Metagenome / Metatranscriptome Family F062591

Basic Information
Family ID	F062591
Family Type	Metagenome / Metatranscriptome
Number of Sequences	130
Average Sequence Length	39 residues
Representative Sequence	VGLGDVLFGRKKLKGANLERLFALSTAQITLETELGLKP
Number of Associated Samples	121
Number of Associated Scaffolds	130

Quality Assessment
Transcriptomic Evidence	Yes
Most common taxonomic group	Unclassified
% of genes with valid RBS motifs	39.23 %
% of genes near scaffold ends (potentially truncated)	98.46 %
% of genes from short scaffolds (< 2000 bps)	94.62 %
Associated GOLD sequencing projects	121
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.51

Most Common Taxonomy
Group	Unclassified (67.692 % of family members)
NCBI Taxonomy ID	N/A
Taxonomy	N/A

Most Common Ecosystem
GOLD Ecosystem	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (20.769 % of family members)
Environment Ontology (ENVO)	Unclassified (25.385 % of family members)
Earth Microbiome Project Ontology (EMPO)	Free-living → Non-saline → Soil (non-saline) (48.462 % of family members)

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Predicted Topology & Secondary Structure
Classification:	Globular	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 34.33% β-sheet: 0.00% Coil/Unstructured: 65.67%
Feature Viewer

Powered by Feature Viewer

Pfam ID	Name	% Frequency in 130 Family Scaffolds
PF01435	Peptidase_M48	86.15
PF04012	PspA_IM30	1.54
PF00034	Cytochrom_C	1.54
PF00486	Trans_reg_C	0.77
PF00583	Acetyltransf_1	0.77
PF01654	Cyt_bd_oxida_I	0.77
PF03176	MMPL	0.77
PF00903	Glyoxalase	0.77
PF02653	BPD_transp_2	0.77
PF00440	TetR_N	0.77
PF02403	Seryl_tRNA_N	0.77
PF08282	Hydrolase_3	0.77
PF00753	Lactamase_B	0.77

COG ID	Name	Functional Category	% Frequency in 130 Family Scaffolds
COG1842	Phage shock protein A	Transcription [K]	3.08
COG0172	Seryl-tRNA synthetase	Translation, ribosomal structure and biogenesis [J]	0.77
COG0560	Phosphoserine phosphatase	Amino acid transport and metabolism [E]	0.77
COG0561	Hydroxymethylpyrimidine pyrophosphatase and other HAD family phosphatases	Coenzyme transport and metabolism [H]	0.77
COG1033	Predicted exporter protein, RND superfamily	General function prediction only [R]	0.77
COG1271	Cytochrome bd-type quinol oxidase, subunit 1	Energy production and conversion [C]	0.77
COG1877	Trehalose-6-phosphate phosphatase	Carbohydrate transport and metabolism [G]	0.77
COG2217	Cation-transporting P-type ATPase	Inorganic ion transport and metabolism [P]	0.77
COG2409	Predicted lipid transporter YdfJ, MMPL/SSD domain, RND superfamily	General function prediction only [R]	0.77
COG3769	Mannosyl-3-phosphoglycerate phosphatase YedP/MpgP, HAD superfamily	Carbohydrate transport and metabolism [G]	0.77

