| Basic Information | |
|---|---|
| Family ID | F062562 |
| Family Type | Metagenome |
| Number of Sequences | 130 |
| Average Sequence Length | 45 residues |
| Representative Sequence | MPYQEFRKLFEQRPEPSRWQRITLGSSIKWALAGGLCVIAVLLVR |
| Number of Associated Samples | 87 |
| Number of Associated Scaffolds | 130 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 45.38 % |
| % of genes near scaffold ends (potentially truncated) | 51.54 % |
| % of genes from short scaffolds (< 2000 bps) | 83.85 % |
| Associated GOLD sequencing projects | 78 |
| AlphaFold2 3D model prediction | No |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (67.692 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil (31.539 % of family members) |
| Environment Ontology (ENVO) | Unclassified (50.769 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (56.923 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 48.89% β-sheet: 13.33% Coil/Unstructured: 37.78% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 130 Family Scaffolds |
|---|---|---|
| PF01740 | STAS | 9.23 |
| PF10987 | DUF2806 | 2.31 |
| PF03301 | Trp_dioxygenase | 2.31 |
| PF08530 | PepX_C | 2.31 |
| PF13466 | STAS_2 | 1.54 |
| PF00924 | MS_channel | 1.54 |
| PF00561 | Abhydrolase_1 | 0.77 |
| PF02353 | CMAS | 0.77 |
| PF08241 | Methyltransf_11 | 0.77 |
| PF00069 | Pkinase | 0.77 |
| PF14534 | DUF4440 | 0.77 |
| PF01965 | DJ-1_PfpI | 0.77 |
| PF02796 | HTH_7 | 0.77 |
| PF03631 | Virul_fac_BrkB | 0.77 |
| PF00563 | EAL | 0.77 |
| PF06537 | DHOR | 0.77 |
| PF14559 | TPR_19 | 0.77 |
| PF07238 | PilZ | 0.77 |
| PF13620 | CarboxypepD_reg | 0.77 |
| PF13545 | HTH_Crp_2 | 0.77 |
| PF00196 | GerE | 0.77 |
| COG ID | Name | Functional Category | % Frequency in 130 Family Scaffolds |
|---|---|---|---|
| COG0515 | Serine/threonine protein kinase | Signal transduction mechanisms [T] | 3.08 |
| COG2936 | Predicted acyl esterase | General function prediction only [R] | 2.31 |
| COG3483 | Tryptophan 2,3-dioxygenase (vermilion) | Amino acid transport and metabolism [E] | 2.31 |
| COG0668 | Small-conductance mechanosensitive channel | Cell wall/membrane/envelope biogenesis [M] | 1.54 |
| COG3264 | Small-conductance mechanosensitive channel MscK | Cell wall/membrane/envelope biogenesis [M] | 1.54 |
| COG1295 | Uncharacterized membrane protein, BrkB/YihY/UPF0761 family (not an RNase) | Function unknown [S] | 0.77 |
| COG2200 | EAL domain, c-di-GMP-specific phosphodiesterase class I (or its enzymatically inactive variant) | Signal transduction mechanisms [T] | 0.77 |
| COG2226 | Ubiquinone/menaquinone biosynthesis C-methylase UbiE/MenG | Coenzyme transport and metabolism [H] | 0.77 |
| COG2227 | 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4-benzoquinol methylase | Coenzyme transport and metabolism [H] | 0.77 |
| COG2230 | Cyclopropane fatty-acyl-phospholipid synthase and related methyltransferases | Lipid transport and metabolism [I] | 0.77 |
| COG3434 | c-di-GMP phosphodiesterase YuxH/PdeH, contains EAL and HDOD domains | Signal transduction mechanisms [T] | 0.77 |
| COG3488 | Uncharacterized conserved protein with two CxxC motifs, DUF1111 family | General function prediction only [R] | 0.77 |
| COG4943 | Redox-sensing c-di-GMP phosphodiesterase, contains CSS-motif and EAL domains | Signal transduction mechanisms [T] | 0.77 |
| COG5001 | Cyclic di-GMP metabolism protein, combines GGDEF and EAL domains with a 6TM membrane domain | Signal transduction mechanisms [T] | 0.77 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 67.69 % |
| Unclassified | root | N/A | 32.31 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2032320005|FACEOR_FY84VJD01DWE7E | Not Available | 529 | Open in IMG/M |
| 3300002558|JGI25385J37094_10021555 | Not Available | 2298 | Open in IMG/M |
| 3300002561|JGI25384J37096_10086605 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1121 | Open in IMG/M |
| 3300002909|JGI25388J43891_1002860 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 3569 | Open in IMG/M |
| 3300002911|JGI25390J43892_10089389 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 690 | Open in IMG/M |
| 3300005166|Ga0066674_10063567 | Not Available | 1682 | Open in IMG/M |
| 3300005171|Ga0066677_10428458 | Not Available | 756 | Open in IMG/M |
| 3300005171|Ga0066677_10706708 | Not Available | 563 | Open in IMG/M |
| 3300005172|Ga0066683_10081473 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1950 | Open in IMG/M |
