NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F062566

Metagenome / Metatranscriptome Family F062566

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F062566
Family Type Metagenome / Metatranscriptome
Number of Sequences 130
Average Sequence Length 41 residues
Representative Sequence MAYSDTYGQTVNVQTLIDHGARRCGKLAEELTSEQVLSAR
Number of Associated Samples 97
Number of Associated Scaffolds 130

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Viruses
% of genes with valid RBS motifs 86.92 %
% of genes near scaffold ends (potentially truncated) 99.23 %
% of genes from short scaffolds (< 2000 bps) 91.54 %
Associated GOLD sequencing projects 94
AlphaFold2 3D model prediction Yes
3D model pTM-score0.44

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Duplodnaviria (83.846 % of family members)
NCBI Taxonomy ID 2731341
Taxonomy All Organisms → Viruses → Duplodnaviria

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake
(46.923 % of family members)
Environment Ontology (ENVO) Unclassified
(78.462 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Water (non-saline)
(75.385 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 39.71%    β-sheet: 0.00%    Coil/Unstructured: 60.29%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.44
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 130 Family Scaffolds
PF00166Cpn10 0.77
PF07460NUMOD3 0.77
PF13392HNH_3 0.77

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 130 Family Scaffolds
COG0234Co-chaperonin GroES (HSP10)Posttranslational modification, protein turnover, chaperones [O] 0.77


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms96.15 %
UnclassifiedrootN/A3.85 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2166559021|GXP7IEG01CPELIAll Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage519Open in IMG/M
3300002092|JGI24218J26658_1000609All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage15674Open in IMG/M
3300003277|JGI25908J49247_10116812All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage634Open in IMG/M
3300003393|JGI25909J50240_1081613All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage647Open in IMG/M
3300003411|JGI25911J50253_10206851All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage540Open in IMG/M
3300003412|JGI25912J50252_10003623All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage5250Open in IMG/M
3300004240|Ga0007787_10245263All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage879Open in IMG/M
3300004771|Ga0007797_1042390All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1230Open in IMG/M
3300004806|Ga0007854_10187424All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage890Open in IMG/M
3300005527|Ga0068876_10254770All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1006Open in IMG/M
3300005581|Ga0049081_10113813All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1004Open in IMG/M
3300005583|Ga0049085_10014392All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage3047Open in IMG/M
3300005584|Ga0049082_10254449All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage592Open in IMG/M
3300006103|Ga0007813_1108878All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage529Open in IMG/M
3300006113|Ga0007858_1053515All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage862Open in IMG/M
3300006117|Ga0007818_1050349All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage789Open in IMG/M
3300006802|Ga0070749_10674191All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage554Open in IMG/M
3300007216|Ga0103961_1362198All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2164Open in IMG/M
3300007540|Ga0099847_1211524All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage563Open in IMG/M
3300008113|Ga0114346_1080712All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1535Open in IMG/M
3300009151|Ga0114962_10633712All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Podoviridae552Open in IMG/M
3300009154|Ga0114963_10621855All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage564Open in IMG/M
3300009155|Ga0114968_10183298All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1223Open in IMG/M
3300009158|Ga0114977_10240387All Organisms → Viruses → Predicted Viral1048Open in IMG/M
3300009158|Ga0114977_10676812All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage551Open in IMG/M
3300009163|Ga0114970_10520489All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage647Open in IMG/M
3300009182|Ga0114959_10290824All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage818Open in IMG/M
3300009184|Ga0114976_10166077All Organisms → Viruses → Predicted Viral1230Open in IMG/M
3300010157|Ga0114964_10228085Not Available890Open in IMG/M
