| Basic Information | |
|---|---|
| Family ID | F062546 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 130 |
| Average Sequence Length | 50 residues |
| Representative Sequence | MANPKLRFYFREPTIDTNIPITDGTVKIEGFDWEFVPDEDAADAWDCGFA |
| Number of Associated Samples | 114 |
| Number of Associated Scaffolds | 130 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 96.09 % |
| % of genes near scaffold ends (potentially truncated) | 98.46 % |
| % of genes from short scaffolds (< 2000 bps) | 92.31 % |
| Associated GOLD sequencing projects | 108 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.44 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (95.385 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil (11.539 % of family members) |
| Environment Ontology (ENVO) | Unclassified (36.923 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (31.538 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 6.41% β-sheet: 10.26% Coil/Unstructured: 83.33% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.44 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 130 Family Scaffolds |
|---|---|---|
| PF04909 | Amidohydro_2 | 20.00 |
| PF07883 | Cupin_2 | 19.23 |
| PF03972 | MmgE_PrpD | 10.00 |
| PF00501 | AMP-binding | 5.38 |
| PF13247 | Fer4_11 | 1.54 |
| PF00037 | Fer4 | 1.54 |
| PF00596 | Aldolase_II | 0.77 |
| PF02566 | OsmC | 0.77 |
| PF13193 | AMP-binding_C | 0.77 |
| COG ID | Name | Functional Category | % Frequency in 130 Family Scaffolds |
|---|---|---|---|
| COG2079 | 2-methylcitrate dehydratase PrpD | Carbohydrate transport and metabolism [G] | 10.00 |
| COG1764 | Organic hydroperoxide reductase OsmC/OhrA | Defense mechanisms [V] | 0.77 |
| COG1765 | Uncharacterized OsmC-related protein | General function prediction only [R] | 0.77 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 96.15 % |
| Unclassified | root | N/A | 3.85 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000033|ICChiseqgaiiDRAFT_c0684261 | All Organisms → cellular organisms → Bacteria | 752 | Open in IMG/M |
| 3300000364|INPhiseqgaiiFebDRAFT_105452692 | All Organisms → cellular organisms → Bacteria | 965 | Open in IMG/M |
| 3300000364|INPhiseqgaiiFebDRAFT_105454907 | All Organisms → cellular organisms → Bacteria | 551 | Open in IMG/M |
| 3300000787|JGI11643J11755_11348125 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 559 | Open in IMG/M |
| 3300000789|JGI1027J11758_12324702 | All Organisms → cellular organisms → Bacteria | 555 | Open in IMG/M |
| 3300003324|soilH2_10108316 | All Organisms → cellular organisms → Bacteria | 3097 | Open in IMG/M |
| 3300003993|Ga0055468_10097783 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 823 | Open in IMG/M |
| 3300004019|Ga0055439_10149699 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 725 | Open in IMG/M |
| 3300004058|Ga0055498_10072811 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 650 | Open in IMG/M |
| 3300004077|Ga0055523_10214615 | All Organisms → cellular organisms → Bacteria | 506 | Open in IMG/M |
| 3300004463|Ga0063356_101091456 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1149 | Open in IMG/M |
| 3300004463|Ga0063356_104555801 | All Organisms → cellular organisms → Bacteria | 596 | Open in IMG/M |
| 3300004463|Ga0063356_106269682 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 510 | Open in IMG/M |
| 3300004463|Ga0063356_106294614 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 509 | Open in IMG/M |
| 3300004480|Ga0062592_101318158 | All Organisms → cellular organisms → Bacteria | 682 | Open in IMG/M |
| 3300005295|Ga0065707_10916899 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 562 | Open in IMG/M |
| 3300005332|Ga0066388_105262117 | All Organisms → cellular organisms → Bacteria | 656 | Open in IMG/M |
| 3300005441|Ga0070700_101629506 | All Organisms → cellular organisms → Bacteria | 552 | Open in IMG/M |
| 3300005459|Ga0068867_101351333 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 659 | Open in IMG/M |
| 3300005467|Ga0070706_101792265 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 558 | Open in IMG/M |
| 3300005546|Ga0070696_100039410 | All Organisms → cellular organisms → Bacteria | 3262 | Open in IMG/M |
| 3300005546|Ga0070696_101822638 | Not Available | 526 | Open in IMG/M |
| 3300005549|Ga0070704_101919495 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 549 | Open in IMG/M |
| 3300005577|Ga0068857_101931962 | All Organisms → cellular organisms → Bacteria | 578 | Open in IMG/M |
| 3300005764|Ga0066903_103137508 | All Organisms → cellular organisms → Bacteria | 894 | Open in IMG/M |
| 3300005843|Ga0068860_101930033 | All Organisms → cellular organisms → Bacteria | 612 | Open in IMG/M |
| 3300005981|Ga0081538_10359366 | All Organisms → cellular organisms → Bacteria | 527 | Open in IMG/M |
| 3300006049|Ga0075417_10024058 | All Organisms → cellular organisms → Bacteria | 2459 | Open in IMG/M |
| 3300006049|Ga0075417_10629219 | All Organisms → cellular organisms → Bacteria | 548 | Open in IMG/M |
| 3300006806|Ga0079220_11459179 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 584 | Open in IMG/M |
| 3300006844|Ga0075428_100125199 | All Organisms → cellular organisms → Bacteria | 2797 | Open in IMG/M |
| 3300006865|Ga0073934_10449413 | All Organisms → cellular organisms → Bacteria | 780 | Open in IMG/M |