| 3300005172|Ga0066683_10324107 | Not Available | 957 | Open in IMG/M |
| 3300005172|Ga0066683_10443818 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 796 | Open in IMG/M |
| 3300005172|Ga0066683_10633514 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 643 | Open in IMG/M |
| 3300005179|Ga0066684_10778338 | Not Available | 634 | Open in IMG/M |
| 3300005180|Ga0066685_10667770 | Not Available | 714 | Open in IMG/M |
| 3300005180|Ga0066685_10779546 | Not Available | 649 | Open in IMG/M |
| 3300005181|Ga0066678_11029593 | Not Available | 532 | Open in IMG/M |
| 3300005439|Ga0070711_101163761 | Not Available | 666 | Open in IMG/M |
| 3300005447|Ga0066689_10302911 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 991 | Open in IMG/M |
| 3300005447|Ga0066689_10565286 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 718 | Open in IMG/M |
| 3300005467|Ga0070706_100676620 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 958 | Open in IMG/M |
| 3300005467|Ga0070706_101794538 | Not Available | 558 | Open in IMG/M |
| 3300005468|Ga0070707_101777854 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 584 | Open in IMG/M |
| 3300005471|Ga0070698_100661956 | Not Available | 985 | Open in IMG/M |
| 3300005536|Ga0070697_100266546 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1467 | Open in IMG/M |
| 3300005536|Ga0070697_100271224 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1454 | Open in IMG/M |
| 3300005536|Ga0070697_100511856 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Acidobacteriales bacterium 13_2_20CM_55_8 | 1050 | Open in IMG/M |
| 3300005536|Ga0070697_100603769 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 965 | Open in IMG/M |
| 3300005536|Ga0070697_100630042 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 944 | Open in IMG/M |
| 3300005536|Ga0070697_101111446 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 703 | Open in IMG/M |
| 3300005540|Ga0066697_10064349 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2097 | Open in IMG/M |
| 3300005552|Ga0066701_10620311 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 656 | Open in IMG/M |
| 3300005554|Ga0066661_10217012 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1185 | Open in IMG/M |
| 3300005555|Ga0066692_10119427 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1587 | Open in IMG/M |
| 3300005555|Ga0066692_10553064 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii | 727 | Open in IMG/M |
| 3300005558|Ga0066698_10149025 | All Organisms → cellular organisms → Bacteria | 1579 | Open in IMG/M |
| 3300005559|Ga0066700_11042750 | Not Available | 536 | Open in IMG/M |
| 3300005568|Ga0066703_10388793 | Not Available | 836 | Open in IMG/M |
| 3300005569|Ga0066705_10033286 | All Organisms → cellular organisms → Bacteria | 2789 | Open in IMG/M |
| 3300005569|Ga0066705_10661541 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 634 | Open in IMG/M |
| 3300005574|Ga0066694_10211025 | Not Available | 921 | Open in IMG/M |
| 3300006028|Ga0070717_10019479 | All Organisms → cellular organisms → Bacteria | 5321 | Open in IMG/M |
| 3300006028|Ga0070717_10147947 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → Methylomagnum → Methylomagnum ishizawai | 2030 | Open in IMG/M |
| 3300006028|Ga0070717_10237754 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1605 | Open in IMG/M |
| 3300006028|Ga0070717_11132604 | Not Available | 712 | Open in IMG/M |
| 3300006032|Ga0066696_10151590 | All Organisms → cellular organisms → Bacteria | 1446 | Open in IMG/M |
| 3300006032|Ga0066696_10925226 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 555 | Open in IMG/M |
| 3300006804|Ga0079221_10174731 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1151 | Open in IMG/M |
| 3300006852|Ga0075433_11335305 | Not Available | 621 | Open in IMG/M |
| 3300006854|Ga0075425_101528171 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 753 | Open in IMG/M |
| 3300007076|Ga0075435_100473984 | Not Available | 1081 | Open in IMG/M |
| 3300007076|Ga0075435_100654761 | All Organisms → cellular organisms → Bacteria | 912 | Open in IMG/M |
| 3300009012|Ga0066710_104425764 | Not Available | 525 | Open in IMG/M |
| 3300009137|Ga0066709_102534333 | Not Available | 690 | Open in IMG/M |
| 3300009137|Ga0066709_102762656 | Not Available | 653 | Open in IMG/M |