3300010157|Ga0114964_10277391All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage796Open in IMG/M
3300010334|Ga0136644_10605742All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage602Open in IMG/M
3300010354|Ga0129333_10381689All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1250Open in IMG/M
3300010354|Ga0129333_11239220All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage618Open in IMG/M
3300010354|Ga0129333_11428987All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage568Open in IMG/M
3300010885|Ga0133913_11671746All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1602Open in IMG/M
3300013004|Ga0164293_10242776All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1276Open in IMG/M
3300013005|Ga0164292_10998691All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage522Open in IMG/M
3300013372|Ga0177922_10419281All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Podoviridae788Open in IMG/M
3300014502|Ga0182021_12769679All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage589Open in IMG/M
3300015050|Ga0181338_1022579All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage980Open in IMG/M
3300015050|Ga0181338_1029172All Organisms → cellular organisms → Bacteria843Open in IMG/M
3300015050|Ga0181338_1062022All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Podoviridae537Open in IMG/M
3300015050|Ga0181338_1067905All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Podoviridae508Open in IMG/M
3300017700|Ga0181339_1003129All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2251Open in IMG/M
3300017707|Ga0181363_1078963All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Podoviridae564Open in IMG/M
3300017716|Ga0181350_1011362All Organisms → cellular organisms → Bacteria2538Open in IMG/M
3300017716|Ga0181350_1021093All Organisms → Viruses → Predicted Viral1826Open in IMG/M
3300017722|Ga0181347_1160551All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage610Open in IMG/M
3300017723|Ga0181362_1020365All Organisms → Viruses → Predicted Viral1425Open in IMG/M
3300017736|Ga0181365_1144464Not Available565Open in IMG/M
3300017736|Ga0181365_1174100All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage504Open in IMG/M
3300017747|Ga0181352_1162964All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage585Open in IMG/M
3300017754|Ga0181344_1125451All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage738Open in IMG/M
3300017754|Ga0181344_1208759All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage547Open in IMG/M
3300017754|Ga0181344_1228545All Organisms → Viruses518Open in IMG/M
3300017761|Ga0181356_1052792Not Available1397Open in IMG/M
3300017761|Ga0181356_1212953All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Podoviridae566Open in IMG/M
3300017761|Ga0181356_1233888All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Podoviridae530Open in IMG/M
3300017761|Ga0181356_1251956All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Podoviridae503Open in IMG/M
3300017774|Ga0181358_1098992All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1047Open in IMG/M
3300017777|Ga0181357_1022183All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2524Open in IMG/M
3300017777|Ga0181357_1024374All Organisms → cellular organisms → Bacteria2400Open in IMG/M
3300017777|Ga0181357_1119872Not Available987Open in IMG/M
3300017777|Ga0181357_1136499All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage912Open in IMG/M
3300017777|Ga0181357_1145656All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage875Open in IMG/M
3300017777|Ga0181357_1308267All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage535Open in IMG/M
3300017778|Ga0181349_1206090All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage677Open in IMG/M
3300017778|Ga0181349_1211751All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Podoviridae665Open in IMG/M
3300017780|Ga0181346_1060370All Organisms → Viruses → Predicted Viral1521Open in IMG/M
3300017780|Ga0181346_1292614All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage555Open in IMG/M
3300017780|Ga0181346_1313030All Organisms → Viruses529Open in IMG/M
3300017784|Ga0181348_1063819All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1486Open in IMG/M
3300017784|Ga0181348_1094311All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1174Open in IMG/M
3300017784|Ga0181348_1266528All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage586Open in IMG/M
3300017785|Ga0181355_1141631All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage975Open in IMG/M
3300017785|Ga0181355_1304234All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage598Open in IMG/M