| 3300006881|Ga0068865_101967356 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 530 | Open in IMG/M |
| 3300006894|Ga0079215_10483077 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 766 | Open in IMG/M |
| 3300009012|Ga0066710_103107698 | All Organisms → cellular organisms → Bacteria | 642 | Open in IMG/M |
| 3300009078|Ga0105106_10152345 | All Organisms → cellular organisms → Bacteria | 1697 | Open in IMG/M |
| 3300009078|Ga0105106_10349197 | All Organisms → cellular organisms → Bacteria | 1069 | Open in IMG/M |
| 3300009091|Ga0102851_12418750 | All Organisms → cellular organisms → Bacteria | 600 | Open in IMG/M |
| 3300009098|Ga0105245_11589947 | All Organisms → cellular organisms → Bacteria | 705 | Open in IMG/M |
| 3300009168|Ga0105104_10646814 | All Organisms → cellular organisms → Bacteria | 604 | Open in IMG/M |
| 3300009444|Ga0114945_10141642 | All Organisms → cellular organisms → Bacteria | 1374 | Open in IMG/M |
| 3300009678|Ga0105252_10053590 | All Organisms → cellular organisms → Bacteria | 1533 | Open in IMG/M |
| 3300009678|Ga0105252_10286985 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 730 | Open in IMG/M |
| 3300009817|Ga0105062_1005771 | All Organisms → cellular organisms → Bacteria | 1806 | Open in IMG/M |
| 3300010029|Ga0105074_1008492 | All Organisms → cellular organisms → Bacteria | 1589 | Open in IMG/M |
| 3300010029|Ga0105074_1059265 | Not Available | 685 | Open in IMG/M |
| 3300010040|Ga0126308_10945658 | All Organisms → cellular organisms → Bacteria | 602 | Open in IMG/M |
| 3300010045|Ga0126311_11480318 | All Organisms → cellular organisms → Bacteria | 568 | Open in IMG/M |
| 3300010046|Ga0126384_11361613 | All Organisms → cellular organisms → Bacteria | 660 | Open in IMG/M |
| 3300010358|Ga0126370_10189002 | All Organisms → cellular organisms → Bacteria | 1544 | Open in IMG/M |
| 3300010361|Ga0126378_10352062 | All Organisms → cellular organisms → Bacteria | 1582 | Open in IMG/M |
| 3300010391|Ga0136847_11083068 | All Organisms → cellular organisms → Bacteria | 2272 | Open in IMG/M |
| 3300010398|Ga0126383_13484335 | All Organisms → cellular organisms → Bacteria | 514 | Open in IMG/M |
| 3300010400|Ga0134122_10897098 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 857 | Open in IMG/M |
| 3300010401|Ga0134121_11398510 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 710 | Open in IMG/M |
| 3300011416|Ga0137422_1045964 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1044 | Open in IMG/M |
| 3300011438|Ga0137451_1204916 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 625 | Open in IMG/M |
| 3300011443|Ga0137457_1147281 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 780 | Open in IMG/M |
| 3300012041|Ga0137430_1078546 | All Organisms → cellular organisms → Bacteria | 917 | Open in IMG/M |
| 3300012160|Ga0137349_1021959 | All Organisms → cellular organisms → Bacteria | 1011 | Open in IMG/M |
| 3300012163|Ga0137355_1052307 | All Organisms → cellular organisms → Bacteria | 770 | Open in IMG/M |
| 3300012168|Ga0137357_1136460 | All Organisms → cellular organisms → Bacteria | 500 | Open in IMG/M |
| 3300012179|Ga0137334_1094979 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 669 | Open in IMG/M |
| 3300012203|Ga0137399_11534057 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 554 | Open in IMG/M |
| 3300012205|Ga0137362_11649408 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 528 | Open in IMG/M |
| 3300012232|Ga0137435_1197952 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 616 | Open in IMG/M |
| 3300012349|Ga0137387_10350964 | All Organisms → cellular organisms → Bacteria | 1068 | Open in IMG/M |
| 3300012353|Ga0137367_10841320 | All Organisms → cellular organisms → Bacteria | 635 | Open in IMG/M |
| 3300012359|Ga0137385_11202851 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 619 | Open in IMG/M |
| 3300012489|Ga0157349_1019173 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 632 | Open in IMG/M |
| 3300012930|Ga0137407_11516951 | All Organisms → cellular organisms → Bacteria | 638 | Open in IMG/M |
| 3300012944|Ga0137410_10974873 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 721 | Open in IMG/M |
| 3300013306|Ga0163162_11930355 | All Organisms → cellular organisms → Bacteria | 676 | Open in IMG/M |
| 3300014326|Ga0157380_12386551 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 594 | Open in IMG/M |
| 3300014501|Ga0182024_12169667 | All Organisms → cellular organisms → Bacteria | 609 | Open in IMG/M |
| 3300014870|Ga0180080_1056529 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 659 | Open in IMG/M |
| 3300014884|Ga0180104_1051408 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1105 | Open in IMG/M |
| 3300014884|Ga0180104_1091272 | All Organisms → cellular organisms → Bacteria | 859 | Open in IMG/M |
| 3300015245|Ga0137409_10729870 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 826 | Open in IMG/M |
| 3300018051|Ga0184620_10349943 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 501 | Open in IMG/M |
| 3300018054|Ga0184621_10086902 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1093 | Open in IMG/M |
| 3300018066|Ga0184617_1275272 | All Organisms → cellular organisms → Bacteria | 506 | Open in IMG/M |
