKLKGANLDRLFALSTAQVTLETELGLKPDRVAA |
| Ga0157375_128791022 | 3300013308 | Miscanthus Rhizosphere | LGLGDVLFGRKKLKSANLDRLFALSTARITLEAELGLKPDDV |
| Ga0120172_10649702 | 3300013765 | Permafrost | VGLKDVLFGRKQLKDAAAERIFALSTAAVTLETEL |
| Ga0134081_100113284 | 3300014150 | Grasslands Soil | MGFTDVLFGRKKLKGPAQERMFALSTARVTLDAELGLK |
| Ga0132256_1002540031 | 3300015372 | Arabidopsis Rhizosphere | VGLGNILFGRKKLSGAKLDKLFALPSAAVTMDAELGLRSDRVAAV |
| Ga0132257_1014552741 | 3300015373 | Arabidopsis Rhizosphere | LGLGDVLFGRKKLKGANLDRLFALSTAQVTLETELGLKPDR |
| Ga0134069_12292431 | 3300017654 | Grasslands Soil | VGLGNILFGRKKLKPAASERLFALSTAQVTLEVELGLKSAGK |
| Ga0180121_102297101 | 3300017695 | Polar Desert Sand | VGLGDILFGRKKLKEAVPEKLFALATACVTLEAELGLKP |
| Ga0136617_100777414 | 3300017789 | Polar Desert Sand | VGLRDLLFGRSKLKEASPEQLFALSTARVTLETELGLRSSGRA |
| Ga0184618_100537111 | 3300018071 | Groundwater Sediment | MGLTDVLFGRKKLKKADEQRLFAITTARITLETDLG |
| Ga0184635_103111891 | 3300018072 | Groundwater Sediment | VGLGNILFGRKKLSGAKLDKLFALPSAAITMDAELGLR |
| Ga0190269_102051902 | 3300018465 | Soil | VGLGNVLFGRKKLKGANLDKLFALSTAAITLETEGNLKPAGV |
| Ga0190271_112225141 | 3300018481 | Soil | VGLTDVLFGGRKRLKGAKLDKLFALSTAQVTLQAELGLK |
| Ga0190264_100807201 | 3300019377 | Soil | VGLGNVLFGRKKLKKAAGDKLFALSAARVTLEVEL |
| Ga0193738_11242412 | 3300020020 | Soil | VGFTDVLFGRKKLREAQGERLFAISTARVTLDVELG |
| Ga0210381_102156391 | 3300021078 | Groundwater Sediment | LGLADVLLGRKKLKSPAGEKLFALSTARVTLETEL |
| Ga0247801_10648051 | 3300023064 | Soil | LGLGDVLFGRKKLKGASLDRLFALSTAQITLETELGLKPDRVAAVVFK |
| Ga0247799_10487001 | 3300023072 | Soil | LGLTDVLFGRKRLKKAVQEKLFAITTARITLETDLGLK |
| Ga0209642_103316682 | 3300025167 | Soil | VGLGNILFGRKKLKEAAPEQLFALATACVTLDVELGLKP |
| Ga0209323_102126353 | 3300025314 | Soil | VGLGNILFGKKRLGRANLDKLFALSTAEITLKTALG |
| Ga0209751_113503012 | 3300025327 | Soil | VGLGDILFGKKRLGGAKLDKLFALSTAHVTLQAEL |
| Ga0207688_101603653 | 3300025901 | Corn, Switchgrass And Miscanthus Rhizosphere | LGLGDVLFGRKKLKSANLDRLFALSTARITLEAELG |
| Ga0207652_112675362 | 3300025921 | Corn Rhizosphere | VGLADVLFGRKKLKGPAGERLFAISTARITLETEL |
| Ga0207700_102889443 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | VGLRDVLFGRKQLKDAAGERLFAISTARITLETELDLKPAGS |
| Ga0207670_113615902 | 3300025936 | Switchgrass Rhizosphere | LGLGDVLFGRKKLKGANLDRLFALSTAQITLETELGLKPDR |
| Ga0207711_102282201 | 3300025941 | Switchgrass Rhizosphere | VGLRDVLFGRKQLKDAAGERLFAISTARITLETELDLRSTGAAG |
| Ga0207661_119929852 | 3300025944 | Corn Rhizosphere | MGLGDVLFGRKKLKGANLDRLFALSTAQITLQAELGLK |
| Ga0207676_121272671 | 3300026095 | Switchgrass Rhizosphere | LGLGDVLFGRKKLKGANLDRLFALSTAQVTLETELGLK |
| Ga0209470_13475681 | 3300026324 | Soil | VGLGDVLFGRKKLKEPAADRLFAITTAAVTLDVECGLK |
| Ga0209886_10091191 | 3300027273 | Groundwater Sand | VGLTDVLFGGRKRLKGARLDKLFALSTAQITLQTELGLD |
| Ga0207601_1002853 | 3300027461 | Soil | LGLRDVLFGRKKLKDAAPERVFAISTARITLETELNLK |
| Ga0209887_10518002 | 3300027561 | Groundwater Sand | VGLGDVLFGRKKLKGAKPDKLFALSTAQVTLETELDL |
| Ga0209818_10488502 | 3300027637 | Agricultural Soil | MGLTDVLFGRKKLKEAQGERLFALSTARVTLDVELGLRPGKR |