3300019781|Ga0181360_111585All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Podoviridae732Open in IMG/M
3300019781|Ga0181360_116965All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage595Open in IMG/M
3300019784|Ga0181359_1094776Not Available1102Open in IMG/M
3300020179|Ga0194134_10261733All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage703Open in IMG/M
3300020200|Ga0194121_10489574All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage600Open in IMG/M
3300020205|Ga0211731_10075420All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage505Open in IMG/M
3300021093|Ga0194123_10133076All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1370Open in IMG/M
3300021424|Ga0194117_10512205All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage534Open in IMG/M
3300021961|Ga0222714_10316940All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage849Open in IMG/M
3300022179|Ga0181353_1066681All Organisms → Viruses925Open in IMG/M
3300022179|Ga0181353_1073295All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage872Open in IMG/M
3300022190|Ga0181354_1113642All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage874Open in IMG/M
3300022407|Ga0181351_1102792All Organisms → Viruses1101Open in IMG/M
3300022407|Ga0181351_1136392All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage900Open in IMG/M
3300022407|Ga0181351_1208252All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Podoviridae646Open in IMG/M
3300022407|Ga0181351_1215641All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage628Open in IMG/M
3300022407|Ga0181351_1267044All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage522Open in IMG/M
3300022923|Ga0255783_10396293All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage520Open in IMG/M
3300022929|Ga0255752_10295974All Organisms → Viruses689Open in IMG/M
3300025392|Ga0208380_1062707All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage520Open in IMG/M
3300025732|Ga0208784_1009385All Organisms → Viruses → Predicted Viral3353Open in IMG/M
3300025872|Ga0208783_10048022All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1968Open in IMG/M
3300026568|Ga0255240_1046373All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage999Open in IMG/M
3300027600|Ga0255117_1098028All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Podoviridae554Open in IMG/M
3300027608|Ga0208974_1072031All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage957Open in IMG/M
3300027656|Ga0209357_1176085All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage556Open in IMG/M
3300027744|Ga0209355_1245692All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Podoviridae705Open in IMG/M
3300027744|Ga0209355_1248252All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage700Open in IMG/M
3300027754|Ga0209596_1060191All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1935Open in IMG/M
3300027754|Ga0209596_1254767All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage718Open in IMG/M
3300027769|Ga0209770_10157577All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage913Open in IMG/M
3300027772|Ga0209768_10031244All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2913Open in IMG/M
3300027798|Ga0209353_10156741All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Podoviridae1012Open in IMG/M
3300027804|Ga0209358_10552162All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage515Open in IMG/M
3300031673|Ga0307377_10601861All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage786Open in IMG/M
3300031707|Ga0315291_11413538All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage553Open in IMG/M
3300031758|Ga0315907_11248984All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage517Open in IMG/M
3300031951|Ga0315904_10604109All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage943Open in IMG/M
3300031963|Ga0315901_10793164All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage688Open in IMG/M
3300032053|Ga0315284_12282345All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Podoviridae536Open in IMG/M
3300032092|Ga0315905_10917226All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage747Open in IMG/M
3300032116|Ga0315903_10815952All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales679Open in IMG/M
3300032605|Ga0316232_1261933All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage663Open in IMG/M
3300033418|Ga0316625_102224569All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage547Open in IMG/M
3300033488|Ga0316621_11457021All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage524Open in IMG/M
3300033981|Ga0334982_0135016All Organisms → Viruses → Predicted Viral1270Open in IMG/M