| 3300018076|Ga0184609_10218930 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 889 | Open in IMG/M |
| 3300018077|Ga0184633_10094306 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1544 | Open in IMG/M |
| 3300018079|Ga0184627_10075982 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1759 | Open in IMG/M |
| 3300018079|Ga0184627_10353581 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 768 | Open in IMG/M |
| 3300018082|Ga0184639_10098172 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1547 | Open in IMG/M |
| 3300018084|Ga0184629_10442828 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 681 | Open in IMG/M |
| 3300018084|Ga0184629_10485404 | All Organisms → cellular organisms → Bacteria | 645 | Open in IMG/M |
| 3300018422|Ga0190265_10103411 | All Organisms → cellular organisms → Bacteria | 2677 | Open in IMG/M |
| 3300018422|Ga0190265_10912600 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1001 | Open in IMG/M |
| 3300018429|Ga0190272_12273508 | All Organisms → cellular organisms → Bacteria | 584 | Open in IMG/M |
| 3300018432|Ga0190275_11438553 | All Organisms → cellular organisms → Bacteria | 766 | Open in IMG/M |
| 3300020197|Ga0194128_10259578 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 890 | Open in IMG/M |
| 3300021363|Ga0193699_10280957 | All Organisms → cellular organisms → Bacteria | 694 | Open in IMG/M |
| 3300021445|Ga0182009_10348161 | All Organisms → cellular organisms → Bacteria | 756 | Open in IMG/M |
| 3300022694|Ga0222623_10357022 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 558 | Open in IMG/M |
| 3300025324|Ga0209640_10231965 | All Organisms → cellular organisms → Bacteria | 1561 | Open in IMG/M |
| 3300025324|Ga0209640_11078217 | All Organisms → cellular organisms → Bacteria | 613 | Open in IMG/M |
| 3300025550|Ga0210098_1096173 | All Organisms → cellular organisms → Bacteria | 510 | Open in IMG/M |
| 3300025925|Ga0207650_11472524 | All Organisms → cellular organisms → Bacteria | 579 | Open in IMG/M |
| 3300025930|Ga0207701_10111337 | All Organisms → cellular organisms → Bacteria | 2447 | Open in IMG/M |
| 3300025930|Ga0207701_11171078 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 635 | Open in IMG/M |
| 3300025936|Ga0207670_11563641 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 561 | Open in IMG/M |
| 3300025942|Ga0207689_11556368 | All Organisms → cellular organisms → Bacteria | 551 | Open in IMG/M |
| 3300026052|Ga0208289_1012285 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 660 | Open in IMG/M |
| 3300026053|Ga0208422_1010378 | All Organisms → cellular organisms → Bacteria | 1062 | Open in IMG/M |
| 3300026066|Ga0208290_1032335 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 579 | Open in IMG/M |
| 3300026075|Ga0207708_11332959 | All Organisms → cellular organisms → Bacteria | 629 | Open in IMG/M |
| 3300027561|Ga0209887_1024256 | All Organisms → cellular organisms → Bacteria | 1434 | Open in IMG/M |
| 3300027573|Ga0208454_1104650 | Not Available | 661 | Open in IMG/M |
| 3300027815|Ga0209726_10164942 | All Organisms → cellular organisms → Bacteria | 1215 | Open in IMG/M |
| 3300027840|Ga0209683_10492654 | All Organisms → cellular organisms → Bacteria | 561 | Open in IMG/M |
| 3300027843|Ga0209798_10387201 | All Organisms → cellular organisms → Bacteria | 656 | Open in IMG/M |
| 3300027847|Ga0209402_10546019 | All Organisms → cellular organisms → Bacteria | 666 | Open in IMG/M |
| 3300027886|Ga0209486_11303238 | All Organisms → cellular organisms → Bacteria | 503 | Open in IMG/M |
| 3300027979|Ga0209705_10194091 | All Organisms → cellular organisms → Bacteria | 1069 | Open in IMG/M |
| 3300028802|Ga0307503_10922381 | All Organisms → cellular organisms → Bacteria | 507 | Open in IMG/M |
| 3300030728|Ga0308136_1020313 | All Organisms → Viruses → Predicted Viral | 1499 | Open in IMG/M |
| 3300031170|Ga0307498_10029023 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1344 | Open in IMG/M |
| 3300031562|Ga0310886_10342585 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 867 | Open in IMG/M |
| 3300031943|Ga0310885_10061745 | All Organisms → cellular organisms → Bacteria | 1594 | Open in IMG/M |
| 3300031962|Ga0307479_10126745 | All Organisms → cellular organisms → Bacteria | 2495 | Open in IMG/M |
| 3300031962|Ga0307479_11172607 | All Organisms → cellular organisms → Bacteria | 732 | Open in IMG/M |
| 3300032075|Ga0310890_10422847 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 995 | Open in IMG/M |
| 3300032122|Ga0310895_10653974 | All Organisms → cellular organisms → Bacteria | 543 | Open in IMG/M |
| 3300032180|Ga0307471_102104456 | All Organisms → cellular organisms → Bacteria | 709 | Open in IMG/M |
| 3300033434|Ga0316613_10170792 | All Organisms → cellular organisms → Bacteria | 1386 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 11.54% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 7.69% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 6.15% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 5.38% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 4.62% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 3.85% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 3.85% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 3.85% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 3.08% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 3.08% |
| Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 3.08% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 3.08% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 2.31% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.31% |
| Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 2.31% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 2.31% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 2.31% |
| Wetland Sediment | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment | 1.54% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 1.54% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.54% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 1.54% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere | 1.54% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.54% |
| Soil | Environmental → Terrestrial → Soil → Loam → Unclassified → Soil | 1.54% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 0.77% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Sediment | 0.77% |
| Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 0.77% |
| Groundwater | Environmental → Aquatic → Freshwater → Groundwater → Contaminated → Groundwater | 0.77% |
| Thermal Springs | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Thermal Springs | 0.77% |
| Hot Spring Sediment | Environmental → Aquatic → Thermal Springs → Sediment → Unclassified → Hot Spring Sediment | 0.77% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.77% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.77% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.77% |
| Unplanted Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Unplanted Soil | 0.77% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.77% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.77% |
| Sugarcane Root And Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil | 0.77% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.77% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.77% |
| Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 0.77% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.77% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.77% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.77% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.77% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.77% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.77% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.77% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.77% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000033 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000787 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300000789 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300003324 | Sugarcane bulk soil Sample H2 | Environmental | Open in IMG/M |
| 3300003993 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailC_D2 | Environmental | Open in IMG/M |
| 3300004019 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_TuleB_D2 | Environmental | Open in IMG/M |
| 3300004058 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_ThreeSqB_D1 | Environmental | Open in IMG/M |
| 3300004077 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - White_ThreeSqC_D2 | Environmental | Open in IMG/M |
| 3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
| 3300004480 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4 | Environmental | Open in IMG/M |
| 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Environmental | Open in IMG/M |
| 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Host-Associated | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005529 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1 | Environmental | Open in IMG/M |
| 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Environmental | Open in IMG/M |
| 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Environmental | Open in IMG/M |
| 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
| 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Host-Associated | Open in IMG/M |
| 3300006049 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 | Host-Associated | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
| 3300006865 | Hot spring sediment bacterial and archeal communities from British Columbia, Canada, to study Microbial Dark Matter (Phase II) - Larsen N4 metaG | Environmental | Open in IMG/M |
| 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Host-Associated | Open in IMG/M |
| 3300006894 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Control | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009078 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 10-12cm September2015 | Environmental | Open in IMG/M |
| 3300009091 | Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009168 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 19-21cm September2015 | Environmental | Open in IMG/M |
| 3300009444 | Hot spring microbial communities from Beatty, Nevada to study Microbial Dark Matter (Phase II) - OV2 TP3 | Environmental | Open in IMG/M |
| 3300009678 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT100 | Environmental | Open in IMG/M |