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	67.69 %
All Organisms	root	All Organisms	32.31 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	67.69 %
cellular organisms	root	All Organisms → cellular organisms	32.31 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	67.69 %
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	32.31 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	67.69 %
Terrabacteria group	clade	All Organisms → cellular organisms → Bacteria → Terrabacteria group	19.23 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	67.69 %
Actinobacteria	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	18.46 %
Chloroflexi	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	0.77 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	67.69 %
Actinomycetia	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	9.23 %
Thermoleophilia	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia	1.54 %
unclassified Chloroflexi	no rank	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi	0.77 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	67.69 %
unclassified Actinomycetia	no rank	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia	9.23 %
Solirubrobacterales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales	0.77 %
Chloroflexi bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	0.77 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	67.69 %
Actinomycetia bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	9.23 %
Solirubrobacteraceae	family	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae	0.77 %
Chloroflexi bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	0.77 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	67.69 %
Actinomycetia bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	9.23 %
environmental samples	no rank	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → environmental samples	0.77 %
Chloroflexi bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	0.77 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	67.69 %
Actinomycetia bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	9.23 %
uncultured Solirubrobacteraceae bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → environmental samples → uncultured Solirubrobacteraceae bacterium	0.77 %
Chloroflexi bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	0.77 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
3300000893\|AP72_2010_repI_A001DRAFT_1067491	Not Available	563	Open in IMG/M
3300001305\|C688J14111_10158924	Not Available	696	Open in IMG/M
3300003999\|Ga0055469_10307924	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	514	Open in IMG/M
3300004157\|Ga0062590_100972143	Not Available	804	Open in IMG/M
3300004157\|Ga0062590_101923284	Not Available	611	Open in IMG/M
3300004463\|Ga0063356_104141787	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	624	Open in IMG/M
3300005168\|Ga0066809_10097621	All Organisms → cellular organisms → Bacteria	715	Open in IMG/M
3300005174\|Ga0066680_10604145	All Organisms → cellular organisms → Bacteria	686	Open in IMG/M
3300005334\|Ga0068869_100132962	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	1914	Open in IMG/M
3300005334\|Ga0068869_102114199	Not Available	506	Open in IMG/M
3300005450\|Ga0066682_10966847	Not Available	504	Open in IMG/M
3300005536\|Ga0070697_101368960	All Organisms → cellular organisms → Bacteria	632	Open in IMG/M
3300005542\|Ga0070732_10195437	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia	1209	Open in IMG/M
3300005598\|Ga0066706_11301389	Not Available	550	Open in IMG/M
3300005614\|Ga0068856_100789065	All Organisms → cellular organisms → Bacteria	970	Open in IMG/M
3300005905\|Ga0075269_10023607	Not Available	981	Open in IMG/M
3300006797\|Ga0066659_10458880	All Organisms → cellular organisms → Bacteria	1014	Open in IMG/M
3300006806\|Ga0079220_10494036	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	834	Open in IMG/M
3300006847\|Ga0075431_100438918	All Organisms → cellular organisms → Bacteria	1302	Open in IMG/M
3300006852\|Ga0075433_11158635	All Organisms → cellular organisms → Bacteria	671	Open in IMG/M
3300006914\|Ga0075436_101376086	Not Available	535	Open in IMG/M
3300009036\|Ga0105244_10504811	All Organisms → cellular organisms → Bacteria	557	Open in IMG/M
3300009038\|Ga0099829_11628639	Not Available	532	Open in IMG/M
3300009093\|Ga0105240_11229344	Not Available	792	Open in IMG/M
3300009093\|Ga0105240_12146245	Not Available	580	Open in IMG/M
3300009100\|Ga0075418_10293998	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	1731	Open in IMG/M
3300009137\|Ga0066709_102230643	Not Available	754	Open in IMG/M
3300009137\|Ga0066709_104546283	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	507	Open in IMG/M
3300009148\|Ga0105243_10140991	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	2056	Open in IMG/M
3300009163\|Ga0114970_10175437	Not Available	1275	Open in IMG/M
3300009661\|Ga0105858_1241700	Not Available	546	Open in IMG/M
3300009797\|Ga0105080_1044052	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	547	Open in IMG/M
3300009812\|Ga0105067_1003478	All Organisms → cellular organisms → Bacteria	1810	Open in IMG/M
3300009837\|Ga0105058_1176600	Not Available	527	Open in IMG/M
3300009840\|Ga0126313_10486290	Not Available	987	Open in IMG/M
3300010039\|Ga0126309_10005194	All Organisms → cellular organisms → Bacteria	5026	Open in IMG/M
3300010043\|Ga0126380_10114739	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	1650	Open in IMG/M
3300010044\|Ga0126310_10113370	Not Available	1667	Open in IMG/M
3300010101\|Ga0127481_1037991	Not Available	739	Open in IMG/M
3300010104\|Ga0127446_1103500	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	587	Open in IMG/M
3300010154\|Ga0127503_10834424	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	931	Open in IMG/M
3300010320\|Ga0134109_10505424	Not Available	500	Open in IMG/M
3300010359\|Ga0126376_12716131	Not Available	544	Open in IMG/M
3300010359\|Ga0126376_12891290	Not Available	530	Open in IMG/M
3300010366\|Ga0126379_11658038	Not Available	744	Open in IMG/M
3300011003\|Ga0138514_100158126	Not Available	505	Open in IMG/M
3300011415\|Ga0137325_1030168	Not Available	1103	Open in IMG/M
3300011992\|Ga0120146_1034056	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	889	Open in IMG/M
3300012022\|Ga0120191_10047955	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	734	Open in IMG/M
3300012093\|Ga0136632_10422180	Not Available	598	Open in IMG/M
3300012188\|Ga0136618_10241130	Not Available	782	Open in IMG/M
3300012201\|Ga0137365_10369081	Not Available	1060	Open in IMG/M
3300012211\|Ga0137377_11163791	Not Available	701	Open in IMG/M
3300012212\|Ga0150985_122364709	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → environmental samples → uncultured Solirubrobacteraceae bacterium	998	Open in IMG/M
3300012285\|Ga0137370_10957407	Not Available	528	Open in IMG/M
3300012350\|Ga0137372_10753300	All Organisms → cellular organisms → Bacteria	701	Open in IMG/M
3300012386\|Ga0134046_1036889	Not Available	918	Open in IMG/M
3300012469\|Ga0150984_104768986	Not Available	534	Open in IMG/M
3300012469\|Ga0150984_105647708	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	1129	Open in IMG/M
3300012681\|Ga0136613_10074783	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	1940	Open in IMG/M
3300012910\|Ga0157308_10085253	Not Available	902	Open in IMG/M
3300013100\|Ga0157373_10499677	Not Available	878	Open in IMG/M
3300013297\|Ga0157378_12620545	Not Available	557	Open in IMG/M
3300013308\|Ga0157375_12879102	Not Available	575	Open in IMG/M
3300013765\|Ga0120172_1064970	Not Available	919	Open in IMG/M
3300014150\|Ga0134081_10011328	All Organisms → cellular organisms → Bacteria	2396	Open in IMG/M
3300015372\|Ga0132256_100254003	All Organisms → cellular organisms → Bacteria	1828	Open in IMG/M
3300015373\|Ga0132257_101455274	Not Available	873	Open in IMG/M
3300017654\|Ga0134069_1229243	Not Available	641	Open in IMG/M
3300017695\|Ga0180121_10229710	Not Available	694	Open in IMG/M
3300017789\|Ga0136617_10077741	All Organisms → cellular organisms → Bacteria	2895	Open in IMG/M
3300018071\|Ga0184618_10053711	All Organisms → cellular organisms → Bacteria	1473	Open in IMG/M
3300018072\|Ga0184635_10311189	Not Available	614	Open in IMG/M
3300018465\|Ga0190269_10205190	Not Available	1072	Open in IMG/M
3300018481\|Ga0190271_11222514	Not Available	873	Open in IMG/M
3300019377\|Ga0190264_10080720	Not Available	1448	Open in IMG/M
3300020020\|Ga0193738_1124241	Not Available	717	Open in IMG/M
3300021078\|Ga0210381_10215639	Not Available	673	Open in IMG/M
3300023064\|Ga0247801_1064805	Not Available	577	Open in IMG/M
3300023072\|Ga0247799_1048700	Not Available	701	Open in IMG/M
3300025167\|Ga0209642_10331668	Not Available	861	Open in IMG/M
3300025314\|Ga0209323_10212635	Not Available	1255	Open in IMG/M
3300025327\|Ga0209751_11350301	Not Available	508	Open in IMG/M
3300025901\|Ga0207688_10160365	Not Available	1333	Open in IMG/M
3300025921\|Ga0207652_11267536	Not Available	639	Open in IMG/M
3300025928\|Ga0207700_10288944	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	1413	Open in IMG/M
3300025936\|Ga0207670_11361590	Not Available	602	Open in IMG/M
3300025941\|Ga0207711_10228220	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	1705	Open in IMG/M
3300025944\|Ga0207661_11992985	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	526	Open in IMG/M
3300026095\|Ga0207676_12127267	Not Available	559	Open in IMG/M
3300026324\|Ga0209470_1347568	Not Available	533	Open in IMG/M
3300027273\|Ga0209886_1009119	Not Available	1424	Open in IMG/M
3300027461\|Ga0207601_100285	All Organisms → cellular organisms → Bacteria	1946	Open in IMG/M
3300027561\|Ga0209887_1051800	Not Available	883	Open in IMG/M
3300027637\|Ga0209818_1048850	Not Available	1019	Open in IMG/M
3300027748\|Ga0209689_1373149	Not Available	546	Open in IMG/M
3300027873\|Ga0209814_10104745	Not Available	1201	Open in IMG/M
3300027907\|Ga0207428_10196040	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	1521	Open in IMG/M
3300028705\|Ga0307276_10117402	Not Available	656	Open in IMG/M
3300028712\|Ga0307285_10181891	Not Available	584	Open in IMG/M
3300028715\|Ga0307313_10001336	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	5212	Open in IMG/M
3300028717\|Ga0307298_10040670	Not Available	1258	Open in IMG/M
3300028719\|Ga0307301_10071376	Not Available	1083	Open in IMG/M
3300028720\|Ga0307317_10126660	Not Available	853	Open in IMG/M
3300028722\|Ga0307319_10230826	Not Available	608	Open in IMG/M
3300028771\|Ga0307320_10238568	Not Available	715	Open in IMG/M
3300028784\|Ga0307282_10006857	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	4471	Open in IMG/M
3300028784\|Ga0307282_10293740	Not Available	783	Open in IMG/M
3300028803\|Ga0307281_10268528	Not Available	630	Open in IMG/M
3300028819\|Ga0307296_10418538	Not Available	732	Open in IMG/M
3300028819\|Ga0307296_10661080	Not Available	571	Open in IMG/M
3300028824\|Ga0307310_10231847	Not Available	881	Open in IMG/M
3300028880\|Ga0307300_10000823	All Organisms → cellular organisms → Bacteria	7579	Open in IMG/M
3300030006\|Ga0299907_10356780	Not Available	1182	Open in IMG/M
3300030619\|Ga0268386_10653286	Not Available	693	Open in IMG/M
3300030830\|Ga0308205_1027648	Not Available	682	Open in IMG/M
3300030990\|Ga0308178_1020166	Not Available	1050	Open in IMG/M
3300030993\|Ga0308190_1041400	Not Available	856	Open in IMG/M
3300031228\|Ga0299914_10962209	Not Available	699	Open in IMG/M
3300031228\|Ga0299914_11532892	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	518	Open in IMG/M
3300031229\|Ga0299913_11269419	Not Available	694	Open in IMG/M
3300031422\|Ga0308186_1028221	Not Available	571	Open in IMG/M
3300031474\|Ga0170818_107560890	Not Available	573	Open in IMG/M
3300031753\|Ga0307477_10777771	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	637	Open in IMG/M
3300031908\|Ga0310900_11014414	Not Available	683	Open in IMG/M
3300031938\|Ga0308175_101328195	Not Available	801	Open in IMG/M
3300032174\|Ga0307470_10486391	Not Available	897	Open in IMG/M
3300033550\|Ga0247829_10418174	Not Available	1104	Open in IMG/M
3300034115\|Ga0364945_0186768	Not Available	630	Open in IMG/M
3300034644\|Ga0370548_062219	Not Available	689	Open in IMG/M