3300034050|Ga0335023_0603306All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage557Open in IMG/M
3300034093|Ga0335012_0185044All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1113Open in IMG/M
3300034096|Ga0335025_0569661All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage562Open in IMG/M
3300034116|Ga0335068_0320805All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage765Open in IMG/M
3300034118|Ga0335053_0756299All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage541Open in IMG/M
3300034279|Ga0335052_0656288All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage519Open in IMG/M
3300034355|Ga0335039_0407384All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage697Open in IMG/M
3300034374|Ga0348335_030532All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2381Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake46.92%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake10.77%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater7.69%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater5.38%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake3.85%
FreshwaterEnvironmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater3.85%
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous3.85%
Freshwater LenticEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic3.08%
Freshwater To Marine Saline GradientEnvironmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient2.31%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater1.54%
SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Sediment1.54%
FreshwaterEnvironmental → Aquatic → Freshwater → River → Unclassified → Freshwater1.54%
Salt MarshEnvironmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh1.54%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil1.54%
LenticEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Lentic0.77%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater0.77%
Freshwater, PlanktonEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton0.77%
Estuarine WaterEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water0.77%
FenEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Fen0.77%
SoilEnvironmental → Terrestrial → Soil → Clay → Unclassified → Soil0.77%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2166559021Fresh water microbial communities from LaBonte Lake, Laramie, Wyoming, sample from peak-bloom 2EnvironmentalOpen in IMG/M
3300002092Lentic bog actinobacteria communities from Grosse Fuchskuhle, Germany - Sample acI-B2 co-culture F-B6 metagenomeEnvironmentalOpen in IMG/M
3300003277Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SDEnvironmentalOpen in IMG/M
3300003393Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.DDEnvironmentalOpen in IMG/M
3300003411Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.SDEnvironmentalOpen in IMG/M
3300003412Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.DDEnvironmentalOpen in IMG/M
3300004240Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.SNEnvironmentalOpen in IMG/M
3300004771Freshwater microbial communities from Crystal Bog, Wisconsin, USA - MA2.5MEnvironmentalOpen in IMG/M
3300004806Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH12Aug08EnvironmentalOpen in IMG/M
3300005527Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaGEnvironmentalOpen in IMG/M
3300005581Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRFEnvironmentalOpen in IMG/M
3300005583Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG SU08MSRFEnvironmentalOpen in IMG/M
3300005584Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG HU45MSRFEnvironmentalOpen in IMG/M
3300006103Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE29Jun09EnvironmentalOpen in IMG/M
3300006113Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH08Aug08EnvironmentalOpen in IMG/M
3300006117Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE08Jun09EnvironmentalOpen in IMG/M
3300006802Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18EnvironmentalOpen in IMG/M
3300007216Combined Assembly of cyanobacterial bloom in Punggol water reservoir, Singapore (Diel cycle-Surface and Bottom layer) 16 sequencing projectsEnvironmentalOpen in IMG/M
3300007540Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaGEnvironmentalOpen in IMG/M
3300008113Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0050-3-NAEnvironmentalOpen in IMG/M
3300009151Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_MF_MetaGEnvironmentalOpen in IMG/M
3300009154Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_EF_MetaGEnvironmentalOpen in IMG/M
3300009155Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaGEnvironmentalOpen in IMG/M