| 3300009817 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_10_20 | Environmental | Open in IMG/M |
| 3300010029 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_10_20 | Environmental | Open in IMG/M |
| 3300010040 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot55 | Environmental | Open in IMG/M |
| 3300010045 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot61 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010391 | Freshwater sediment microbial communities from Lake Superior, USA - Station SU-17. Combined Assembly of Gp0155404, Gp0155335, Gp0155336, Gp0155336, Gp0155403, Gp0155406 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300011416 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT551_2 | Environmental | Open in IMG/M |
| 3300011438 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT500_2 | Environmental | Open in IMG/M |
| 3300011443 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT630_2 | Environmental | Open in IMG/M |
| 3300012041 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT754_2 | Environmental | Open in IMG/M |
| 3300012160 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT630_2 | Environmental | Open in IMG/M |
| 3300012163 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT800_2 | Environmental | Open in IMG/M |
| 3300012168 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT860_2 | Environmental | Open in IMG/M |
| 3300012179 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT262_2 | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012232 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT100_2 | Environmental | Open in IMG/M |
| 3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
| 3300012353 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012489 | Unplanted soil (control) microbial communities from North Carolina - M.Soil.5.yng.040610 | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014501 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014870 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT560_16_10D | Environmental | Open in IMG/M |
| 3300014884 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT730_16_1Da | Environmental | Open in IMG/M |
| 3300015245 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300018051 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5_b1 | Environmental | Open in IMG/M |
| 3300018054 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_b1 | Environmental | Open in IMG/M |
| 3300018066 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_5_b1 | Environmental | Open in IMG/M |
| 3300018076 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_coex | Environmental | Open in IMG/M |
| 3300018077 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_170_b1 | Environmental | Open in IMG/M |
| 3300018079 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b1 | Environmental | Open in IMG/M |
| 3300018082 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_170_b2 | Environmental | Open in IMG/M |
| 3300018084 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_b1 | Environmental | Open in IMG/M |
| 3300018422 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 T | Environmental | Open in IMG/M |
| 3300018429 | Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 T | Environmental | Open in IMG/M |
| 3300018432 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 550 T | Environmental | Open in IMG/M |
| 3300020197 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015037 Kigoma Deep Cast 65m | Environmental | Open in IMG/M |
| 3300021363 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3c2 | Environmental | Open in IMG/M |
| 3300021445 | Bulk soil microbial communities from the field in Mead, Nebraska, USA - 072115-187_1 MetaG | Environmental | Open in IMG/M |
| 3300022694 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_coex | Environmental | Open in IMG/M |
| 3300025324 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 10_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300025550 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Joice_ThreeSqA_D1 (SPAdes) | Environmental | Open in IMG/M |
| 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025930 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) | Environmental | Open in IMG/M |
| 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026052 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailA_D1 (SPAdes) | Environmental | Open in IMG/M |
| 3300026053 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushOxbow_ThreeSqA_D1 (SPAdes) | Environmental | Open in IMG/M |
| 3300026066 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailB_D1 (SPAdes) | Environmental | Open in IMG/M |
| 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027561 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_30_40 (SPAdes) | Environmental | Open in IMG/M |
| 3300027573 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT100 (SPAdes) | Environmental | Open in IMG/M |
| 3300027815 | Subsurface groundwater microbial communities from S. Glens Falls, New York, USA - GMW46 contaminated, 5.4 m (SPAdes) | Environmental | Open in IMG/M |
| 3300027840 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare2Fresh (SPAdes) | Environmental | Open in IMG/M |
| 3300027843 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare3Fresh (SPAdes) | Environmental | Open in IMG/M |