| 3300009137|Ga0066709_103704595 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 555 | Open in IMG/M |
| 3300010048|Ga0126373_10269163 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1685 | Open in IMG/M |
| 3300010048|Ga0126373_10561092 | All Organisms → cellular organisms → Bacteria | 1191 | Open in IMG/M |
| 3300010301|Ga0134070_10061449 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7 | 1274 | Open in IMG/M |
| 3300010323|Ga0134086_10030621 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1770 | Open in IMG/M |
| 3300010329|Ga0134111_10003351 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 4850 | Open in IMG/M |
| 3300010358|Ga0126370_10798766 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 841 | Open in IMG/M |
| 3300010366|Ga0126379_10208202 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1888 | Open in IMG/M |
| 3300011269|Ga0137392_11612225 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 507 | Open in IMG/M |
| 3300012096|Ga0137389_11043264 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 701 | Open in IMG/M |
| 3300012189|Ga0137388_10452402 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1191 | Open in IMG/M |
| 3300012189|Ga0137388_10570905 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1051 | Open in IMG/M |
| 3300012198|Ga0137364_10408625 | Not Available | 1016 | Open in IMG/M |
| 3300012199|Ga0137383_10060122 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2727 | Open in IMG/M |
| 3300012199|Ga0137383_10274930 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1234 | Open in IMG/M |
| 3300012199|Ga0137383_10415605 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 985 | Open in IMG/M |
| 3300012202|Ga0137363_11127606 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 667 | Open in IMG/M |
| 3300012207|Ga0137381_10169478 | Not Available | 1885 | Open in IMG/M |
| 3300012207|Ga0137381_11701528 | Not Available | 521 | Open in IMG/M |
| 3300012208|Ga0137376_10255673 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1519 | Open in IMG/M |
| 3300012209|Ga0137379_10835323 | Not Available | 826 | Open in IMG/M |
| 3300012211|Ga0137377_10299737 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1542 | Open in IMG/M |
| 3300012211|Ga0137377_11874648 | Not Available | 517 | Open in IMG/M |
| 3300012285|Ga0137370_10984325 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 520 | Open in IMG/M |
| 3300012349|Ga0137387_11329209 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 502 | Open in IMG/M |
| 3300012354|Ga0137366_10306034 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1169 | Open in IMG/M |
| 3300012356|Ga0137371_10074287 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2634 | Open in IMG/M |
| 3300012356|Ga0137371_10200014 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1565 | Open in IMG/M |
| 3300012356|Ga0137371_10525840 | Not Available | 912 | Open in IMG/M |
| 3300012356|Ga0137371_10812593 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 712 | Open in IMG/M |
| 3300012357|Ga0137384_10653424 | Not Available | 856 | Open in IMG/M |
| 3300012359|Ga0137385_10457113 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1083 | Open in IMG/M |
| 3300012359|Ga0137385_10966939 | Not Available | 703 | Open in IMG/M |
| 3300012362|Ga0137361_10211448 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1757 | Open in IMG/M |
| 3300012532|Ga0137373_10505098 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 923 | Open in IMG/M |
| 3300012929|Ga0137404_10055950 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 3043 | Open in IMG/M |
| 3300012929|Ga0137404_10267573 | Not Available | 1472 | Open in IMG/M |
| 3300012972|Ga0134077_10011191 | Not Available | 2930 | Open in IMG/M |
| 3300012972|Ga0134077_10536922 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 522 | Open in IMG/M |
| 3300015358|Ga0134089_10022844 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2152 | Open in IMG/M |
| 3300015358|Ga0134089_10073509 | All Organisms → cellular organisms → Bacteria | 1279 | Open in IMG/M |
| 3300018433|Ga0066667_10470685 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1030 | Open in IMG/M |
| 3300018433|Ga0066667_10649049 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 882 | Open in IMG/M |
| 3300018468|Ga0066662_11582768 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 683 | Open in IMG/M |