3300009158Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaGEnvironmentalOpen in IMG/M
3300009163Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140205_XF_MetaGEnvironmentalOpen in IMG/M
3300009182Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_EF_MetaGEnvironmentalOpen in IMG/M
3300009184Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaGEnvironmentalOpen in IMG/M
3300010157Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_MF_MetaGEnvironmentalOpen in IMG/M
3300010334Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_EF_MetaG (v2)EnvironmentalOpen in IMG/M
3300010354Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNAEnvironmentalOpen in IMG/M
3300010885northern Canada Lakes Co-assemblyEnvironmentalOpen in IMG/M
3300013004Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES118 metaGEnvironmentalOpen in IMG/M
3300013005Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES117 metaGEnvironmentalOpen in IMG/M
3300013372Freshwater microbial communities from Lake Erie, Ontario, Canada. Combined Assembly of 10 SPsEnvironmentalOpen in IMG/M
3300014502Permafrost microbial communities from Stordalen Mire, Sweden - 612E3M metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300015050Freshwater viral communities from Lake Michigan, USA - Sp13.VD.MM110.S.DEnvironmentalOpen in IMG/M
3300017700Freshwater viral communities from Lake Michigan, USA - Sp13.VD.MM110.D.DEnvironmentalOpen in IMG/M
3300017707Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MLB.S.NEnvironmentalOpen in IMG/M
3300017716Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.DCM.DEnvironmentalOpen in IMG/M
3300017722Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.NEnvironmentalOpen in IMG/M
3300017723Freshwater viral communities from Lake Michigan, USA - Su13.ND.MM110.S.NEnvironmentalOpen in IMG/M
3300017736Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.D.NEnvironmentalOpen in IMG/M
3300017747Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.S.NEnvironmentalOpen in IMG/M
3300017754Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.D.DEnvironmentalOpen in IMG/M
3300017761Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.NEnvironmentalOpen in IMG/M
3300017774Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.DEnvironmentalOpen in IMG/M
3300017777Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.D.NEnvironmentalOpen in IMG/M
3300017778Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.DEnvironmentalOpen in IMG/M
3300017780Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.D.NEnvironmentalOpen in IMG/M
3300017784Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.D.NEnvironmentalOpen in IMG/M
3300017785Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.D.NEnvironmentalOpen in IMG/M
3300019781Freshwater viral communities from Lake Michigan, USA - Sp13.ND.MM15.S.DEnvironmentalOpen in IMG/M
3300019784Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.DEnvironmentalOpen in IMG/M
3300020179Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015056 Kigoma Offshore 0mEnvironmentalOpen in IMG/M
3300020200Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015020 Mahale Deep Cast 50mEnvironmentalOpen in IMG/M
3300020205Freshwater lake microbial communities from Lake Erken, Sweden - P4710_103 megahit1EnvironmentalOpen in IMG/M
3300021093Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015023 Mahale A surfaceEnvironmentalOpen in IMG/M
3300021424Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015009 Mahale N1 surfaceEnvironmentalOpen in IMG/M
3300021961Estuarine water microbial communities from San Francisco Bay, California, United States - C33_3DEnvironmentalOpen in IMG/M
3300022179Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.D.NEnvironmentalOpen in IMG/M
3300022190Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.NEnvironmentalOpen in IMG/M
3300022407Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.S.DEnvironmentalOpen in IMG/M
3300022923Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011507BT metaGEnvironmentalOpen in IMG/M
3300022929Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011512CT metaGEnvironmentalOpen in IMG/M
3300025392Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE27Jun07 (SPAdes)EnvironmentalOpen in IMG/M
3300025732Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_>0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025872Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_>0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300026568Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Yuk_RepC_8d (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300027600Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Atlam_RepA_8hEnvironmentalOpen in IMG/M