| Ga0209689_13731491 | 3300027748 | Soil | LGLRDILSGRKRLKGPAAERLFALSTAAITLEVDCG |
| Ga0209814_101047451 | 3300027873 | Populus Rhizosphere | VGFTDVLFGRKKLKSPAGERLFALSTARVTLDAELGLK |
| Ga0207428_101960401 | 3300027907 | Populus Rhizosphere | VGFTDVLFGRKKLKSPAGERLFALSTARVTLDAELGLKSAGSG |
| Ga0307276_101174022 | 3300028705 | Soil | VGLTDVLFGRKKLKSPAQERLFALSTARVTLEGELGLKSAGAG |
| Ga0307285_101818912 | 3300028712 | Soil | LTDVLFGRKKLAKAQQEKLFAISTARITLETEFGLK |
| Ga0307313_100013366 | 3300028715 | Soil | VGLGNVLFGRKKLKGANLDKLFALSTAAITLETELGLKPAGV |
| Ga0307298_100406701 | 3300028717 | Soil | VGLGNVLFGRKKLKDASGERLFAISTARITLETELELR |
| Ga0307301_100713761 | 3300028719 | Soil | MGLGNVLFGRKKLKGANLDKLFALSTAAITLETESNLKPAGVAA |
| Ga0307317_101266601 | 3300028720 | Soil | VGLRDVLLGRKKLQDPARERLFAISTARITLETEL |
| Ga0307319_102308261 | 3300028722 | Soil | VGLGNIIFGRKKLSGAKLDKLFALPSAAVTMDAELGLRSDGV |
| Ga0307320_102385681 | 3300028771 | Soil | LGLGNVLFGRKKLKGANLDKLFALSTAAITLETEGNLKPAG |
| Ga0307282_100068571 | 3300028784 | Soil | VGLGNVLFGRKKLKGANLDKLFALSTAAITLETELG |
| Ga0307282_102937402 | 3300028784 | Soil | LGLADVLLGRKKLKSPAGEKLFALSTARVTLEAELGL |
| Ga0307281_102685282 | 3300028803 | Soil | VALTDVLFGRKKLKEAKGERLFALSTARVTLEVELG |
| Ga0307296_104185381 | 3300028819 | Soil | LGLGNVLFGRKKLKDAAGERLFAISTARITLETELGLKPTG |
| Ga0307296_106610801 | 3300028819 | Soil | LGLADVLLGRKKLKSPAGEKLFALSTARVTLETELGL |
| Ga0307310_102318472 | 3300028824 | Soil | LGLRDVLSGRKKLQEPARERLFAISTARITLETELDLKPA |
| Ga0307300_1000082310 | 3300028880 | Soil | MGLGDVLFGRKKLKGAKLDKLFALSTAQVTLESELG |
| Ga0299907_103567802 | 3300030006 | Soil | VALTDILFGRKRLKGAKLEKLFALSTARITLEVELGLKSAGVA |
| Ga0268386_106532862 | 3300030619 | Soil | VALTDILFGRKRLKGAKLEKLFALSTARITLEVELGL |
| Ga0308205_10276482 | 3300030830 | Soil | VGLRDVLFGRKQLKGPADERLFALATAQVTLETEL |
| Ga0308178_10201661 | 3300030990 | Soil | LGLRDVLFGRKKLKDPAQERLFAISTARITLQTELD |
| Ga0308190_10414001 | 3300030993 | Soil | VGLADILLGRKKLKGPAQDRLFALSTARVTLDTEL |
| Ga0299914_109622092 | 3300031228 | Soil | VALTDILFGRKRLKGAKLEKLFALSTARITLEVELGLKP |
| Ga0299914_115328922 | 3300031228 | Soil | VGLGNILFGKKKLSGAKLDKLFALSTAHVAMQAELGLRSAGGA |
| Ga0299913_112694192 | 3300031229 | Soil | VALTDILFGRKRLKGAKLEKLFALSTARITLEVELGLK |
| Ga0308186_10282212 | 3300031422 | Soil | LGLGNVLFGRKKLKDSSGERLFAISTARITLETELDLKS |
| Ga0170818_1075608901 | 3300031474 | Forest Soil | LGLGDVLFGRKKLKAPAAERLFAITTAAVTLDTECSLQ |
| Ga0307477_107777712 | 3300031753 | Hardwood Forest Soil | LFGRKKLKGPAEDRLFALATACVTLDTECSLKPAGVAAVTY |
| Ga0310900_110144142 | 3300031908 | Soil | LGDVLFGRKKLKGANLDRLFALSTAQITLQTELNLKPDRVAAVV |
| Ga0308175_1013281951 | 3300031938 | Soil | VGLGDVLFGRKKLKGANLERLFALSTAQITLETELGLKP |
| Ga0307470_104863912 | 3300032174 | Hardwood Forest Soil | LGLGNVLFGRKKLKDAAGERLFAMSTARITLETELGLKPT |
| Ga0247829_104181741 | 3300033550 | Soil | VGLRDVLFGRKQLKDAAGERLFAISTARITLETELDLRSTG |
| Ga0364945_0186768_2_139 | 3300034115 | Sediment | VGLGNVLFGRKKLKKAAGDKLFALSAGRVTLEVELGLKAAGTAAVL |
| Ga0370548_062219_2_109 | 3300034644 | Soil | LGLADVLLGRKKLKSPAGEKLFALSTARVTLETELG |
| ⦗Top⦘ |