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:

Habitat	Taxonomy	Distribution
Environmental	Environmental	80.77%
Host-Associated	Host-Associated	19.23%

Habitat	Taxonomy	Distribution
Terrestrial	Environmental → Terrestrial	71.54%
Plants	Host-Associated → Plants	19.23%
Aquatic	Environmental → Aquatic	9.23%

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil	70.00%
Rhizosphere	Host-Associated → Plants → Rhizosphere	13.08%
Freshwater	Environmental → Aquatic → Freshwater	6.15%
Rhizoplane	Host-Associated → Plants → Rhizoplane	6.15%
Sediment	Environmental → Aquatic → Sediment	2.31%
Marine	Environmental → Aquatic → Marine	0.77%
Floodplain	Environmental → Terrestrial → Floodplain	0.77%
Agricultural Field	Environmental → Terrestrial → Agricultural Field	0.77%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified	58.46%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	10.77%
Loam	Environmental → Terrestrial → Soil → Loam	6.15%
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	4.62%
Ice	Environmental → Aquatic → Freshwater → Ice	3.85%
Sand	Environmental → Terrestrial → Soil → Sand	3.85%
Unclassified	Environmental → Aquatic → Sediment → Unclassified	2.31%
Soil	Host-Associated → Plants → Rhizosphere → Soil	2.31%
Wetlands	Environmental → Terrestrial → Soil → Wetlands	1.54%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified	1.54%
Sediment	Environmental → Aquatic → Freshwater → Sediment	0.77%
Lake	Environmental → Aquatic → Freshwater → Lake	0.77%
Groundwater	Environmental → Aquatic → Freshwater → Groundwater	0.77%
Wetlands	Environmental → Aquatic → Marine → Wetlands	0.77%
Sediment	Environmental → Terrestrial → Floodplain → Sediment	0.77%
Unclassified	Environmental → Terrestrial → Agricultural Field → Unclassified	0.77%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified → Unclassified	37.69%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	10.77%
Grasslands	Environmental → Terrestrial → Soil → Unclassified → Grasslands	6.15%
Agricultural Land	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land	5.38%
Unclassified	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified	4.62%
Unclassified	Environmental → Aquatic → Freshwater → Ice → Unclassified	3.85%
Agricultural Soil	Environmental → Terrestrial → Soil → Loam → Agricultural Soil	3.85%
Unclassified	Environmental → Terrestrial → Soil → Sand → Unclassified	3.85%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil	3.08%
Unclassified	Environmental → Aquatic → Sediment → Unclassified → Unclassified	2.31%
Agricultural	Environmental → Terrestrial → Soil → Unclassified → Agricultural	2.31%
Uranium Contaminated	Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated	2.31%
Unclassified	Host-Associated → Plants → Rhizosphere → Soil → Unclassified	2.31%
Permafrost	Environmental → Terrestrial → Soil → Unclassified → Permafrost	1.54%
Unclassified	Environmental → Terrestrial → Soil → Loam → Unclassified	1.54%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified	1.54%
Unclassified	Environmental → Aquatic → Freshwater → Sediment → Unclassified	0.77%
Unclassified	Environmental → Aquatic → Freshwater → Lake → Unclassified	0.77%
Unclassified	Environmental → Aquatic → Freshwater → Groundwater → Unclassified	0.77%
Unclassified	Environmental → Aquatic → Marine → Wetlands → Unclassified	0.77%
Unclassified	Environmental → Terrestrial → Soil → Wetlands → Unclassified	0.77%
Permafrost	Environmental → Terrestrial → Soil → Wetlands → Permafrost	0.77%
Grasslands	Environmental → Terrestrial → Soil → Loam → Grasslands	0.77%
Unclassified	Environmental → Terrestrial → Floodplain → Sediment → Unclassified	0.77%
Unclassified	Environmental → Terrestrial → Agricultural Field → Unclassified → Unclassified	0.77%