3300027608Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF (SPAdes)EnvironmentalOpen in IMG/M
3300027656Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.SD (SPAdes)EnvironmentalOpen in IMG/M
3300027744Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.SN (SPAdes)EnvironmentalOpen in IMG/M
3300027754Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300027769Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.DD (SPAdes)EnvironmentalOpen in IMG/M
3300027772Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.SD (SPAdes)EnvironmentalOpen in IMG/M
3300027798Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD (SPAdes)EnvironmentalOpen in IMG/M
3300027804Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.SN (SPAdes)EnvironmentalOpen in IMG/M
3300031673Soil microbial communities from Risofladan, Vaasa, Finland - TR-3EnvironmentalOpen in IMG/M
3300031707Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G12_20EnvironmentalOpen in IMG/M
3300031758Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123EnvironmentalOpen in IMG/M
3300031951Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA120EnvironmentalOpen in IMG/M
3300031963Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA116EnvironmentalOpen in IMG/M
3300032053Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_16EnvironmentalOpen in IMG/M
3300032092Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA121EnvironmentalOpen in IMG/M
3300032116Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA119EnvironmentalOpen in IMG/M
3300032605Freshwater microbial communities from Trout Bog Lake, Wisconsin, USA - TBH18025_13EnvironmentalOpen in IMG/M
3300033418Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_T1_C1_D1_AEnvironmentalOpen in IMG/M
3300033488Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_OW2_C1_D1_CEnvironmentalOpen in IMG/M
3300033981Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME24Aug2014-rr0011EnvironmentalOpen in IMG/M
3300034050Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07May2013-rr0095EnvironmentalOpen in IMG/M
3300034093Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME08Jun2014-rr0072EnvironmentalOpen in IMG/M
3300034096Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME15Oct2015-rr0098EnvironmentalOpen in IMG/M
3300034116Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-CONTROL-GENDONOREnvironmentalOpen in IMG/M
3300034118Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME05Aug2017-rr0165EnvironmentalOpen in IMG/M
3300034279Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jul2014-rr0163EnvironmentalOpen in IMG/M
3300034355Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Oct2015-rr0135EnvironmentalOpen in IMG/M
3300034374Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_31 (v4)EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
LBLPB2_034445302166559021FreshwaterMAYSGTIGETVINVQTLIDHGARRCGKLAEELTSEQQLSARQ
JGI24218J26658_1000609163300002092LenticMAYSGSVGNTVISIQTLIDHGARRCGKLAEELTDEEVLSARQS
JGI25908J49247_1011681233300003277Freshwater LakeMSYSGTVGTTVVNVQEIIDHAARRCGKLAEELTSEQQLTARQSLYYFLS
JGI25909J50240_108161313300003393Freshwater LakeMAYSDTYGQTYNVQTLIDHGARRCGKLAEELTSEQVLSARQSLGF
JGI25911J50253_1020685133300003411Freshwater LakeMSYSGTVGTTVVNVQEIIDHAARRCGKLAEELTSEQQLTARQSLYY
JGI25912J50252_1000362313300003412Freshwater LakeMAYSGTVGTTVIDVQTLIDHGARRCGKLAEELTSEQVLSARES
Ga0007787_1024526313300004240Freshwater LakeMAYSDTYGQTVNVQTLIDHGARRAGKLAEELTSEQLVSARQSLS
Ga0007797_104239043300004771FreshwaterMAYSGTVGTTVINVQTLIDHGARRCGKLAEELTSEQVLSSRQ
Ga0007854_1018742433300004806FreshwaterMAYSGTVGNTVINVQTLIDHGARRAGKLAEELTDEQVQSAKE
Ga0068876_1025477033300005527Freshwater LakeMAYSGTVGETVINVQTLIDHGARRCGKLAEELTSEQQLSARQSL
Ga0049081_1011381333300005581Freshwater LenticMAYSETYGQTVNVQTLIDHGARRCGKLAEELTSEQVLSARQSLGFL
Ga0049085_1001439213300005583Freshwater LenticMAYSNSVGTTVITVQTLIDHGARRCGKLAGELTSEQVLSSRESLFFL
Ga0049082_1025444933300005584Freshwater LenticMAYSGTVGTTVIDVQTLIDHGARRCGKLAEELTSE
Ga0007813_110887823300006103FreshwaterMAYSGTVGTTVISVQQLIDHGARRCGKLAEELTSEQVLSAKESLYFFL
Ga0007858_105351533300006113FreshwaterMAYSGTVGNTVINVQTLIDHGARRAGKLAEELTDEQVQSAKESLFY
Ga0007818_105034913300006117FreshwaterMAYSGTFGTTVISVQTLIDHGARRCGKLAEELTDE
Ga0070749_1067419123300006802AqueousMAYSGTVGTTVIQVQTLIDHGARRCGKLAEELTSEQIL
Ga0103961_136219813300007216Freshwater LakeMAYSGTVGTTVIQVQTLIDHGARRCGKLAEELTSEQV
Ga0099847_121152413300007540AqueousMAYSDTYGQIYSVQTLIDHGARRCGKLAEELTSEQLLSAKESLGFV
Ga0114346_108071243300008113Freshwater, PlanktonMSYSNEYGQVYQIQTLIDHGARRCGKLAEELTSEQLLSARE
Ga0114962_1063371233300009151Freshwater LakeMAYSGSVGTTVINVQTLIDHGARRCGKLAEELTDEQVLSS