| 3300018482|Ga0066669_10550568 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1005 | Open in IMG/M |
| 3300025910|Ga0207684_10222269 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1630 | Open in IMG/M |
| 3300025922|Ga0207646_10499163 | Not Available | 1096 | Open in IMG/M |
| 3300025922|Ga0207646_10832765 | Not Available | 821 | Open in IMG/M |
| 3300025929|Ga0207664_11375381 | Not Available | 626 | Open in IMG/M |
| 3300025939|Ga0207665_10654922 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 823 | Open in IMG/M |
| 3300026295|Ga0209234_1192042 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 702 | Open in IMG/M |
| 3300026297|Ga0209237_1035935 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2644 | Open in IMG/M |
| 3300026297|Ga0209237_1147618 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 921 | Open in IMG/M |
| 3300026298|Ga0209236_1063984 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1772 | Open in IMG/M |
| 3300026298|Ga0209236_1065827 | Not Available | 1738 | Open in IMG/M |
| 3300026306|Ga0209468_1000953 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 13099 | Open in IMG/M |
| 3300026306|Ga0209468_1055697 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1335 | Open in IMG/M |
| 3300026306|Ga0209468_1138983 | Not Available | 667 | Open in IMG/M |
| 3300026309|Ga0209055_1126445 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 955 | Open in IMG/M |
| 3300026310|Ga0209239_1006807 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 6330 | Open in IMG/M |
| 3300026314|Ga0209268_1134397 | Not Available | 611 | Open in IMG/M |
| 3300026324|Ga0209470_1024684 | All Organisms → cellular organisms → Bacteria | 3179 | Open in IMG/M |
| 3300026324|Ga0209470_1036168 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2484 | Open in IMG/M |
| 3300026324|Ga0209470_1125720 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7 | 1136 | Open in IMG/M |
| 3300026325|Ga0209152_10008215 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 3689 | Open in IMG/M |
| 3300026327|Ga0209266_1005940 | All Organisms → cellular organisms → Bacteria | 7306 | Open in IMG/M |
| 3300026332|Ga0209803_1057884 | Not Available | 1688 | Open in IMG/M |
| 3300026333|Ga0209158_1368666 | Not Available | 501 | Open in IMG/M |
| 3300026524|Ga0209690_1008664 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 5545 | Open in IMG/M |
| 3300026532|Ga0209160_1338453 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 515 | Open in IMG/M |
| 3300026538|Ga0209056_10061890 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 3268 | Open in IMG/M |
| 3300026538|Ga0209056_10577863 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 568 | Open in IMG/M |
| 3300026542|Ga0209805_1351966 | Not Available | 561 | Open in IMG/M |
| 3300027882|Ga0209590_10448603 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 834 | Open in IMG/M |
| 3300031820|Ga0307473_10337889 | Not Available | 963 | Open in IMG/M |
| 3300032205|Ga0307472_100316520 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1263 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 31.54% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 23.08% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 14.62% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 13.85% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 5.38% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 3.08% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 3.08% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.54% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 1.54% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.77% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.77% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.77% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2032320005 | Soil microbial communities from sample at FACE Site 5 Oak Ridge CO2- | Environmental | Open in IMG/M |
| 3300002558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_40cm | Environmental | Open in IMG/M |
| 3300002561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_40cm | Environmental | Open in IMG/M |
| 3300002909 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_2_20cm | Environmental | Open in IMG/M |
| 3300002911 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cm | Environmental | Open in IMG/M |