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	20.77%
Grasslands Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil	4.62%
Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil	4.62%
Populus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere	4.62%
Polar Desert Sand	Environmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand	3.85%
Vadose Zone Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil	3.85%
Groundwater Sand	Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand	3.85%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil	3.08%
Serpentine Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil	2.31%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil	2.31%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil	2.31%
Soil	Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil	2.31%
Groundwater Sediment	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment	1.54%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	1.54%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil	1.54%
Agricultural Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil	1.54%
Permafrost	Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost	1.54%
Grasslands Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil	1.54%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil	1.54%
Hardwood Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil	1.54%
Corn, Switchgrass And Miscanthus Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere	1.54%
Corn Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere	1.54%
Soil	Environmental → Terrestrial → Soil → Loam → Unclassified → Soil	1.54%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere	1.54%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	1.54%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere	1.54%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	1.54%
Avena Fatua Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere	1.54%
Groundwater Sediment	Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment	0.77%
Freshwater Lake	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake	0.77%
Soil	Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil	0.77%
Natural And Restored Wetlands	Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands	0.77%
Soil	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil	0.77%
Terrestrial	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial	0.77%
Surface Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil	0.77%
Rice Paddy Soil	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil	0.77%
Permafrost Soil	Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil	0.77%
Soil	Environmental → Terrestrial → Soil → Loam → Grasslands → Soil	0.77%
Switchgrass Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere	0.77%
Sediment	Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment	0.77%
Soil	Environmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil	0.77%
Arabidopsis Rhizosphere	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere	0.77%
Avena Fatua Rhizosphere	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere	0.77%
Corn Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere	0.77%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	0.77%
Arabidopsis Thaliana Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere	0.77%
Corn, Switchgrass And Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere	0.77%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere	0.77%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere	0.77%
Arabidopsis Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere	0.77%