| 3300027847 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_126 (SPAdes) | Environmental | Open in IMG/M |
| 3300027886 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost (SPAdes) | Environmental | Open in IMG/M |
| 3300027979 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 10-12cm September2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300028802 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 17_S | Environmental | Open in IMG/M |
| 3300028809 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_PalmiticAcid_Day48 | Environmental | Open in IMG/M |
| 3300030728 | Metatranscriptome of marine microbial communities from Western Arctic Ocean, Canada - CB4_940_32.3 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031170 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 12_S | Environmental | Open in IMG/M |
| 3300031562 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D3 | Environmental | Open in IMG/M |
| 3300031943 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D2 | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032075 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D3 | Environmental | Open in IMG/M |
| 3300032122 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D4 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300033434 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day10_CT_b | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| ICChiseqgaiiDRAFT_06842612 | 3300000033 | Soil | MANPKLRFYFREPTIDTNIPITDGTVKIEGFDWEFVPTEEECDAWDCGFAARVRAY |
| INPhiseqgaiiFebDRAFT_1054526922 | 3300000364 | Soil | VANPTLKFYFREPTIDTNIPITDGTVKIEGFEWQFV |
| INPhiseqgaiiFebDRAFT_1054549071 | 3300000364 | Soil | VANPTLKFYFREPTIDTNIPITDGTVKIEGFEWQFVKTEDEADAWDCGFAARL |
| JGI11643J11755_113481251 | 3300000787 | Soil | MANPKLKFYFREPTIDTNIPITDGTVKIEGFDWEFVPDEDAADAWDCGFAARVRAFAK |
| JGI1027J11758_123247021 | 3300000789 | Soil | VANPTLKFYFREPTIDTNIPITDGTVKIEGFEWQFVKTEDEADAWDCGFAARLR |
| soilH2_101083161 | 3300003324 | Sugarcane Root And Bulk Soil | MIKTVNAAERKGKNMANAKLKFYFREPTIDTNLPITDGTVTIDGFDWEFVDNEAAADAWDCGFAARVRAFAK |
| Ga0055468_100977832 | 3300003993 | Natural And Restored Wetlands | MADPKLKFYFREPTIDTNMPITDGTVKIEGFDWEFVTNEDAADAWDCGFAARVRAYA |
| Ga0055439_101496991 | 3300004019 | Natural And Restored Wetlands | MANPKLRFYFREPTIDLNIPITDGTVKIDGFDWEFVPTEEQCDAWDCGFAARLRAYAKGEAHISI |
| Ga0055498_100728111 | 3300004058 | Natural And Restored Wetlands | MANPKLRFYFREPTIDLNIPITDGSVKVEGFDLEFVPNEEQCDAWDCGFAARLVAY |
| Ga0055523_102146151 | 3300004077 | Natural And Restored Wetlands | MANPKLRFYFREPTIDTNIPITDGTVKIDDFEWEFVPTEEECDAWDC |
| Ga0063356_1010914562 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MANPRLRFYFREPTIDLNIPITDGTVKIDGFDWEFVPTEDA |
| Ga0063356_1045558012 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MASPKLKFFFREPTIDTNIPITDGTVKIEGFDWEFVPNEAAADAWDCGFAARVRA |
| Ga0063356_1062696822 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MALPKLKFYFREPTIDTNVPITDGTVKIEGFEWEFVPDEDAADAWDCGF |
| Ga0063356_1062946142 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MALPKLKFYFREPTIDTNIPITDGTVKIEGFEWEFVPDEDAADAWDCGF |
| Ga0062592_1013181581 | 3300004480 | Soil | MPNPKLHFYFREPTVDTNMPITDGTIKVEGFDVEIVAREEDADAWDCGFAARVRAYSKGAAQLSI |
| Ga0065707_109168992 | 3300005295 | Switchgrass Rhizosphere | MPNPKLRLYFREPTVDTNMPITDGTVKIEGFEFEIVKREDDADAWDCGFAARVRAHARGLGHVS |
| Ga0066388_1052621171 | 3300005332 | Tropical Forest Soil | MPDPKLRLYFREPTVDTNMPITEESVKIEGLQVEIVKREDDA |
| Ga0070700_1016295061 | 3300005441 | Corn, Switchgrass And Miscanthus Rhizosphere | MANPVLKFYFREPTIDTNIPITDSTVKIDGFDWQFVDNED |
| Ga0068867_1013513332 | 3300005459 | Miscanthus Rhizosphere | MANPKLKFYFREPTIDTNIPITDGTVKIEGFDWEFVPDEDAADAWDCGFAARVRA |
| Ga0070706_1017922652 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | MSNAKLRFYFREPTIDTNIPITDGTVKMKGFDWEFVDNEDDADAWDCG |
| Ga0070741_114392132 | 3300005529 | Surface Soil | MANPKLRFRFFEPEVDTNLPFTDGTVQIDGFDLECVSG |
| Ga0070696_1000394104 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | MANSKLKFYFREPTIDTNLPITDGSVKIDGFDWEFVDNEAAA |
| Ga0070696_1018226381 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | MANPILRFYFREPTIDLNIPITDGTVKIEGFDWEFVPNEDACDAWDCGFAARL |
| Ga0070704_1019194951 | 3300005549 | Corn, Switchgrass And Miscanthus Rhizosphere | MALPKLKFYFREPTIDTNIPITDGTLKIEGFEWEFVPDEDAADAWDCG |
| Ga0068857_1019319622 | 3300005577 | Corn Rhizosphere | MANPVLKFYFREPTIDTNIPITDSTVKIDGFDWQFVDNEDAADAWDCGFA |
| Ga0066903_1031375082 | 3300005764 | Tropical Forest Soil | MSDPKLLLYFREPTVDTNMPITDGTVKIEGFEVEIVQREDDADVWDCGFAARVRAHAKGLAHVSI |
| Ga0068860_1019300331 | 3300005843 | Switchgrass Rhizosphere | MANPVLKFYFREPTIDTNIPITDSTVKIDGFDWQFVDNEDAADAWDCGFAARVRAYAQGL |
| Ga0081538_103593661 | 3300005981 | Tabebuia Heterophylla Rhizosphere | MANPKLRFYFREPTIDTNIPITDGTVKIDGFDWELVASEDDADAWDC |
| Ga0075417_100240584 | 3300006049 | Populus Rhizosphere | MSNAKLRFYFREPTIDTNIPITDGTVKMEGFDWGFADNEDDADAWDCGFAARVRAYAKGLPHISI |
| Ga0075417_106292192 | 3300006049 | Populus Rhizosphere | MSNAKLRFYFREPTIDTNIPITDGTIKMEGFDWEFVDNEDDADAWDCGFAARVRAYAKGLPHISI |
| Ga0079220_114591792 | 3300006806 | Agricultural Soil | MANAKLKFYFREPTIDTNLPITDGSVKIDGFDWEFVD |
| Ga0075428_1001251991 | 3300006844 | Populus Rhizosphere | MSNAKLRFYFREPTIDTNIPITDGTIKMEGFDWEFVDNEDDADAWD |