| 3300005166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123 | Environmental | Open in IMG/M |
| 3300005171 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 | Environmental | Open in IMG/M |
| 3300005172 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 | Environmental | Open in IMG/M |
| 3300005179 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 | Environmental | Open in IMG/M |
| 3300005180 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 | Environmental | Open in IMG/M |
| 3300005181 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 | Environmental | Open in IMG/M |
| 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
| 3300005447 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 | Environmental | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
| 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
| 3300005540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 | Environmental | Open in IMG/M |
| 3300005552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 | Environmental | Open in IMG/M |
| 3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
| 3300005555 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 | Environmental | Open in IMG/M |
| 3300005558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 | Environmental | Open in IMG/M |
| 3300005559 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 | Environmental | Open in IMG/M |
| 3300005568 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 | Environmental | Open in IMG/M |
| 3300005569 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 | Environmental | Open in IMG/M |
| 3300005574 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143 | Environmental | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006032 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 | Environmental | Open in IMG/M |
| 3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010301 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09082015 | Environmental | Open in IMG/M |
| 3300010323 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010329 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_11112015 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
| 3300012354 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012532 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012972 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300015358 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026295 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026297 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026298 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026306 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 (SPAdes) | Environmental | Open in IMG/M |
| 3300026309 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 (SPAdes) | Environmental | Open in IMG/M |
| 3300026310 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026314 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143 (SPAdes) | Environmental | Open in IMG/M |
| 3300026324 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 (SPAdes) | Environmental | Open in IMG/M |
| 3300026325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 (SPAdes) | Environmental | Open in IMG/M |
| 3300026327 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 (SPAdes) | Environmental | Open in IMG/M |
| 3300026332 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 (SPAdes) | Environmental | Open in IMG/M |
| 3300026333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 (SPAdes) | Environmental | Open in IMG/M |
| 3300026524 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 (SPAdes) | Environmental | Open in IMG/M |
| 3300026532 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 (SPAdes) | Environmental | Open in IMG/M |
| 3300026538 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes) | Environmental | Open in IMG/M |
| 3300026542 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 (SPAdes) | Environmental | Open in IMG/M |
| 3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| FACEORA_6589460 | 2032320005 | Soil | MSYQEFRKLFEQRPEPSRWQRITLGSSIKWALAGGLCIIAVLLVR |
| JGI25385J37094_100215555 | 3300002558 | Grasslands Soil | MPYQEFRKLFEQRPEPSRWQRITLGSSIKWALAGGLCVIAVLLVR* |
| JGI25384J37096_100866053 | 3300002561 | Grasslands Soil | VYGEKKGKMPYEEFRKLFEQRPEPNRWQKIRLGSSIKWALAGGLCVIAVLLMR* |