Ga0114963_1062185513300009154Freshwater LakeMAYSGTYGTTVINVQKLIDHGARRCGKLAEELTSEQVLSARE
Ga0114968_1018329833300009155Freshwater LakeMAYSGTVGTTVVTVQSLIDHGARRCGKLAEELTSEQLVASRESLFFLL
Ga0114977_1024038713300009158Freshwater LakeMAYSDTYGQTVNVQTLIDHGARRCGKLAEELTSEQVLSSRQSLGFLLS
Ga0114977_1067681223300009158Freshwater LakeMAYSGTVGTTVVNVQEVIDHATRRCGKLAEELTSEQQ
Ga0114970_1052048923300009163Freshwater LakeMAYSGTVGTTVITVQTLIDHGARRCGKLAEELTSEQVLSA
Ga0114959_1029082413300009182Freshwater LakeMAYSGTSGQTVINVQTLIDHGARRCGKLAEELTSEQQISARESLF
Ga0114976_1016607753300009184Freshwater LakeMAYSGTTGTTVITVQTLIDHGARRCGKLAEELTSEQV
Ga0114964_1022808513300010157Freshwater LakeLRAGSADMAYSGTTGTTVVTVQTLIDHGARRCGKLASELTSEQVLSARESL
Ga0114964_1027739133300010157Freshwater LakeMAYSGTSGQTVINVQTLIDHGARRCGKLAEELTSEQQISARESLFFLL
Ga0136644_1060574213300010334Freshwater LakeMAYSGTVGETVISVQDLIDHGARRCGKLAEELTSEQ
Ga0129333_1038168933300010354Freshwater To Marine Saline GradientMPYSGTVGNTVINVQTLIDHGARRCGKLAEELTSE
Ga0129333_1123922023300010354Freshwater To Marine Saline GradientMAYSDTYGQVYNVQTLIDHGARRCGKLAEELTSEQILSARE
Ga0129333_1142898713300010354Freshwater To Marine Saline GradientMAYSGTVGDTVISVQTLIDHGARRCGKLAEELTSEQLLSAK
Ga0133913_1167174613300010885Freshwater LakeMAYSDTYGQTVNVQTLIDHGARRAGKLAEELTSEQLVSA
Ga0164293_1024277643300013004FreshwaterMSYSDTYGQVFNVQTLIDHAARRCGKLAEELTSEQLL
Ga0164292_1099869113300013005FreshwaterMSYSGTIGTTVIDVQTLIEHGARRCGKLAEELTSEQ
Ga0177922_1041928133300013372FreshwaterMAYSETYGQTVNVQTLIDHGARRCGKLAEELTSEQVLSAR
Ga0182021_1276967923300014502FenMAYSDTYGQTVNVQTLIDHGARRCGKLAEELTSEQVL
Ga0181338_102257913300015050Freshwater LakeMAYSGSVGTTVITVQTLIDHGARRCGKLAEELTSEQ
Ga0181338_102917233300015050Freshwater LakeMAYSDTYGQTVNVQTLIDHGARRCGKLAAELTSEQVVSA
Ga0181338_106202233300015050Freshwater LakeMAYSDTYGQTVDVQTLIDHGARRCGKLAEELTSEQ
Ga0181338_106790533300015050Freshwater LakeMAYSDTYGQTVNVQTLIDHGARRCGKLAEELTSEQVLSAR
Ga0181339_100312913300017700Freshwater LakeMAYSNSVGTTVITVQTLIDHGARRCGKLAGELTSEQVLSSRES
Ga0181363_107896333300017707Freshwater LakeMAYSDTFGQTVNVQTLIDHGARRAGKLAEELTSEQ
Ga0181350_101136273300017716Freshwater LakeMAYSDTFGQTVNVQTLIDHGARRAGKLAEELTSEQLVSARQSLSFLLQN
Ga0181350_102109363300017716Freshwater LakeMSYSGDYGQTVINVQTLIDHGARRCGKLAEELTSEQVLSARQSLYFLL
Ga0181347_116055113300017722Freshwater LakeMAYSGTVSTTVINVQQLIDHGARRCGKLAEELTSEQQ
Ga0181362_102036513300017723Freshwater LakeMAYSDTYGQTVNVQTLIDHGARRCGKLAEELTSEQVVSA
Ga0181365_114446433300017736Freshwater LakeMAYSETYGQTVDVQTLIDHGARRCGKLAEELTSEQV
Ga0181365_117410013300017736Freshwater LakeMAYSGSVGTTVITVQTLIDHGARRCGKLAEELTSEQVLS
Ga0181352_116296423300017747Freshwater LakeMATSGTVGTTVINVQQLIDHGARRCGKLAEELTAEQQVSAREF
Ga0181344_112545113300017754Freshwater LakeMAYSDTYGQTVNVQTLIDHGARRAGKLAEELTSEQLVSARQS
Ga0181344_120875923300017754Freshwater LakeMAYSNTVGQTVLNVQTFIDHGARRCGKLAEELTSEQQLSARESLFILL
Ga0181344_122854533300017754Freshwater LakeMAYSETVGMTVINVQTLIDHGARRCGKLAEELTSEQVLSSRQ
Ga0181356_105279253300017761Freshwater LakeMAYSNSIGTTVITVQTLIDHGARRCGKLAGELTSE
Ga0181356_121295313300017761Freshwater LakeMAYSDTYGQTVDVQTLIDHGARRCGKLAEELTSEQVVSA
Ga0181356_123388813300017761Freshwater LakeMAYSDTYGQTVNVQTLIDHGARRCGKLAEELTSEQVVSARQSLGFLLSN
Ga0181356_125195613300017761Freshwater LakeMAYSDTYGQTVNVQTLIDHGARRCGKLAEELTSEQVVSARQSLG
Ga0181358_109899223300017774Freshwater LakeMSYSGTVGTTVVNVQEVIDHAARRCGKLAEELTSE
Ga0181357_102218313300017777Freshwater LakeMAYSGTVGTTVIDVQTLIDHGARRCGKLAEELTSEQV
Ga0181357_102437413300017777Freshwater LakeMAYSDTFGQTVNVQTLIDHGARRAGKLAEELTSEQLVSARQSLSFLLQNL
Ga0181357_111987243300017777Freshwater LakeMAYSETYGQTVNVQTLIDHGARRCGKLAEELTSEQVL
Ga0181357_113649913300017777Freshwater LakeMAYSDTYGQTYNVQTLIDHGARRCGKLAEELTSEQVLTSRQS
Ga0181357_114565613300017777Freshwater LakeMAYSDTYGQTVNVQTLIDHGARRCGKLAEELTSEQVVSARQSLGFLL
Ga0181357_130826713300017777Freshwater LakeMAYSGTTGTTVTTVQTLIDHGARRCGKLAGELTSEQVLSSRQSLYFLLSN
Ga0181349_120609033300017778Freshwater LakeMAYSGTVGTTVIDVQTLIEHGARRCGKLAEELTSEQQVSARESLFFFLS
Ga0181349_121175113300017778Freshwater LakeMAYSGTVGTTVIDVQTLIDHGARRCGKLAEELTSEQVQSARE
Ga0181346_106037063300017780Freshwater LakeMAYSDTYGQTVNVQTLIDHGARRCGKLAEELTSEQ
Ga0181346_129261423300017780Freshwater LakeMAYSGTVGTTVVNVQEIIDHAARRCGKLAEELTSEQQLTARQ
Ga0181346_131303033300017780Freshwater LakeMAYSDTYGQTVNVQTLIDHGARRCGKLAEELTSEQVVSAR
Ga0181348_106381913300017784Freshwater LakeMAYSDTYGQTYNVQTLIDHGARRCGKLAEELTSEQVVSARQS
Ga0181348_109431113300017784Freshwater LakeMAYSDTYGQTVNVQTLIDHGARRCGKLAEELTSEQVVSARQSL
Ga0181348_126652813300017784Freshwater LakeMAYSGTTGTTVTTVQTLIDHGARRCGKLAGELTSEQVL
Ga0181355_114163143300017785Freshwater LakeMAYSDTYGQTVNVQTLIDHGARRCGKLAEELTSEQVVSARQSLGFLLSNL