| Ga0073934_104494131 | 3300006865 | Hot Spring Sediment | MANPKLRFYFREPTIDTNIPITDGTVKIEGFDWEFVANEDDADAWDCGFAA |
| Ga0068865_1019673562 | 3300006881 | Miscanthus Rhizosphere | MANPKLKFYFREPTIDTNIPITDGTVKIDGFEWEFVPDENQCDAWDCGFAARVRAYAK |
| Ga0079215_104830772 | 3300006894 | Agricultural Soil | MANPILRFYFREPTIDLNIPITDGTVKIDGFDWEFVPTEDACDAWDCGFAARL |
| Ga0066710_1031076981 | 3300009012 | Grasslands Soil | MADAKLRFYFREPTIDTNIPITYGTIKIEGFDWHFVKNEDEADAWDCGFAARLRAYAE |
| Ga0105106_101523452 | 3300009078 | Freshwater Sediment | MANPKLRFYFREPTIDTNIPITDGTVKIEGFDWEFVPDEDAADAWDCGFA |
| Ga0105106_103491971 | 3300009078 | Freshwater Sediment | MANPKLRFYFREPTIDTNIPITYGTVTIDGFDWEFVPTE |
| Ga0102851_124187501 | 3300009091 | Freshwater Wetlands | MANPKLHFYFREPTIDTNIPITDGTVKIEGFDWEFVPTEEECDAWDCGFAARVRAYAKGEQHISI |
| Ga0105245_115899472 | 3300009098 | Miscanthus Rhizosphere | MADPIIRFYFREPTIDTNIPITDGTVRIDGFQWQFVKTED |
| Ga0105104_106468141 | 3300009168 | Freshwater Sediment | MPNPKLRLYFREPTVDTNMPITDGTVKIEGFEFEIVKREDDADAWDCGFAARV |
| Ga0114945_101416421 | 3300009444 | Thermal Springs | MANPKLRFYFREPTIDTNVPITDGTVKIDGFDFEFVDSEDGADAWDCGFAARVRAY |
| Ga0105252_100535903 | 3300009678 | Soil | MAKPKLHFYFREPTVDTNRAITDGTVKVEGFDLEIVEREEAADAWDCGFAARLRANAQGA |
| Ga0105252_102869851 | 3300009678 | Soil | MANPKLRFYFREPTIDTNIPITDGTVKIEGFDWEFVPIEEACDAWDCG |
| Ga0105062_10057711 | 3300009817 | Groundwater Sand | MPNPKLRLYFREPTVDTNMPITDGTVKIEGFGFEIVKREDDADAW |
| Ga0105074_10084923 | 3300010029 | Groundwater Sand | MPNPKLRLYFREPTVDTNMPITDGTVKIEGFEFEIVKREDDAD |
| Ga0105074_10592651 | 3300010029 | Groundwater Sand | MPSPKLRLYFREPTVDTNMPITDGTVKIEGFEFEIVKREDDAD |
| Ga0126308_109456582 | 3300010040 | Serpentine Soil | MANPKLRFYFREPTIDTNIPITDGTVTIDGFDWEFVPTEEECDAWDCGFAARVRAYAKGEPHTSI |
| Ga0126311_114803181 | 3300010045 | Serpentine Soil | MANPKLRFYFREPTIDTNIPITDGTVQIDGFDWEFVPTEDEC |
| Ga0126384_113616132 | 3300010046 | Tropical Forest Soil | MANPKLRFYFREPTIDTNIAITDGTVKAEGFDFEFVPSED |
| Ga0126370_101890022 | 3300010358 | Tropical Forest Soil | MAQPKLRFYFREPTIDTNIPITDGTVKIEGFDWQFVASEDQA |
| Ga0126378_103520621 | 3300010361 | Tropical Forest Soil | MSDPKLRLYFREPTVDTNMPITDGSVKIEGFEVEIVPREDDA |
| Ga0136847_110830683 | 3300010391 | Freshwater Sediment | MEVAMANPKLRFYFREPTIDTNIPITDGTVKIEGFDWEFVPTEEQCDAWDCGFAAR |
| Ga0126383_134843351 | 3300010398 | Tropical Forest Soil | MPDPKLRLYFREPTVDTNMPITDGTVKIEGFEVEI |
| Ga0134122_108970982 | 3300010400 | Terrestrial Soil | MKGDKIMALPKLKFYFREPTIDTNIPITDGTVKIEGFDWEFVPDE |
| Ga0134121_113985101 | 3300010401 | Terrestrial Soil | MANPRLKFYFREPTIDTNIPITDGSVKIDGFDWEFVPNEEAADAWDCGFAARVRAY |
| Ga0137422_10459641 | 3300011416 | Soil | MANPKLRFYFREPTIDLNIPITDGTVKIDGFDWEFVPTEEECDAWDCG |
| Ga0137451_12049161 | 3300011438 | Soil | MANPRLRFYFREPTIDLNIPITDGTVKIDGFDWEF |
| Ga0137457_11472811 | 3300011443 | Soil | MANPILRFYFREPTIDLNIPITDGTVKIDGFDWEFVPTED |
| Ga0137430_10785462 | 3300012041 | Soil | MAKPKLHFYFREPTVDTNKAITDGTVQIEGFDLEIVEREEAADA |
| Ga0137349_10219591 | 3300012160 | Soil | MANPKLRFYFREPTIDTNIPITDGTVKIEGFDWEFVPTEEECD |
| Ga0137355_10523073 | 3300012163 | Soil | MSRYVASVTKGTAMANPKLRFYFREPTIDTNIPITDGTVKIEGFDWEFVPTEEECDAWDCGFAARVRAYA |
| Ga0137357_11364601 | 3300012168 | Soil | MANPKLRFYFREPTIDTNIPITDGTIKIEGFEWEFVPREDDADAWDCGFAARLRAHATNE |
| Ga0137334_10949792 | 3300012179 | Soil | MAIPRLRFYFREPTIDLNIPITDGTVKIDGFDWEFVPTE |
| Ga0137399_115340571 | 3300012203 | Vadose Zone Soil | MANPKLKFYFREPTIDTNIPITDGSVKIDGFDWEFVPN |
| Ga0137362_116494081 | 3300012205 | Vadose Zone Soil | MLPRGLKGGSKMSNAKLRFYFREPTIDTNIPITDGTVKMEGFDWEFVDNEDDADAWDCGFAARVRAYAK |
| Ga0137435_11979521 | 3300012232 | Soil | MANPRLRFYFREPTIDLNIPITDGTVKIDGFDWEFVPTEEACDAWDCGFAARVRAYA |
| Ga0137387_103509642 | 3300012349 | Vadose Zone Soil | MSNAKLRFYFREPTIDTNIPITDGTVKMEGFDWEFADNEDNADAWDCGFAA |
| Ga0137367_108413202 | 3300012353 | Vadose Zone Soil | MLLRGLKGGTKMSNAKLRFYFREPTIDTNIPITDGTIKMEGFDWEFVDNEDDADAWDCGFAARVRAYAKG |
| Ga0137385_112028511 | 3300012359 | Vadose Zone Soil | MANPKLKFYFREPTIDTNIPITDGSVKIDGFDWEFVPDENECDAWDCG |
| Ga0157349_10191731 | 3300012489 | Unplanted Soil | MANPKLKFYFREPTIDTNIPITDGTVKIDGFDWEFVPDENQCDAW |
| Ga0137407_115169512 | 3300012930 | Vadose Zone Soil | MPNPKLRLYFREPTVDTNMPITDGTVKVEGFELEIVKREDDAD |
| Ga0137410_109748732 | 3300012944 | Vadose Zone Soil | MANPKLKFYFREPTIDTNIPITDGSVKIDGFEWEFVPDE |
| Ga0163162_119303551 | 3300013306 | Switchgrass Rhizosphere | MKIMANPVLKFYFREPTIDTNIPITDSTVKIDGFDWQFVDNEDAADAWDCGFAAR |
| Ga0157380_123865512 | 3300014326 | Switchgrass Rhizosphere | MANPKLIFYFREPTIDTNIPITDGSVKIDGFEWEFVPDENQCDAWDCGFAARVRAYAKEE |
| Ga0182024_121696672 | 3300014501 | Permafrost | LAVEAAMANPKLRFFFREPTIDTNLPFTDGTISIEGFDLEVATGEW |
| Ga0180080_10565292 | 3300014870 | Soil | MANPKLLFYFREPTIDTNIPITDGTVKIDGFDWEFVPTEEECDAWDCGFAARVR |
| Ga0180104_10514082 | 3300014884 | Soil | MPSAKLRFYFREPTIDTNIPITDGTIKIEGFEWEFVPKEDDADAWDCGFAARLRAHATNEPHIS |
| Ga0180104_10912722 | 3300014884 | Soil | MPSPKLRFYFREPTIDTNIPITDGTIKIEGFEWEFVPKEDDADAWDCGFAARLRAHATNEPHIS |
| Ga0137409_107298702 | 3300015245 | Vadose Zone Soil | MANPKLKFYFREPTIDTNIPITDGSVKIDGFDWEFVPDENQCDAWDCGFAARV |
| Ga0184620_103499431 | 3300018051 | Groundwater Sediment | MANPKLKFYFREPTIDTNMPITDGSVKLDGFDWEVVPDESECD |