| JGI25388J43891_10028605 | 3300002909 | Grasslands Soil | MPYQKFRKLFEQRPEPSRWQRITLGSPIKWALAGGLCIIAVLLVR* |
| JGI25390J43892_100893891 | 3300002911 | Grasslands Soil | MPYQEFRKLFEQRPEPSRWQRITLGSSIKWALAGGLCVIAALLVR* |
| Ga0066674_100635672 | 3300005166 | Soil | MPYEEFRKLFEQRPEPNRWQKIRLGSSIKWALAGGLCVIAVLLMR* |
| Ga0066677_104284581 | 3300005171 | Soil | EKKGKMPYEEFRKLFEQRPEPNRWQKIRLGSSIKWALAGGLCVIAVLLMR* |
| Ga0066677_107067081 | 3300005171 | Soil | MPYQKFRKLFEQRPEPSRWQRITLGSSIKWALAGGLCIIAVLLAR* |
| Ga0066683_100814733 | 3300005172 | Soil | MPYQEFRKLFEQRPEPSRWQRIRLGSSIKWALAGGLCIIAVLLVR* |
| Ga0066683_103241072 | 3300005172 | Soil | MPYEEFRKLFEQRPEPNRWQKIRLGSSIKWALAGGLCVIAVR* |
| Ga0066683_104438181 | 3300005172 | Soil | MPYQEFRKLFEQRPEPSRWQRITLGSSIKWALAGGLCIIAVLLVR* |
| Ga0066683_106335142 | 3300005172 | Soil | KMPYQKFRKLFEQRPEPSRWQRITLGSSIKWALAGGLCVIAVLLVR* |
| Ga0066684_107783381 | 3300005179 | Soil | MPYEEFRKLFEQRPEPNRWQKIRLGSSIKWALAGGLCVIAVLLM |
| Ga0066685_106677701 | 3300005180 | Soil | MPYEEFRKLFEQRPEPNRWQKIRLGSSIKWALAGGLCVIAV |
| Ga0066685_107795462 | 3300005180 | Soil | YEEFRKLFEQRPEPNRWQKIRLGSSIKWALAGGLCVIAVR* |
| Ga0066678_110295932 | 3300005181 | Soil | MPYEEFRKLFEQRPEPNRWQRIRLGSSIKWALAGGLCVIAVLLMR* |
| Ga0070711_1011637613 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | GKMPYEEFRKLFEQRPEPSRWQRITLGSSIKWALAGGLCVIAVLLMR* |
| Ga0066689_103029111 | 3300005447 | Soil | EKKGKMPYEEFRKLFEQRPEPNRWQRIRLGSSIKWAPAGGLCVIAVLLMR* |
| Ga0066689_105652861 | 3300005447 | Soil | FRKLFEQRPEPSRWQRITLGSSIKWALAGGLCIIAVLLAR* |
| Ga0070706_1006766201 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | MPYQKFRKLFEQRPEPSRWQRITLGSSIKWALAGGLCVIAVLLLR* |
| Ga0070706_1017945381 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | EKKGKMPYEEFRKLFEQRPEPNRWQRIRLGSSIKWALAGGLCVIAVLLMR* |
| Ga0070707_1017778542 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | MPYQKFRKLFEQRPEPSRWQRITLGSSIKWALAGGLCIIAVLLVR* |
| Ga0070698_1006619563 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | EFRKLFEQRPEPSRWQRITLGSSIKWALVGGLCVIAVLLMR* |
| Ga0070697_1002665462 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | MPYEEFRKLFEQRPEPSRWQRITLGSSIKWALVGGLCVIAVLLMR* |
| Ga0070697_1002712241 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | EFRKLFEQRPEPSRWQRITLGNSMKWALAGGLCIIAVLLVR* |
| Ga0070697_1005118561 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | MPYEEFRKLFEQRPEPGRWQRIRLGSATKWALAGGLCVVVVLLVVR* |
| Ga0070697_1006037691 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | QKFRKLFEQRPEPSRWQRITLGSSIKWALAGGLCVIAVLLVR* |
| Ga0070697_1006300422 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | MPYEEFRKLFEQCPEPSRWQRIRLGSAMKWALAGGLCVIAVLLVR* |
| Ga0070697_1011114462 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | MPYQKFRKLFEQRPEPSRWQRITLGSSIKWAMAIAVLLRGEAEPIP* |
| Ga0066697_100643491 | 3300005540 | Soil | MGRIRKMPYQKFRKLFEQRPEPSRWQRITLGSSIKWALAGGLCIIAVLLAR* |
| Ga0066701_106203112 | 3300005552 | Soil | LFEQRPEPSRWQRIRLGSSIKWALAGGLCIIAVLLVR* |
| Ga0066661_102170122 | 3300005554 | Soil | MPYEEFRKLFEQRPEIRPRFWQRITLGSSIKWALAGGLCVIAVLLVR* |
| Ga0066692_101194271 | 3300005555 | Soil | MPYEEFRKLFEQRPEPGRWQRITLGSSIKWALAGGLCIIAVLL |
| Ga0066692_105530642 | 3300005555 | Soil | MGESEKMPYQEFRKLFEQRPEPSRWQRITLGSSIKWALAGGLCIIAVLLVR* |
| Ga0066698_101490252 | 3300005558 | Soil | MPYEEFRKLFEQRPEPNRWQRIRLGSSIKWAPAGGLCVIAVLLMR* |
| Ga0066700_110427501 | 3300005559 | Soil | MPYQEFRKLFEQRAEPGRWQRIRLGSSTKWALAGLLCVVACS* |
| Ga0066703_103887933 | 3300005568 | Soil | MPYEEFRKLFEQRPEPNRWQRIKLGSSIKWALAGGLCVIAVLLMR* |
| Ga0066705_100332863 | 3300005569 | Soil | MPYQELRKLFEQRPEPSRWQRIRLGSSIKWALAGGLCVIAVLLVR* |
| Ga0066705_106615412 | 3300005569 | Soil | MPYQKFRQLFEQRPPEPSRWQRITLGSSIKWALAGGLCVIAVLLAR* |
| Ga0066694_102110252 | 3300005574 | Soil | MPYEEFRKLFKQRPEPNRWQRIRLGSSIKWALAGGLCVIAVLLMR* |
| Ga0070717_100194798 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MPYQKFRKLFEQRPEPSRWQRITLGSSIKWALAGGLCVIAVLLVR* |
| Ga0070717_101479472 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MPYQEFRKLFEQRPEPSRWQRIRLGSSIKWALAVGLCVIAVLLVR* |
| Ga0070717_102377542 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MPYEEFRKLFQQRPKPNRWQRIILGSSIKWAVVGGLCIIAVLLVVR* |
| Ga0070717_111326042 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MPYREFRKLFEQRPEPSRWQRITLGSSIKWALAGGLCVIAVLLAAR* |
| Ga0066696_101515903 | 3300006032 | Soil | MPYQELRKLFEQRPEPSRWQRIRLGSSIKWALAGGLCVIAVL |