Visualization

Powered by ApexCharts

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
3300000893	Forest soil microbial communities from Amazon forest - Pasture72 2010 replicate I A001	Environmental	Open in IMG/M
3300001305	Grasslands soil microbial communities from Hopland, California, USA	Environmental	Open in IMG/M
3300003999	Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleA_D2	Environmental	Open in IMG/M
3300004157	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2	Environmental	Open in IMG/M
3300004463	Combined assembly of Arabidopsis thaliana microbial communities	Host-Associated	Open in IMG/M
3300005168	Soil and rhizosphere microbial communities from Laval, Canada - mgLPC	Environmental	Open in IMG/M
3300005174	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129	Environmental	Open in IMG/M
3300005334	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2	Host-Associated	Open in IMG/M
3300005450	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131	Environmental	Open in IMG/M
3300005536	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG	Environmental	Open in IMG/M
3300005542	Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1	Environmental	Open in IMG/M
3300005598	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155	Environmental	Open in IMG/M
3300005614	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2	Host-Associated	Open in IMG/M
3300005905	Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_5C_0N_105	Environmental	Open in IMG/M
3300006797	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108	Environmental	Open in IMG/M
3300006806	Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100	Environmental	Open in IMG/M
3300006847	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5	Host-Associated	Open in IMG/M
3300006852	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2	Host-Associated	Open in IMG/M
3300006914	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5	Host-Associated	Open in IMG/M
3300009036	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG	Host-Associated	Open in IMG/M
3300009038	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG	Environmental	Open in IMG/M
3300009093	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG	Host-Associated	Open in IMG/M
3300009100	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2	Host-Associated	Open in IMG/M
3300009137	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158	Environmental	Open in IMG/M
3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Host-Associated	Open in IMG/M
3300009163	Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140205_XF_MetaG	Environmental	Open in IMG/M
3300009661	Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil DNA_2013-062	Environmental	Open in IMG/M
3300009797	Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S2_10_20	Environmental	Open in IMG/M
3300009812	Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N2_50_60	Environmental	Open in IMG/M
3300009837	Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_20_30	Environmental	Open in IMG/M
3300009840	Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105A	Environmental	Open in IMG/M
3300010039	Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot56	Environmental	Open in IMG/M
3300010043	Tropical forest soil microbial communities from Panama - MetaG Plot_26	Environmental	Open in IMG/M
3300010044	Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot60	Environmental	Open in IMG/M
3300010101	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_20_5_24_2 metaT (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300010104	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_40_2_16_1 metaT (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300010154	Soil microbial communities from Willow Creek, Wisconsin, USA - WC-WI-TBF metaT (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300010320	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_11112015	Environmental	Open in IMG/M
3300010359	Tropical forest soil microbial communities from Panama - MetaG Plot_15	Environmental	Open in IMG/M
3300010366	Tropical forest soil microbial communities from Panama - MetaG Plot_24	Environmental	Open in IMG/M
3300011003	Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t9i015	Environmental	Open in IMG/M
3300011415	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT469_2	Environmental	Open in IMG/M
3300011992	Permafrost microbial communities from Nunavut, Canada - A23_65cm_12M	Environmental	Open in IMG/M
3300012022	Terrestrial microbial communites from a soil warming plot in Okalahoma, USA - C6	Environmental	Open in IMG/M
3300012093	Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ611 (21.06)	Environmental	Open in IMG/M
3300012188	Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ330 (21.06)	Environmental	Open in IMG/M
3300012201	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG	Environmental	Open in IMG/M
3300012211	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG	Environmental	Open in IMG/M
3300012212	Combined assembly of Hopland grassland soil	Host-Associated	Open in IMG/M
3300012285	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG	Environmental	Open in IMG/M
3300012350	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG	Environmental	Open in IMG/M
3300012386	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_24_1 metaT (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300012469	Combined assembly of Soil carbon rhizosphere	Host-Associated	Open in IMG/M
3300012681	Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ272 (21.06)	Environmental	Open in IMG/M
3300012910	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S198-509B-2	Environmental	Open in IMG/M
3300013100	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG	Host-Associated	Open in IMG/M
3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Host-Associated	Open in IMG/M
3300013308	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG	Host-Associated	Open in IMG/M
3300013765	Permafrost microbial communities from Nunavut, Canada - A30_80cm_6M	Environmental	Open in IMG/M
3300014150	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_5_24_1 metaG	Environmental	Open in IMG/M
3300015372	Soil combined assembly	Host-Associated	Open in IMG/M
3300015373	Combined assembly of cpr5 rhizosphere	Host-Associated	Open in IMG/M
3300017654	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_2_24_1 metaG	Environmental	Open in IMG/M
3300017695	Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ540 (21.06) (version 2)	Environmental	Open in IMG/M
3300017789	Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ322 (21.06)	Environmental	Open in IMG/M
3300018071	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_b1	Environmental	Open in IMG/M
3300018072	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b2	Environmental	Open in IMG/M
3300018465	Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 IS	Environmental	Open in IMG/M
3300018481	Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 T	Environmental	Open in IMG/M
3300019377	Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 112 T	Environmental	Open in IMG/M
3300020020	Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2a1	Environmental	Open in IMG/M
3300021078	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5_coex redo	Environmental	Open in IMG/M
3300023064	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S001-104B-6	Environmental	Open in IMG/M
3300023072	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S151-409C-6	Environmental	Open in IMG/M
3300025167	Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 19_2 (SPAdes)	Environmental	Open in IMG/M
3300025314	Soil microbial communities from Rifle, Colorado, USA - sediment 19ft 2	Environmental	Open in IMG/M
3300025327	Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 13_1 (SPAdes)	Environmental	Open in IMG/M
3300025901	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes)	Host-Associated	Open in IMG/M
3300025921	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes)	Environmental	Open in IMG/M
3300025928	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes)	Environmental	Open in IMG/M
3300025936	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes)	Environmental	Open in IMG/M
3300025941	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025944	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes)	Environmental	Open in IMG/M
3300026095	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026324	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 (SPAdes)	Environmental	Open in IMG/M
3300027273	Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N2_40_50 (SPAdes)	Environmental	Open in IMG/M
3300027461	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-ROWE15-E (SPAdes)	Environmental	Open in IMG/M
3300027561	Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_30_40 (SPAdes)	Environmental	Open in IMG/M
3300027637	Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS200 (SPAdes)	Environmental	Open in IMG/M
3300027748	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 (SPAdes)	Environmental	Open in IMG/M
3300027873	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 (SPAdes)	Host-Associated	Open in IMG/M
3300027907	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes)	Host-Associated	Open in IMG/M
3300028705	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_115	Environmental	Open in IMG/M
3300028712	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_139	Environmental	Open in IMG/M
3300028715	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_203	Environmental	Open in IMG/M
3300028717	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_158	Environmental	Open in IMG/M
3300028719	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_182	Environmental	Open in IMG/M
3300028720	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_357	Environmental	Open in IMG/M
3300028722	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_368	Environmental	Open in IMG/M
3300028771	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_369	Environmental	Open in IMG/M
3300028784	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_121	Environmental	Open in IMG/M
3300028803	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_120	Environmental	Open in IMG/M
3300028819	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_153	Environmental	Open in IMG/M
3300028824	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_197	Environmental	Open in IMG/M
3300028880	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_181	Environmental	Open in IMG/M
3300030006	Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT152D67	Environmental	Open in IMG/M
3300030619	Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT150D86 (Novaseq)	Environmental	Open in IMG/M
3300030830	Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_368 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300030990	Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_149 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300030993	Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_185 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300031228	Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT153D57	Environmental	Open in IMG/M
3300031229	Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT155D38	Environmental	Open in IMG/M
3300031422	Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_181 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300031474	Fir Coassembly Site 11 - Champenoux / Amance forest	Environmental	Open in IMG/M
3300031753	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515	Environmental	Open in IMG/M
3300031908	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D1	Environmental	Open in IMG/M
3300031938	Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1	Environmental	Open in IMG/M
3300032174	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05	Environmental	Open in IMG/M
3300033550	Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day4	Environmental	Open in IMG/M
3300034115	Sediment microbial communities from East River floodplain, Colorado, United States - 29_s17	Environmental	Open in IMG/M
3300034644	Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_123 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M