| Ga0184621_100869021 | 3300018054 | Groundwater Sediment | MAIPKLKFYFREPTIDTNIPITDGTVQVDGFDWQFV |
| Ga0184617_12752721 | 3300018066 | Groundwater Sediment | MANPILRFYFREPTIDLNIPITDGTVKIDGFDWEFVPTEDACDAWDCGFAARLRAYAKGEAHISIP |
| Ga0184609_102189302 | 3300018076 | Groundwater Sediment | MANPILRFYFREPTIDLNIPITDGTVKIDGFDWEFVPTEDA |
| Ga0184633_100943061 | 3300018077 | Groundwater Sediment | MAIPKLKFYFREPTIDTNIPITDGTVKIDGFDWQFVPNEEEADAWDCGF |
| Ga0184627_100759821 | 3300018079 | Groundwater Sediment | MPNPKLRFYFREPTIDTNTPITDGTVKIDGFEFEFVDNEDGADGWDCGFA |
| Ga0184627_103535812 | 3300018079 | Groundwater Sediment | MANAKMRFYFREPTIDLNIPITDGTVKVDGFDLEFVPNEEQCD |
| Ga0184639_100981721 | 3300018082 | Groundwater Sediment | MAIPKLKFYFREPTIDTNIPITDGTVKIDGFDWQFVPNEEEA |
| Ga0184629_104428282 | 3300018084 | Groundwater Sediment | MAIPRLRFYFREPTIDLNIPITDGTVKIDGFDWEFVPTEEACDAWDCGFAARVRAY |
| Ga0184629_104854042 | 3300018084 | Groundwater Sediment | MPNPKLRLYFREPTVDTNMPITDGTVKVEGFELEIVKR |
| Ga0190265_101034113 | 3300018422 | Soil | MSNPKLKFYFREPTIDTNIPITDGTVKIEGFDWEFVPDE |
| Ga0190265_109126002 | 3300018422 | Soil | MANPKLKFYFREPTIDTNIPITDGTVKIDGFDWEFVSNEDAADAWDCGF |
| Ga0190272_122735081 | 3300018429 | Soil | MKIMANPVLKFYFREPTIDTNIPITDSTVKIDGFDWQFVENEDAA |
| Ga0190275_114385531 | 3300018432 | Soil | MANPKLKFYFREPTIDTNIPITDGPVKIEGCEWEFVPTEDAADAWD |
| Ga0194128_102595782 | 3300020197 | Freshwater Lake | MANARMRFYFREPTIDMNIPITDGTVKVEGFDLEFVPDEGQCDAWDCGFAARLVAYAKGEKHISI |
| Ga0193699_102809572 | 3300021363 | Soil | MANPVLKFYFREPTIDTNIPITDSTVKIDGFDWQFVDN |
| Ga0182009_103481611 | 3300021445 | Soil | MPNPKLRFYFREPTIDTNSAITDGTVKIDGFDFEFVSTEDQADAWDCGFAARVRAHAMGLPHIS |
| Ga0222623_103570221 | 3300022694 | Groundwater Sediment | MAIPKLKFYFREPTIDTNIPITDGTVKVDGFDWQFVPNEEEADAWDCGFAARVRAY |
| Ga0209640_102319652 | 3300025324 | Soil | MAQPKLRFYFREPTIDTNIPITDGTVKIDGFDWEF |
| Ga0209640_110782172 | 3300025324 | Soil | MANPVMRFRYREPTVDTNRPLTEGTVKVEGFDLQVLPEMTTDD |
| Ga0210098_10961731 | 3300025550 | Natural And Restored Wetlands | MANPKLRFYFREPTIDTNIPITDGTVEIDGFDWEFVPTEEECDAW |
| Ga0207650_114725242 | 3300025925 | Switchgrass Rhizosphere | MANPVLKFYFREPTIDTNIPITDSTVKIDGFDWQFVDNEDAADAWDCGFAARVRAYAQGLPHISI |
| Ga0207701_101113373 | 3300025930 | Corn, Switchgrass And Miscanthus Rhizosphere | MANPRLRFYFREPTIDLNIPITDGTVKIDGFDWEFVPTEEACDAWDCGFAARLRAYAKGEAHIS |
| Ga0207701_111710781 | 3300025930 | Corn, Switchgrass And Miscanthus Rhizosphere | MANPKLKFYFREPTIDTNIPITDGSVKIDGFDWEFVPNEEAADAWDCGFAARVRAY |
| Ga0207670_115636412 | 3300025936 | Switchgrass Rhizosphere | MANAKLKFYFREPTIDTNLPITDGSVKIDGFDWEFVDNEAAADAWDCGFAARVRAF |
| Ga0207689_115563681 | 3300025942 | Miscanthus Rhizosphere | MANPVLKFYFREPTIDTNMPITDSTVKIDGFDRQFVDNEDAAD |
| Ga0208289_10122851 | 3300026052 | Natural And Restored Wetlands | MATPKLKFYFREPTIDTNIPITDGTVKLDGFDWEFVPNEEECDAWDCGFAAR |
| Ga0208422_10103781 | 3300026053 | Natural And Restored Wetlands | MANPRLRFYFREPTIDTNIPITDGTVKIEGFDWEFVPTEEACDAWDCGFAAR |
| Ga0208290_10323352 | 3300026066 | Natural And Restored Wetlands | MADPKLKFYFREPTIDTNIPITDGTVKLDGFDWEFVPNEEECDAWDCGFA |
| Ga0207708_113329591 | 3300026075 | Corn, Switchgrass And Miscanthus Rhizosphere | MANPVLKFYFREPTIDTNIPITDSTVKIDGFDWQFVDNEDAADAWDCGFAARVRA |
| Ga0209887_10242562 | 3300027561 | Groundwater Sand | MPNPKLRLYFREPTVDTNMPITDGTVKIEGFEFEIVKREDDADAWDCGFAARVRAHAKG |
| Ga0208454_11046502 | 3300027573 | Soil | MAKPKLHFYFREPTVDTNKAITDGTVQIEGFDLEIVEREEAADAWDCGFAARLRARA |
| Ga0209726_101649422 | 3300027815 | Groundwater | MANPKLRFYFREPTIDTNIPITDGTVKIDGFDWEFVPTEA |
| Ga0209683_104926542 | 3300027840 | Wetland Sediment | MANPKLRFYFREPTIDTNIPITDGTVKLDGFDWEFVPSEEECDAWDCGFAAR |
| Ga0209798_103872012 | 3300027843 | Wetland Sediment | MANPKLRFYFREPTIDTNIPITDGTVKIDGFDWEFVPDEESCDAWDCGF |
| Ga0209402_105460192 | 3300027847 | Marine | MANPKLRFRFREPTVDTNLPLTDGTVKIDGFDLEVLGG |
| Ga0209486_113032382 | 3300027886 | Agricultural Soil | MANPNLKFYFREPTIDTNMPITDGTVKIEGFDWELVPDKDAADAWDCGFAARVRAFASGLPHIS |
| Ga0209705_101940912 | 3300027979 | Freshwater Sediment | MANPKLRFYFREPTIDTNIPITDGTVKIEGFDWEFVPDED |
| Ga0307503_109223812 | 3300028802 | Soil | MANPRLRFYFREPTIDLNIPITDGTVKIDGFDWEFVPTEEACDAWDCGFAARLRAYAKGEAHISI |
| Ga0247824_105785521 | 3300028809 | Soil | MASPKLKFYFREPTIDTNIPITDGTVKIEGFDWEFVPNEAAADAWDCGFAARVRAYAQAVPHISIP |
| Ga0308136_10203132 | 3300030728 | Marine | MANPKLRFRFREPTVDTNLPLTDGTVKIDGFDLEVLGGSEDSRFEADARDEGFGALVQRKVE |
| Ga0307498_100290231 | 3300031170 | Soil | MANPKLKFYFREPTIDTNIPITDGSVKIDGFDWEFVPDENQCDAWDCG |
| Ga0310886_103425852 | 3300031562 | Soil | MANPKLKFYFREPTIDTNIPITDGTVKIDGFDWEFVPNENECDAWDCGFAARVRA |
| Ga0310885_100617452 | 3300031943 | Soil | MANPKLKFYFREPTIDTNIPITDGTVKIEGFDWEFVPTEDAADAW |
| Ga0307479_101267453 | 3300031962 | Hardwood Forest Soil | MANPKLRFYFREPTIDTNIPITDGTVKIEGFDWQFVP |
| Ga0307479_111726072 | 3300031962 | Hardwood Forest Soil | MANPKLRFYFREPTIDTNIPITDGTVKIEGFDWQFVPNEEEADAWDCGFAARVRAY |
| Ga0310890_104228471 | 3300032075 | Soil | MANPRLRFYFREPTIDLNIPITDGTVKIDGFDWEFVPTEDSCDAWD |
| Ga0310895_106539741 | 3300032122 | Soil | MPNSKLRFYFREPTVDTNMPITDGTVKVEGFELEIVKREEDADAWDCGFAARVRAH |
| Ga0307471_1021044561 | 3300032180 | Hardwood Forest Soil | MANPKLRFYFREPTIDTNIPITDGTVKIEGFDWQFVPN |
| Ga0316613_101707922 | 3300033434 | Soil | MANPRLRFYFREPTIDTNIPITDGTVKIEGFDWEFV |
| ⦗Top⦘ |