| Ga0066696_109252261 | 3300006032 | Soil | EFRKLFEQRPEPSRWQRIRLGSSIKWALAGGLCIIAVLLVR* |
| Ga0079221_101747312 | 3300006804 | Agricultural Soil | MPYEEFRKLFEQRPEPGRWQRIRLGSAVKWTLAGGLCVVAVLLVR* |
| Ga0075433_113353053 | 3300006852 | Populus Rhizosphere | EKKGKMPYEEFRKLFEQHPEPSRWQRIRLGSSIKWALAGGLCVIAALLTR* |
| Ga0075425_1015281712 | 3300006854 | Populus Rhizosphere | MPYEEFRKLFEQRPEPSRWQRITLGSAIRWALAGGLCVIGLLMR* |
| Ga0075435_1004739842 | 3300007076 | Populus Rhizosphere | MPYEEFRKLFEQHPEPSRWQRIRLGSSIKWALAGGLCVIAVLLMR* |
| Ga0075435_1006547611 | 3300007076 | Populus Rhizosphere | FRKLFEQRPEPSRWQRITLGSSIKWAVAGGVCVIAVLLVR* |
| Ga0066710_1044257641 | 3300009012 | Grasslands Soil | MGESEKMPYQEFRKLFEQRPEPSRWQRITLGSPIKWALAGGLCIIAVLLVR |
| Ga0066709_1025343332 | 3300009137 | Grasslands Soil | GEKKGKMPYEEFRKLFEQRPEPNRWQKIRLGSSIKWALAGGLCVIAVLLMR* |
| Ga0066709_1027626562 | 3300009137 | Grasslands Soil | PYEEFRKLFEQRPEPNRWQKIRLGSSIKWALAGGLCVIAVR* |
| Ga0066709_1037045951 | 3300009137 | Grasslands Soil | MPYQEFRKLFEQRPEPGRWQRITLGSSIKWALAGGLCIIAVLLAR* |
| Ga0126373_102691632 | 3300010048 | Tropical Forest Soil | MPYEEFRKLFENRPEPNRWQRIALGNSIKWALAGLLCVIAVLLVR* |
| Ga0126373_105610923 | 3300010048 | Tropical Forest Soil | FENRPEPKRWQRIQLGNSIKWALAGLLCIIAVLLVR* |
| Ga0134070_100614494 | 3300010301 | Grasslands Soil | QEFRKLFEQRPEPSRWQRITLGSSIKWALAGGLCIIAVLLVR* |
| Ga0134086_100306215 | 3300010323 | Grasslands Soil | QKFRKLFEQRPEPSRWQRITLGSPIKWALAGGLCIIAVLLVR* |
| Ga0134111_100033518 | 3300010329 | Grasslands Soil | PYQEFRKLFEQRPEPSRWQRITLGSSIKWALAGGLCLIAVLLVR* |
| Ga0126370_107987661 | 3300010358 | Tropical Forest Soil | MPYEEFRKLFENRPEPNRWHRIALGNSIKWALAGLLCVIAVLLAR* |
| Ga0126379_102082022 | 3300010366 | Tropical Forest Soil | MPYEEFRKLFENRPEPKRWQRIQLGNSIKWALAGLLCIIAVLLVR* |
| Ga0137392_116122251 | 3300011269 | Vadose Zone Soil | MGESEKMPYQEFRKLFEQRPKPSRWQRTTLGSSIKWALAGGLCVIALLLVR* |
| Ga0137389_110432641 | 3300012096 | Vadose Zone Soil | MGESEKMPYQEFRKLFEQRPKPSRWQRTTLGSSIKWALAGGLCVIAVLLAR* |
| Ga0137388_104524022 | 3300012189 | Vadose Zone Soil | MGESEKMPYQEFRKLFDQRPKPSRWQRTTLGSSIKWALAGGLCVIALLLVR* |
| Ga0137388_105709052 | 3300012189 | Vadose Zone Soil | MPYQEFRKLFEQRPEPGRWQRITLGSSIKWALAGGLCVIAVLLAR* |
| Ga0137364_104086251 | 3300012198 | Vadose Zone Soil | KMPYQEFRKLFEQRPEPSRWQRITLGSSIKWALAGGLCIIAVLLVR* |
| Ga0137383_100601226 | 3300012199 | Vadose Zone Soil | FRKLFEQRPEPSRWQRIRLGSSIKWALAGGLCIIAVLLVR* |
| Ga0137383_102749301 | 3300012199 | Vadose Zone Soil | MPYQEFRKLFEQRPEPSRWQRITLGSSIKWALAGGL |
| Ga0137383_104156052 | 3300012199 | Vadose Zone Soil | MPYQKFRKLFEQRPEPSRWQRITLGSSIKWALAGGLCIIA |
| Ga0137363_111276062 | 3300012202 | Vadose Zone Soil | KKAKMPYEEFRKLFEQRPEPNRWQRISLGSSIKWALAGGLCVIAALLMR* |
| Ga0137381_101694781 | 3300012207 | Vadose Zone Soil | EKMPYQEFRKLFEQRPEPSRWQRITLGSSIKWALAGGLCIIAVLLVR* |
| Ga0137381_117015281 | 3300012207 | Vadose Zone Soil | KKGKMPYEEFRKLFEQRPEPNRWQRIRLGSSIKWAPAGGLCVIAVLLMR* |
| Ga0137376_102556731 | 3300012208 | Vadose Zone Soil | QRPEPNRWQKIRLGSSIKWALSGGLCVIAVLLMR* |
| Ga0137379_108353232 | 3300012209 | Vadose Zone Soil | VRKNAQEFRKLFEQRPEPSRWQRITLGSPIKWALAGGLCIIAVLLVR* |
| Ga0137377_102997372 | 3300012211 | Vadose Zone Soil | MPYEEFRKLFEQRPEPGRWQRITLGSSIKWALAGGLCIIAVLLAR* |
| Ga0137377_118746482 | 3300012211 | Vadose Zone Soil | VYGEKKGKMPYEEFRKLFEQRPEPNRWQTIRLGSSIKWALAGGLCVIAVLLMR* |
| Ga0137370_109843252 | 3300012285 | Vadose Zone Soil | RKLFEQRPEPSRWQRITLGSSIKWALAGGLCVIAVLLVR* |
| Ga0137387_113292091 | 3300012349 | Vadose Zone Soil | MPYQEFRKLFEQRPEPSRWQRITLGSSIKWALAGGLCIIA |
| Ga0137366_103060341 | 3300012354 | Vadose Zone Soil | QRPEPNRWQRIRLGSSIKWAPAGGLCVIAVLLMR* |
| Ga0137371_100742871 | 3300012356 | Vadose Zone Soil | KFRKLFEQRPEPSRWQRITLGSSIKWALAGGLCIIAVLLAR* |
| Ga0137371_102000144 | 3300012356 | Vadose Zone Soil | VRYGEKKGKMPYEEFRKLFKQRPEPNRWQRIRLGSSIKWALAGGLCVIAVLLMR* |
| Ga0137371_105258401 | 3300012356 | Vadose Zone Soil | KFRKLFEQRPEPSRWQRITLGSSIKWALAGGLCIIAVLLARGSALL* |
| Ga0137371_108125931 | 3300012356 | Vadose Zone Soil | MPYQEFRKLFEQRPEPSRWQRITLGISIKWALAGGLCVIAMLLVR* |
| Ga0137384_106534241 | 3300012357 | Vadose Zone Soil | KLFEQRPEPSRWQRITLGSSIKWALAGGLCIIAVLLVR* |
| Ga0137385_104571133 | 3300012359 | Vadose Zone Soil | PYQKFRKLFEQRPEPSRWQRITPGSSIKWVLAGGLCIIAVLLAR* |
| Ga0137385_109669393 | 3300012359 | Vadose Zone Soil | YGEKKGKMPYEEFRKLFEQRPEPNRWQKIRLGSSIKWALAGGLCVIAVLLMR* |