Ga0181355_130423413300017785Freshwater LakeMYSGTVGTTVISVQQLIDHGARRCGKLAEELTSEQ
Ga0181360_11158533300019781Freshwater LakeMSYSGTVGTTVVNVQEIIDHAARRCGKLAEELTSEQQLTA
Ga0181360_11696513300019781Freshwater LakeMAYSGTVGTTVIDVQTLIDHGARRCGKLAEELTSEQVQSARESLYFF
Ga0181359_109477643300019784Freshwater LakeMAYSNSVGTTVITVQTLIDHGARRCGKLAGELTSEQVLSS
Ga0194134_1026173333300020179Freshwater LakeMAFSDTYGQVYKVQVLIDHAARRCGKLAEELTSEQLVT
Ga0194121_1048957423300020200Freshwater LakeMAYSGTVGATTISVQTLIDHGARRCGKLAEELTSEQVLS
Ga0211731_1007542013300020205FreshwaterMAYSGTVGTTVVNVQELVDHAARRCGKLAEELTSEQQLTARQSLFYFLSS
Ga0194123_1013307643300021093Freshwater LakeMAYSGTTGTTVISVQTLIDHGARRCGKLAEELTSEQVLSARESLFYVLS
Ga0194117_1051220523300021424Freshwater LakeMAYSGTTGTTVISVQTLIDHGARRCGKLAEELTSEQ
Ga0222714_1031694033300021961Estuarine WaterMAYSETYGQTVNVQTLIDHGARRCGKLAEELTSEQVVSARQSL
Ga0181353_106668133300022179Freshwater LakeMAYSDTYGQTVNVQTLIDHGARRAGKLAEELTSEQLVS
Ga0181353_107329513300022179Freshwater LakeMAYSGTYGETIINVQDFIDHGARRCGKLAEELTSEQILSARQSLY
Ga0181354_111364243300022190Freshwater LakeMAYSGTVGTTVIDVQTLIDHGARRCGKLAEELTSEQVLSARD
Ga0181351_110279213300022407Freshwater LakeMAYSDTYGQTVNVQTLIDHGARRCGKLAEELTSEQVASARQSLGFLLSNLI
Ga0181351_113639243300022407Freshwater LakeMAYSDTYGQTVNVQTLIDHGARRCGKLAEELTSEQVVSARQ
Ga0181351_120825213300022407Freshwater LakeMAYSDTYGQTVNVQTLIDHGARRCGKLAEELTSEQVVS
Ga0181351_121564123300022407Freshwater LakeMAYSDTYGQTVNVQTLIDHGARRAGKLAEELTSEQLV
Ga0181351_126704423300022407Freshwater LakeMAYSDTFGQTVNVQTLIDHGARRAGKLAEELTSEQLVSARQSLSF
Ga0255783_1039629323300022923Salt MarshMAYSGTVGTTVITVQTLIDHGARRCGKLAEELTSEQVLSARES
Ga0255752_1029597433300022929Salt MarshMSYSDTYGQVFNVQTLIDHAARRCGKLAEELTSEQLLT
Ga0208380_106270723300025392FreshwaterMAYSGTVGNTVINVQTLIDHGARRAGKLAEELTDEQTQSAKESLFYILSN
Ga0208784_100938513300025732AqueousMAYSGTVGTTVIQVQTLIDHGARRCGKLAEELTSEQVLSARESLFF
Ga0208783_1004802263300025872AqueousMAYSDTYGQTVNVQTLIDHGARRAGKLAEELTSEQLVASRQ
Ga0255240_104637313300026568FreshwaterMAYSDTYGQTYNVQTLIDHGARRCGKLAEELTSEQVLSSRQSLGFLLSNLI
Ga0255117_109802813300027600FreshwaterMAYSDTYGQTVNVQTLIDHGARRCGKLAEELTSEQVLSARQSLGFLLSD
Ga0208974_107203113300027608Freshwater LenticMAYSDTYGQTVNVQTLIDHGARRCGKLAEELTSEQVVSARQSLGFLLSD
Ga0209357_117608533300027656Freshwater LakeMAYSDTYGQTVNVQTLIDHGARRCGKLAEELTSEQV
Ga0209355_124569233300027744Freshwater LakeMAYSDTYGQTVDVQTLIDHGARRCGKLAEELTSEQVVSARQSLGF
Ga0209355_124825213300027744Freshwater LakeMAYSNTVGQTVLNVQTFIDHGARRCGKLAEELTSEQQLS
Ga0209596_106019143300027754Freshwater LakeMSTSGTFGQTVIDVQTLIDHGARRCGKLAEELTSEQQ
Ga0209596_125476723300027754Freshwater LakeMAYSGSVGTTVITVQTLIDHGARRCGKLAEELTSE
Ga0209770_1015757713300027769Freshwater LakeMAYSGTIGQTVISVQTLIDHGARRCGKLAEELTSEQLLSARESLYFLLS
Ga0209768_1003124463300027772Freshwater LakeMAYSGTVGTTVIDVQTLIDHGARRCGKLAEELTSEQVLSARESL
Ga0209353_1015674143300027798Freshwater LakeMAYSETYGQTVNVQTLIDHGARRCGKLAEELTSEQVLSARQSLG
Ga0209358_1055216213300027804Freshwater LakeMAYSGTVSTTVINVQELIDHGARRCGKLAEELTSEQQVASRQSLYFL
Ga0307377_1060186113300031673SoilMAYSGTVGTTVVNVQELVDHAARRCGKLAEELTSEQQLT
Ga0315291_1141353823300031707SedimentMAYSGTIGQTVISVQTLIDHGARRCGKLAEELAVEQVQS
Ga0315907_1124898413300031758FreshwaterMAYSDTYGQVFNVQTLIDHAARRCGKLAEELTSEQLVTA
Ga0315904_1060410943300031951FreshwaterMAYSDTYGQTVNVQTLIDHGARRCGKLAEELTSEQVLSA
Ga0315901_1079316413300031963FreshwaterMAYSDTYGQTVNVQTLIDHGARRAGKLAEELTSEQLVSARQSLSF
Ga0315284_1228234513300032053SedimentMATSGTVGATVIDVQQLIDHGARRCGKLAEELTSEQQTSAR
Ga0315905_1091722633300032092FreshwaterMAYSGSVGTTVITVQTLIDHGARRCGKLAEELTSEQVLSA
Ga0315903_1081595213300032116FreshwaterMAYSGSVGTTVVTVQTLIDHGARRCGKLAEELTSEQVLSARES
Ga0316232_126193323300032605FreshwaterMAYSGTVGNTVISVQTLIDHGARRAGKLAEELTDEQVQ
Ga0316625_10222456923300033418SoilMAYSGTVGTTVIQVQTLIDHGARRAGKVAEELTSEQVL
Ga0316621_1145702123300033488SoilMAYSGTVGTTVIQVQTLIDHGARRAGKVAEELTSEQVLSARQS
Ga0334982_0135016_1158_12683300033981FreshwaterMAYSDTYGQVYNVQTLIDHGARRCGKLAEELTSEQLL
Ga0335023_0603306_1_1293300034050FreshwaterMAYSGTFGQTVITVQTLIDHGARRCGKLAEELTSEQLLSARES
Ga0335012_0185044_3_1253300034093FreshwaterMAYSDTYGQTVNVQTLIDHGARRAGKLAEELTSEQLVSARQ
Ga0335025_0569661_3_1163300034096FreshwaterMSYSGSVGTTVINVQTLIDHGARRCGKLAEELTSEQLL
Ga0335068_0320805_2_1153300034116FreshwaterMAYSGTVGTTVINTQKLIDHGARRCGKLAEELTAEQIL
Ga0335053_0756299_2_1423300034118FreshwaterMAYSDTYGQTVNVQTLIDHGARRAGKLAEELTSEQLVSARQSLGFLL
Ga0335052_0656288_1_1173300034279FreshwaterMAYSDTYGQVYNIQTLIDHGARRCGKLAEELTSEQLLSA
Ga0335039_0407384_579_6953300034355FreshwaterMAYSDTYGQVFNVQTLIDHAARRCGKLAEELTSEQVVAA
Ga0348335_030532_2262_23813300034374AqueousMAYSDTYGQVYNVQTLIDHGARRCGKLAEELTSEQILSAR


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.