Geographical Distribution

Zoom:	Powered by OpenStreetMap

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
AP72_2010_repI_A001DRAFT_10674911	3300000893	Forest Soil	VGLADVLFGRKKLKGPAGERLFAISTARITLESELD
C688J14111_101589241	3300001305	Soil	VGLRDVLFGRKQLKEAAGERLFAISTARITLETELD
Ga0055469_103079242	3300003999	Natural And Restored Wetlands	MGLWNILSGGRKLRGPKRDRLFALSTAQVTLEGELGLRPAG
Ga0062590_1009721432	3300004157	Soil	LGLGDVLFGRKKLKGANLDRLFALSTAQITLETELGLKPAGVA
Ga0062590_1019232841	3300004157	Soil	VGLRDVLLGRKQLKDAAGERLFAISTARITLETELDLKPA
Ga0063356_1041417871	3300004463	Arabidopsis Thaliana Rhizosphere	LGLADVLFGRKKLKAPEKERLFALATAGVTLSVELGLHAVA
Ga0066809_100976212	3300005168	Soil	LGLGDVLFGRKRLRRANVDRLFALSTAQVTLQAELGLTSAGVAT
Ga0066680_106041452	3300005174	Soil	MGLTDILFGRKKLKGPAEERLFALSTAAVTLQTDLNLTTA
Ga0068869_1001329623	3300005334	Miscanthus Rhizosphere	LGLGNVLFGRKKLKDAAGERLFAISTARITLEAELGLKST
Ga0068869_1021141991	3300005334	Miscanthus Rhizosphere	LGLRDILSGRKKLKDPARERLFAISTARITLQTELDLKPS
Ga0066682_109668471	3300005450	Soil	VGLANVLFGRKKLKAPARERLFALSTAGVTLDTELGLKPVSAAVVFK
Ga0070697_1013689601	3300005536	Corn, Switchgrass And Miscanthus Rhizosphere	LGLTDVLFGRKRLKPPAEDRLFALATATVTLQTELGLKPAGV
Ga0070732_101954371	3300005542	Surface Soil	LGLGDVLFGRKKLKAPAAERLFAISTAAVTLDTACSL
Ga0066706_113013892	3300005598	Soil	MGLTDILFGRKKLKGPAEERLFALSTAAVTLQTDLNLTTAGVA
Ga0068856_1007890652	3300005614	Corn Rhizosphere	VGLRDVLFGRKKLKDPARERLFAISTARITLETEL
Ga0075269_100236072	3300005905	Rice Paddy Soil	VPLLDVLFGRKKLKDASEERIFALSTAQVTLQTELGL
Ga0066659_104588802	3300006797	Soil	LGLRDVLFGRKKVKDPVRERLFAISTARITLESELDL
Ga0079220_104940362	3300006806	Agricultural Soil	VGLTDVLFGRKKLKGPNEDSLFALTTACVTLQSELGLK
Ga0075431_1004389181	3300006847	Populus Rhizosphere	VGLTDVLFGGRKRLKGAKLDKLFALSTAQITLETELGL
Ga0075433_111586351	3300006852	Populus Rhizosphere	VGFTDVLFGRKKLKSPAGERLFALSTARVTLDAELGLKS
Ga0075436_1013760861	3300006914	Populus Rhizosphere	VGLLDVLFGRKRLKDASVERLFALSTAQVTLDVDLG
Ga0105244_105048112	3300009036	Miscanthus Rhizosphere	LGLRDVLFGRKKLKDPARERLFAISTARITLETEL
Ga0099829_116286391	3300009038	Vadose Zone Soil	MGLGNVLFGRKQLKGPNEDTLFALTTACVTLQTELGLTPAGVGAVTYKS
Ga0105240_112293442	3300009093	Corn Rhizosphere	MGLTDVLFGRKKLKGPNQDSLFALTTACVTLQTEL
Ga0105240_121462452	3300009093	Corn Rhizosphere	VGLTDVLFGRKKLKGPNEDSLFALTTACVTLQSELGLKPA
Ga0075418_102939983	3300009100	Populus Rhizosphere	LGLADVLFGRKKLKKADEQKLFAIATARITLETELGLK
Ga0066709_1022306432	3300009137	Grasslands Soil	VGLTDVLFGRKRLKGAARDRLFALSTARVTLELEGVK
Ga0066709_1045462832	3300009137	Grasslands Soil	MGLRDVLFGRNKLKDPARERLFAISTARITMQAELNLK
Ga0105243_101409913	3300009148	Miscanthus Rhizosphere	LGLGNVLFGRKKLKDAAGERLFAISTARITLETELELRP
Ga0114970_101754371	3300009163	Freshwater Lake	VGVFDVMFGRKRLKGAAQDRLFALATAQVTLEVELALKP
Ga0105858_12417001	3300009661	Permafrost Soil	VALRDVLFGRKKLPGPREDRLFALSTASVTLETECGLTTAG
Ga0105080_10440522	3300009797	Groundwater Sand	VGLGSILFGGRKRLKGAKLDKIFALSSAQVQLEAELGLK
Ga0105067_10034783	3300009812	Groundwater Sand	VGLTDVLFGGRKRLKGARLDKLFALSTAQITLQTELGLDSAGVAAVVFK
Ga0105058_11766001	3300009837	Groundwater Sand	VGLGNILFGGRKRLKGAKLDKIFALSSAQVQLEAELGLKPAGVAAV
Ga0126313_104862902	3300009840	Serpentine Soil	LGLTNVLFGRKKLKKAVQERLFALATARISLETELGLK
Ga0126309_100051941	3300010039	Serpentine Soil	VGLTDILFGRKRLKGAKLDKLFALSTAQVTLDAEL
Ga0126380_101147393	3300010043	Tropical Forest Soil	VGLADVLFGRKKLKGPAGERLFAISTARITLETELD
Ga0126310_101133701	3300010044	Serpentine Soil	VGLTDILFGRKKLKGAVREQLFAISTAHVTMEVELGLRFAR
Ga0127481_10379911	3300010101	Grasslands Soil	VGLADILLGRKKLKGPAQDRLFALSTARVTLDAEL
Ga0127446_11035002	3300010104	Grasslands Soil	VGLGDVLFGRKKLKGANLDRLFALSTAQITLETGTSLRTGVRS*
Ga0127503_108344241	3300010154	Soil	VGLRDVLSGRKKLQDPAQDRLFAISTARITLETDLDLKSAGS
Ga0134109_105054241	3300010320	Grasslands Soil	VGLRDVLLGRKKLQAPAGERLFAISTARITLATELDL
Ga0126376_127161312	3300010359	Tropical Forest Soil	VGLADVLFGRKKLKGPAGERLFAISTARITLETELDLK