| Ga0137361_102114484 | 3300012362 | Vadose Zone Soil | VYGEKKGKMPYEEFRKLFEQRPEPNRWQRIRLGSSIKWALAGGLCVIAVLLVR* |
| Ga0137373_105050983 | 3300012532 | Vadose Zone Soil | MGESEKMPYQEFRKLFEQRPEPSRWQRITLGSSIKWALAGGLCVIAVLLVR* |
| Ga0137404_100559503 | 3300012929 | Vadose Zone Soil | MPYQKFRRLFEQRPEPSRWQRITLGSSIKWALAGGLCIIAVLLVR* |
| Ga0137404_102675734 | 3300012929 | Vadose Zone Soil | PYQEFRKLFEQRPEPSRWQRITLGSSIKWALAGGLCVIAVLLVR* |
| Ga0134077_100111911 | 3300012972 | Grasslands Soil | PYQKFRKLFEQRPEPSRWQRITLGSSIKWALAGGLCVIAVLLVR* |
| Ga0134077_105369221 | 3300012972 | Grasslands Soil | IRKMPYQKFRKLFEQRPEPSRWQRITLGSSIKWALAGGLCIIAVLLAR* |
| Ga0134089_100228446 | 3300015358 | Grasslands Soil | VYGEKKGKMPYEEFRKLFEQRPEPNRWQKIRLGSSIKWALAGGLCVIAVR* |
| Ga0134089_100735093 | 3300015358 | Grasslands Soil | MPYQKFRKLFEQRPEPSRWQRITLGSSIKWALAGGLCVIAV |
| Ga0066667_104706852 | 3300018433 | Grasslands Soil | MPYQKFRQLFEQRPPEPSRWQRITLGSSIKWALAGGLCVI |
| Ga0066667_106490493 | 3300018433 | Grasslands Soil | PYEEFRKLFEQRPEPNRWQKIRLGSSIKWALAGGLCVIAVR |
| Ga0066662_115827681 | 3300018468 | Grasslands Soil | FEQRPEPNRWQRIRLGSSIKWAPAGGLCVIAVLLMR |
| Ga0066669_105505681 | 3300018482 | Grasslands Soil | LVYGEKKGKMPYEEFRKLFEQRPEPNRWQRIRLGSSIKWAPAGGLCVIAVLLMR |
| Ga0207684_102222694 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MPYQKFRKLFEQRPEPSRWHRITLGSSIKWALAGGLCIIAMLLVR |
| Ga0207646_104991633 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MPYEEFRKLFEQRPEIRPRFWQRIRACSTAKWVLAGALCVVAVLLMR |
| Ga0207646_108327651 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | KFRKLFEQRPEPSRWQRITLGSSIKWALAGGLCIIAVLLVR |
| Ga0207664_113753811 | 3300025929 | Agricultural Soil | FSIARPDSCIQGEQEKMPYQKFRKLFEQRPEPNRWQRIRLGSSIKWALASGLCVIAVLLM |
| Ga0207665_106549222 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | MPYQEFRKLFEQRPEPSRWQRITLGSSIKWALAGGLCIIAVLMMR |
| Ga0209234_11920422 | 3300026295 | Grasslands Soil | KMPYQEFRKLFEQRPEPSRWQRITLGSSIKWALAGGLCVIAVLLVR |
| Ga0209237_10359353 | 3300026297 | Grasslands Soil | MPYQEFRKLFEQRPEPSRWQRITLGSSIKWALAGGLCVIAVLLVR |
| Ga0209237_11476181 | 3300026297 | Grasslands Soil | MPYEEFRKLFEQRPEPGRWQRITLGSSIKWALAGGLCIIAVLLAR |
| Ga0209236_10639841 | 3300026298 | Grasslands Soil | KLFEQRPEPSRWQRITLGSPIKWALAGGVCIIAVLLVR |
| Ga0209236_10658273 | 3300026298 | Grasslands Soil | MPYEEFRKLFEQRPEPNRWQKIRLGSSIKWALAGGLCVIAVLLMR |
| Ga0209468_100095316 | 3300026306 | Soil | MPYQKFRKLFEQRPEPSRWQRITLGSPIKWALAGGLCIIAVLLVR |
| Ga0209468_10556971 | 3300026306 | Soil | YEEFRKLFEQRPEIRPRFWQRITLGSSIKWALAGGLCVIAVLLVR |
| Ga0209468_11389832 | 3300026306 | Soil | VYGEKKGKMPYEEFRKLFEQRPEPNRWQKIRLGSSIKWALAGGLCVIAVR |
| Ga0209055_11264454 | 3300026309 | Soil | KLFEQRPEPNRWQRIRLGSSIKWALAGGLCVIAVLLMR |
| Ga0209239_10068072 | 3300026310 | Grasslands Soil | MPYQEFRKLFEQRPEPSRWQRITLGSSIKWALAGGLCVIAALLVR |
| Ga0209268_11343971 | 3300026314 | Soil | GKMPYEEFRKLFEQRPEPNRWQKIRLGSSIKWALAGGLCVIAVLLMR |
| Ga0209470_10246843 | 3300026324 | Soil | MPYQEFRKLFEQRPEPSRWQRITLGSSIKWALAGGLCLIAVLLVR |
| Ga0209470_10361682 | 3300026324 | Soil | MPYQKFRKLFEQRPEPSRWQRITLGSSIKWALAGGLCIIAVLLAR |
| Ga0209470_11257201 | 3300026324 | Soil | KLFEQRPEPSRWQRITLGSPIKWALAGGLCIIAVLLVR |
| Ga0209152_100082151 | 3300026325 | Soil | MPYQKFRRLFEQRPEPSRWQRITLGSSIKWALAGGLCIIAVLL |
| Ga0209266_10059409 | 3300026327 | Soil | KMPYEEFRKLFEQRPEPNRWQRIRLGSSIKWAPAGGLCVIAVLLMR |
| Ga0209803_10578842 | 3300026332 | Soil | VYGEKKGKMPYEEFRKLFEQRPEPNRWQKIRLGSSIKWALAGGLCVIAVLLMR |
| Ga0209158_13686661 | 3300026333 | Soil | LVYGEKKGKMPYEEFRKLFEQRPEPNRWQKIRLGSSIKWALAGGLCVIAVLLMR |
| Ga0209690_10086641 | 3300026524 | Soil | MPYQEFRKLFEQRPEPSRWQRIRLGSSIKWALAGGLCIIAVLLVR |
| Ga0209160_13384532 | 3300026532 | Soil | MPYQEFRKLFEQRPEPSRWQRITLGSSIKWALAGGLCIIAV |
| Ga0209056_100618905 | 3300026538 | Soil | MPYQKFRKLFEQRPEPSRWQRITLGSSIKWALAGGLCVIAVLLVR |
| Ga0209056_105778631 | 3300026538 | Soil | KFRQLFEQRPPEPSRWQRITLGSSIKWALAGGLCVIAVLLAR |
| Ga0209805_13519661 | 3300026542 | Soil | YEEFRKLFEQRPEPNRWQRIRLGSSIKWAPAGGLCVIAVLLMR |
| Ga0209590_104486032 | 3300027882 | Vadose Zone Soil | FRLFEQRPEPSRWQRIRLGSSIKWALAGGLCIIAVLLVR |
| Ga0307473_103378891 | 3300031820 | Hardwood Forest Soil | DSCVRKEKMPYQEFRNLFEQRPEPGRWQRIRLGSATKWALAGGLCVIAVLLVVR |
| Ga0307472_1003165202 | 3300032205 | Hardwood Forest Soil | MPYQKFRKLFEQRPEPSRWQRITPGSSIKWALAGGLCIIAVLLAVR |
| ⦗Top⦘ |