Ga0126376_128912902	3300010359	Tropical Forest Soil	VGLGNILFGRKKLKAAASERLFALSTAQVTLDVELGLK
Ga0126379_116580381	3300010366	Tropical Forest Soil	VGLADVLFGRKKLKGPNEDSLFALTTACVTLQTELGLTP
Ga0138514_1001581262	3300011003	Soil	LGLGNVLFGRKKLKDAAGERLFAISTARITLEAELGLK
Ga0137325_10301681	3300011415	Soil	VGLGDVLFGRKRLKGAKLDKLFALSTAQITLETELGLRTAGV
Ga0120146_10340561	3300011992	Permafrost	LGFRDVLFGRKQLKEAAAERLFALSTARVTLDSD*
Ga0120191_100479551	3300012022	Terrestrial	MGLGDVLFGRKKLKEPSGDRIFALSTARITLETELGL
Ga0136632_104221802	3300012093	Polar Desert Sand	VGFTDILFGRKRLKEASGERLFALSTARITLETDLGLTPAESGLKHTAAV
Ga0136618_102411301	3300012188	Polar Desert Sand	VGFTDILFGRKRLKEASGERLFALSTARITLETDL
Ga0137365_103690812	3300012201	Vadose Zone Soil	VGLADVLFGRKKLKDPARARLFALRTARVTLEAERGLKPAGV
Ga0137377_111637911	3300012211	Vadose Zone Soil	LGLRDVLSGRKQLKAPAAERLFAMSTAAITLDVSCGLR
Ga0150985_1223647091	3300012212	Avena Fatua Rhizosphere	VGLTDILFGRKRLSKPKADRLFALSTAAITLDTELG
Ga0137370_109574071	3300012285	Vadose Zone Soil	VGLTDVLFGRKKLKGPSEDSLFALTTACVTLQTELGLKP
Ga0137372_107533001	3300012350	Vadose Zone Soil	VGLRDVLFGRKQLKAAKGERLFALSTAAVTLDVAL
Ga0134046_10368891	3300012386	Grasslands Soil	VGLADILLGRKKLKGPAQDRLFALSTARVTMDTELGLK
Ga0150984_1047689862	3300012469	Avena Fatua Rhizosphere	VGLGDVLFGRRKLKEASRERIFALSTATITLETELG
Ga0150984_1056477081	3300012469	Avena Fatua Rhizosphere	LGFTDVLFGRKKLKSPAQERLFALSTARVTLEGELGLKSAGAGG
Ga0136613_100747831	3300012681	Polar Desert Sand	VGFTDILFGRKRLKEASGERLFALSTARITLETDLG
Ga0157308_100852531	3300012910	Soil	VGLRDVLFGRKQLKDAAGERLFAISTARITLETELDLKPAGAA
Ga0157373_104996772	3300013100	Corn Rhizosphere	VGLADVLFGRKKLKGPAGERLFAISTARITLEIELDL
Ga0157378_126205451	3300013297	Miscanthus Rhizosphere	LGLGDVLFGRKKLKGANLDRLFALSTAQVTLETELGLKPDRVAA
Ga0157375_128791022	3300013308	Miscanthus Rhizosphere	LGLGDVLFGRKKLKSANLDRLFALSTARITLEAELGLKPDDV
Ga0120172_10649702	3300013765	Permafrost	VGLKDVLFGRKQLKDAAAERIFALSTAAVTLETEL
Ga0134081_100113284	3300014150	Grasslands Soil	MGFTDVLFGRKKLKGPAQERMFALSTARVTLDAELGLK
Ga0132256_1002540031	3300015372	Arabidopsis Rhizosphere	VGLGNILFGRKKLSGAKLDKLFALPSAAVTMDAELGLRSDRVAAV
Ga0132257_1014552741	3300015373	Arabidopsis Rhizosphere	LGLGDVLFGRKKLKGANLDRLFALSTAQVTLETELGLKPDR
Ga0134069_12292431	3300017654	Grasslands Soil	VGLGNILFGRKKLKPAASERLFALSTAQVTLEVELGLKSAGK
Ga0180121_102297101	3300017695	Polar Desert Sand	VGLGDILFGRKKLKEAVPEKLFALATACVTLEAELGLKP
Ga0136617_100777414	3300017789	Polar Desert Sand	VGLRDLLFGRSKLKEASPEQLFALSTARVTLETELGLRSSGRA
Ga0184618_100537111	3300018071	Groundwater Sediment	MGLTDVLFGRKKLKKADEQRLFAITTARITLETDLG
Ga0184635_103111891	3300018072	Groundwater Sediment	VGLGNILFGRKKLSGAKLDKLFALPSAAITMDAELGLR
Ga0190269_102051902	3300018465	Soil	VGLGNVLFGRKKLKGANLDKLFALSTAAITLETEGNLKPAGV
Ga0190271_112225141	3300018481	Soil	VGLTDVLFGGRKRLKGAKLDKLFALSTAQVTLQAELGLK
Ga0190264_100807201	3300019377	Soil	VGLGNVLFGRKKLKKAAGDKLFALSAARVTLEVEL
Ga0193738_11242412	3300020020	Soil	VGFTDVLFGRKKLREAQGERLFAISTARVTLDVELG
Ga0210381_102156391	3300021078	Groundwater Sediment	LGLADVLLGRKKLKSPAGEKLFALSTARVTLETEL
Ga0247801_10648051	3300023064	Soil	LGLGDVLFGRKKLKGASLDRLFALSTAQITLETELGLKPDRVAAVVFK
Ga0247799_10487001	3300023072	Soil	LGLTDVLFGRKRLKKAVQEKLFAITTARITLETDLGLK
Ga0209642_103316682	3300025167	Soil	VGLGNILFGRKKLKEAAPEQLFALATACVTLDVELGLKP
Ga0209323_102126353	3300025314	Soil	VGLGNILFGKKRLGRANLDKLFALSTAEITLKTALG
Ga0209751_113503012	3300025327	Soil	VGLGDILFGKKRLGGAKLDKLFALSTAHVTLQAEL
Ga0207688_101603653	3300025901	Corn, Switchgrass And Miscanthus Rhizosphere	LGLGDVLFGRKKLKSANLDRLFALSTARITLEAELG
Ga0207652_112675362	3300025921	Corn Rhizosphere	VGLADVLFGRKKLKGPAGERLFAISTARITLETEL
Ga0207700_102889443	3300025928	Corn, Switchgrass And Miscanthus Rhizosphere	VGLRDVLFGRKQLKDAAGERLFAISTARITLETELDLKPAGS
Ga0207670_113615902	3300025936	Switchgrass Rhizosphere	LGLGDVLFGRKKLKGANLDRLFALSTAQITLETELGLKPDR
Ga0207711_102282201	3300025941	Switchgrass Rhizosphere	VGLRDVLFGRKQLKDAAGERLFAISTARITLETELDLRSTGAAG
Ga0207661_119929852	3300025944	Corn Rhizosphere	MGLGDVLFGRKKLKGANLDRLFALSTAQITLQAELGLK
Ga0207676_121272671	3300026095	Switchgrass Rhizosphere	LGLGDVLFGRKKLKGANLDRLFALSTAQVTLETELGLK
Ga0209470_13475681	3300026324	Soil	VGLGDVLFGRKKLKEPAADRLFAITTAAVTLDVECGLK
Ga0209886_10091191	3300027273	Groundwater Sand	VGLTDVLFGGRKRLKGARLDKLFALSTAQITLQTELGLD
Ga0207601_1002853	3300027461	Soil	LGLRDVLFGRKKLKDAAPERVFAISTARITLETELNLK
Ga0209887_10518002	3300027561	Groundwater Sand	VGLGDVLFGRKKLKGAKPDKLFALSTAQVTLETELDL
Ga0209818_10488502	3300027637	Agricultural Soil	MGLTDVLFGRKKLKEAQGERLFALSTARVTLDVELGLRPGKR
Ga0209689_13731491	3300027748	Soil	LGLRDILSGRKRLKGPAAERLFALSTAAITLEVDCG
Ga0209814_101047451	3300027873	Populus Rhizosphere	VGFTDVLFGRKKLKSPAGERLFALSTARVTLDAELGLK
Ga0207428_101960401	3300027907	Populus Rhizosphere	VGFTDVLFGRKKLKSPAGERLFALSTARVTLDAELGLKSAGSG
Ga0307276_101174022	3300028705	Soil	VGLTDVLFGRKKLKSPAQERLFALSTARVTLEGELGLKSAGAG
Ga0307285_101818912	3300028712	Soil	LTDVLFGRKKLAKAQQEKLFAISTARITLETEFGLK
Ga0307313_100013366	3300028715	Soil	VGLGNVLFGRKKLKGANLDKLFALSTAAITLETELGLKPAGV
Ga0307298_100406701	3300028717	Soil	VGLGNVLFGRKKLKDASGERLFAISTARITLETELELR
Ga0307301_100713761	3300028719	Soil	MGLGNVLFGRKKLKGANLDKLFALSTAAITLETESNLKPAGVAA
Ga0307317_101266601	3300028720	Soil	VGLRDVLLGRKKLQDPARERLFAISTARITLETEL
Ga0307319_102308261	3300028722	Soil	VGLGNIIFGRKKLSGAKLDKLFALPSAAVTMDAELGLRSDGV
Ga0307320_102385681	3300028771	Soil	LGLGNVLFGRKKLKGANLDKLFALSTAAITLETEGNLKPAG
Ga0307282_100068571	3300028784	Soil	VGLGNVLFGRKKLKGANLDKLFALSTAAITLETELG
Ga0307282_102937402	3300028784	Soil	LGLADVLLGRKKLKSPAGEKLFALSTARVTLEAELGL
Ga0307281_102685282	3300028803	Soil	VALTDVLFGRKKLKEAKGERLFALSTARVTLEVELG
Ga0307296_104185381	3300028819	Soil	LGLGNVLFGRKKLKDAAGERLFAISTARITLETELGLKPTG
Ga0307296_106610801	3300028819	Soil	LGLADVLLGRKKLKSPAGEKLFALSTARVTLETELGL
Ga0307310_102318472	3300028824	Soil	LGLRDVLSGRKKLQEPARERLFAISTARITLETELDLKPA
Ga0307300_1000082310	3300028880	Soil	MGLGDVLFGRKKLKGAKLDKLFALSTAQVTLESELG
Ga0299907_103567802	3300030006	Soil	VALTDILFGRKRLKGAKLEKLFALSTARITLEVELGLKSAGVA
Ga0268386_106532862	3300030619	Soil	VALTDILFGRKRLKGAKLEKLFALSTARITLEVELGL
Ga0308205_10276482	3300030830	Soil	VGLRDVLFGRKQLKGPADERLFALATAQVTLETEL
Ga0308178_10201661	3300030990	Soil	LGLRDVLFGRKKLKDPAQERLFAISTARITLQTELD
Ga0308190_10414001	3300030993	Soil	VGLADILLGRKKLKGPAQDRLFALSTARVTLDTEL
Ga0299914_109622092	3300031228	Soil	VALTDILFGRKRLKGAKLEKLFALSTARITLEVELGLKP
Ga0299914_115328922	3300031228	Soil	VGLGNILFGKKKLSGAKLDKLFALSTAHVAMQAELGLRSAGGA
Ga0299913_112694192	3300031229	Soil	VALTDILFGRKRLKGAKLEKLFALSTARITLEVELGLK
Ga0308186_10282212	3300031422	Soil	LGLGNVLFGRKKLKDSSGERLFAISTARITLETELDLKS
Ga0170818_1075608901	3300031474	Forest Soil	LGLGDVLFGRKKLKAPAAERLFAITTAAVTLDTECSLQ
Ga0307477_107777712	3300031753	Hardwood Forest Soil	LFGRKKLKGPAEDRLFALATACVTLDTECSLKPAGVAAVTY
Ga0310900_110144142	3300031908	Soil	LGDVLFGRKKLKGANLDRLFALSTAQITLQTELNLKPDRVAAVV
Ga0308175_1013281951	3300031938	Soil	VGLGDVLFGRKKLKGANLERLFALSTAQITLETELGLKP
Ga0307470_104863912	3300032174	Hardwood Forest Soil	LGLGNVLFGRKKLKDAAGERLFAMSTARITLETELGLKPT
Ga0247829_104181741	3300033550	Soil	VGLRDVLFGRKQLKDAAGERLFAISTARITLETELDLRSTG
Ga0364945_0186768_2_139	3300034115	Sediment	VGLGNVLFGRKKLKKAAGDKLFALSAGRVTLEVELGLKAAGTAAVL
Ga0370548_062219_2_109	3300034644	Soil	LGLADVLLGRKKLKSPAGEKLFALSTARVTLETELG

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.51
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.51
Powered by PDBe Molstar

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome / Metatranscriptome Family F062591

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Gene Neighborhood

Neighboring Pfam domains

Neighboring Clusters of Orthologous Genes (COGs)

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign