Metagenome Family F062506

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences

Select file to download:
Download

Overview

Basic Information
Family ID	F062506
Family Type	Metagenome
Number of Sequences	130
Average Sequence Length	44 residues
Representative Sequence	MRDVRASPPPVPEDVRRRAINRAHAEAQKKRKDAKAAKRTKHIL
Number of Associated Samples	66
Number of Associated Scaffolds	130

Quality Assessment
Transcriptomic Evidence	No
Most common taxonomic group	Unclassified
% of genes with valid RBS motifs	21.30 %
% of genes near scaffold ends (potentially truncated)	66.92 %
% of genes from short scaffolds (< 2000 bps)	83.08 %
Associated GOLD sequencing projects	65
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.48

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign

Most Common Taxonomy
Group	Unclassified (90.000 % of family members)
NCBI Taxonomy ID	N/A
Taxonomy	N/A

Most Common Ecosystem
GOLD Ecosystem	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Miscanthus Phyllosphere (92.308 % of family members)
Environment Ontology (ENVO)	Unclassified (93.077 % of family members)
Earth Microbiome Project Ontology (EMPO)	Host-associated → Plant → Plant surface (93.077 % of family members)

Multiple Sequence Alignments

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Select alignment to view:

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification:	Globular	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 47.22% β-sheet: 0.00% Coil/Unstructured: 52.78%
Feature Viewer

Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.48
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.48
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

Gene Neighborhood

Neighboring Pfam domains

Pfam ID	Name	% Frequency in 130 Family Scaffolds
PF04195	Transposase_28	6.92

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	90.00 %
All Organisms	root	All Organisms	10.00 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	90.00 %
cellular organisms	root	All Organisms → cellular organisms	10.00 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	90.00 %
Eukaryota	superkingdom	All Organisms → cellular organisms → Eukaryota	10.00 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	90.00 %
Viridiplantae	kingdom	All Organisms → cellular organisms → Eukaryota → Viridiplantae	10.00 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	90.00 %
Streptophyta	phylum	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta	10.00 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	90.00 %
Streptophytina	subphylum	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina	10.00 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	90.00 %
Embryophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	10.00 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	90.00 %
Tracheophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta	10.00 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	90.00 %
Euphyllophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta	10.00 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	90.00 %
Spermatophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta	10.00 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	90.00 %
Magnoliopsida	class	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida	10.00 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	90.00 %
Mesangiospermae	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae	10.00 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	90.00 %
Liliopsida	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida	10.00 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	90.00 %
Petrosaviidae	subclass	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae	10.00 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	90.00 %
commelinids	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids	10.00 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	90.00 %
Poales	order	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales	10.00 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	90.00 %
Poaceae	family	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	10.00 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	90.00 %
PACMAD clade	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade	10.00 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	90.00 %
Panicoideae	subfamily	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae	10.00 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	90.00 %
Andropogonodae	no rank	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae	9.23 %
Panicodae	no rank	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae	0.77 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	90.00 %
Andropogoneae	tribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae	9.23 %
Paniceae	tribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae	0.77 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	90.00 %
Sorghinae	subtribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae	7.69 %
Tripsacinae	subtribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae	1.54 %
Panicinae	subtribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae	0.77 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	90.00 %
Sorghum	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum	7.69 %
Zea	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea	1.54 %
Panicum	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum	0.77 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	90.00 %
Sorghum bicolor	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	7.69 %
Zea mays	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays	1.54 %
Panicum sect. Hiantes	section	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes	0.77 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	90.00 %
Sorghum bicolor	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	7.69 %
Zea mays	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays	1.54 %
Panicum virgatum	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	0.77 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
3300005840\|Ga0068870_10910726	Not Available	622	Open in IMG/M
3300006881\|Ga0068865_101889318	Not Available	541	Open in IMG/M
3300009148\|Ga0105243_12630685	Not Available	543	Open in IMG/M
3300013296\|Ga0157374_11238246	Not Available	768	Open in IMG/M
3300013297\|Ga0157378_11176194	Not Available	806	Open in IMG/M
3300013297\|Ga0157378_11742728	Not Available	670	Open in IMG/M
3300013297\|Ga0157378_12234433	Not Available	598	Open in IMG/M
3300015267\|Ga0182122_1067906	Not Available	512	Open in IMG/M
3300015268\|Ga0182154_1062019	Not Available	529	Open in IMG/M
3300015275\|Ga0182172_1047383	Not Available	580	Open in IMG/M
3300015276\|Ga0182170_1024247	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	700	Open in IMG/M
3300015277\|Ga0182128_1078383	Not Available	505	Open in IMG/M
3300015279\|Ga0182174_1030742	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	678	Open in IMG/M
3300015281\|Ga0182160_1007130	Not Available	994	Open in IMG/M
3300015281\|Ga0182160_1077284	Not Available	515	Open in IMG/M
3300015282\|Ga0182124_1065118	Not Available	539	Open in IMG/M
3300015283\|Ga0182156_1077487	Not Available	522	Open in IMG/M
3300015285\|Ga0182186_1048937	Not Available	589	Open in IMG/M
3300015286\|Ga0182176_1007056	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	1144	Open in IMG/M
3300015287\|Ga0182171_1029140	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	692	Open in IMG/M
3300015287\|Ga0182171_1051024	Not Available	593	Open in IMG/M
3300015287\|Ga0182171_1073562	Not Available	532	Open in IMG/M
3300015288\|Ga0182173_1039061	Not Available	633	Open in IMG/M
3300015288\|Ga0182173_1075986	Not Available	523	Open in IMG/M
3300015289\|Ga0182138_1062216	Not Available	560	Open in IMG/M
3300015295\|Ga0182175_1070964	Not Available	557	Open in IMG/M
3300015296\|Ga0182157_1058409	Not Available	599	Open in IMG/M
3300015298\|Ga0182106_1023487	Not Available	778	Open in IMG/M
3300015299\|Ga0182107_1089014	Not Available	529	Open in IMG/M
3300015300\|Ga0182108_1029035	Not Available	741	Open in IMG/M
3300015300\|Ga0182108_1077601	Not Available	556	Open in IMG/M
3300015300\|Ga0182108_1103844	Not Available	507	Open in IMG/M
3300015302\|Ga0182143_1029966	Not Available	727	Open in IMG/M
3300015302\|Ga0182143_1105123	Not Available	501	Open in IMG/M
3300015303\|Ga0182123_1089072	Not Available	518	Open in IMG/M
3300015303\|Ga0182123_1092155	Not Available	513	Open in IMG/M
3300015303\|Ga0182123_1096102	Not Available	507	Open in IMG/M
3300015303\|Ga0182123_1097375	Not Available	505	Open in IMG/M
3300015304\|Ga0182112_1013991	Not Available	901	Open in IMG/M
3300015305\|Ga0182158_1092507	Not Available	522	Open in IMG/M
3300015307\|Ga0182144_1045674	Not Available	653	Open in IMG/M
3300015308\|Ga0182142_1035473	Not Available	717	Open in IMG/M
3300015308\|Ga0182142_1046941	Not Available	661	Open in IMG/M
3300015308\|Ga0182142_1062583	Not Available	608	Open in IMG/M
3300015308\|Ga0182142_1067384	Not Available	594	Open in IMG/M
3300015314\|Ga0182140_1025446	Not Available	789	Open in IMG/M
3300015314\|Ga0182140_1046052	Not Available	667	Open in IMG/M
3300015314\|Ga0182140_1068669	Not Available	593	Open in IMG/M
3300015322\|Ga0182110_1122325	Not Available	505	Open in IMG/M
3300015341\|Ga0182187_1148431	Not Available	561	Open in IMG/M
3300015342\|Ga0182109_1025035	Not Available	1096	Open in IMG/M
3300015342\|Ga0182109_1159895	Not Available	572	Open in IMG/M
3300015343\|Ga0182155_1033428	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays	979	Open in IMG/M
3300015343\|Ga0182155_1149965	Not Available	585	Open in IMG/M
3300015343\|Ga0182155_1171368	Not Available	557	Open in IMG/M
3300015343\|Ga0182155_1193158	Not Available	532	Open in IMG/M
3300015343\|Ga0182155_1210139	Not Available	515	Open in IMG/M
3300015344\|Ga0182189_1073444	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	765	Open in IMG/M
3300015344\|Ga0182189_1115248	Not Available	651	Open in IMG/M
3300015344\|Ga0182189_1194529	Not Available	535	Open in IMG/M
3300015345\|Ga0182111_1231905	Not Available	513	Open in IMG/M
3300015346\|Ga0182139_1093395	Not Available	727	Open in IMG/M
3300015346\|Ga0182139_1222040	Not Available	523	Open in IMG/M
3300015346\|Ga0182139_1243566	Not Available	503	Open in IMG/M
3300015347\|Ga0182177_1144554	Not Available	620	Open in IMG/M
3300015347\|Ga0182177_1149767	Not Available	612	Open in IMG/M
3300015351\|Ga0182161_1148940	Not Available	635	Open in IMG/M
3300015351\|Ga0182161_1153984	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	627	Open in IMG/M
3300015351\|Ga0182161_1166794	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	608	Open in IMG/M
3300015351\|Ga0182161_1192980	Not Available	574	Open in IMG/M
3300015355\|Ga0182159_1161758	Not Available	703	Open in IMG/M
3300015355\|Ga0182159_1216600	Not Available	621	Open in IMG/M
3300015361\|Ga0182145_1028922	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays	936	Open in IMG/M
3300015361\|Ga0182145_1105902	Not Available	617	Open in IMG/M
3300015361\|Ga0182145_1180846	Not Available	515	Open in IMG/M
3300015361\|Ga0182145_1195006	Not Available	502	Open in IMG/M
3300017407\|Ga0182220_1054783	Not Available	610	Open in IMG/M
3300017407\|Ga0182220_1092372	Not Available	527	Open in IMG/M
3300017409\|Ga0182204_1059566	Not Available	622	Open in IMG/M
3300017409\|Ga0182204_1090420	Not Available	549	Open in IMG/M
3300017410\|Ga0182207_1030431	Not Available	889	Open in IMG/M
3300017410\|Ga0182207_1083755	Not Available	647	Open in IMG/M
3300017413\|Ga0182222_1076701	Not Available	550	Open in IMG/M
3300017417\|Ga0182230_1084583	Not Available	576	Open in IMG/M
3300017420\|Ga0182228_1094899	Not Available	562	Open in IMG/M
3300017424\|Ga0182219_1041270	Not Available	734	Open in IMG/M
3300017424\|Ga0182219_1094148	Not Available	570	Open in IMG/M
3300017424\|Ga0182219_1113098	Not Available	538	Open in IMG/M
3300017425\|Ga0182224_1040031	Not Available	784	Open in IMG/M
3300017425\|Ga0182224_1067729	Not Available	669	Open in IMG/M
3300017427\|Ga0182190_1107632	Not Available	583	Open in IMG/M
3300017430\|Ga0182192_1024485	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	976	Open in IMG/M
3300017433\|Ga0182206_1079621	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	628	Open in IMG/M
3300017436\|Ga0182209_1098769	Not Available	605	Open in IMG/M
3300017438\|Ga0182191_1043376	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	809	Open in IMG/M
3300017442\|Ga0182221_1107437	Not Available	581	Open in IMG/M
3300017443\|Ga0182193_1108426	Not Available	619	Open in IMG/M
3300017683\|Ga0182218_1062597	Not Available	663	Open in IMG/M
3300017683\|Ga0182218_1109197	Not Available	560	Open in IMG/M
3300017684\|Ga0182225_1044402	Not Available	725	Open in IMG/M
3300017684\|Ga0182225_1079382	Not Available	606	Open in IMG/M
3300017684\|Ga0182225_1088714	Not Available	586	Open in IMG/M
3300017684\|Ga0182225_1110053	Not Available	548	Open in IMG/M
3300017686\|Ga0182205_1066309	Not Available	691	Open in IMG/M
3300017686\|Ga0182205_1113065	Not Available	580	Open in IMG/M
3300021060\|Ga0182232_1066979	Not Available	588	Open in IMG/M
3300025938\|Ga0207704_10851644	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	764	Open in IMG/M
3300025942\|Ga0207689_11731824	Not Available	517	Open in IMG/M

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:

Habitat	Taxonomy	Distribution
Host-Associated	Host-Associated	100.00%

Habitat	Taxonomy	Distribution
Plants	Host-Associated → Plants	100.00%

Habitat	Taxonomy	Distribution
Phyllosphere	Host-Associated → Plants → Phyllosphere	93.08%
Rhizosphere	Host-Associated → Plants → Rhizosphere	3.85%
Rhizoplane	Host-Associated → Plants → Rhizoplane	3.08%

Habitat	Taxonomy	Distribution
Unclassified	Host-Associated → Plants → Phyllosphere → Unclassified	93.08%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	3.85%
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	3.08%

Habitat	Taxonomy	Distribution
Unclassified	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified	93.08%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	3.85%
Unclassified	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified	3.08%

Habitat	Taxonomy	Distribution
Miscanthus Phyllosphere	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Miscanthus Phyllosphere	92.31%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere	3.08%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	3.08%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	0.77%
Phyllosphere	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Phyllosphere	0.77%

Visualization

Powered by ApexCharts

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
3300005840	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2	Host-Associated	Open in IMG/M
3300006881	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2	Host-Associated	Open in IMG/M
3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Host-Associated	Open in IMG/M
3300013296	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG	Host-Associated	Open in IMG/M
3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Host-Associated	Open in IMG/M
3300015267	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015268	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015269	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015275	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015276	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015277	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015279	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015281	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015282	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015283	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015285	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015286	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015287	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015288	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015289	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015292	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015295	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015296	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015298	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015299	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015300	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015302	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015303	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015304	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015305	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015307	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015308	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015314	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015322	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015323	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015341	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015342	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015343	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015344	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015345	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015346	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015347	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015351	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015355	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015361	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300017407	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017409	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017410	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017413	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017417	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_07NOV2016_LD1 MG	Host-Associated	Open in IMG/M
3300017420	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_07NOV2016_LD1 MG	Host-Associated	Open in IMG/M
3300017424	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017425	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017427	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300017430	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300017433	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017436	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017438	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300017442	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017443	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300017683	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017684	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017686	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300021060	Phyllosphere microbial comminities from miscanthus, Michigan, USA - G6R3_NF_07NOV2016_LD2 MG	Host-Associated	Open in IMG/M
3300025938	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes)	Host-Associated	Open in IMG/M
3300025942	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes)	Host-Associated	Open in IMG/M

Geographical Distribution

Zoom:	Powered by OpenStreetMap

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
Ga0068870_109107262	3300005840	Miscanthus Rhizosphere	MRDIRASLPPVPEDAQWRAVNRAYAEAQKKRKDAKTAKRK
Ga0068865_1018893181	3300006881	Miscanthus Rhizosphere	VCSSPPPVPEDAGQRAINRAHADAQKKRKDAKAAKRTKHILARE
Ga0105243_126306851	3300009148	Miscanthus Rhizosphere	MRDVRSSPPPVPEDARRRAINRAHADAQKKRKDAKAAKR
Ga0157374_112382462	3300013296	Miscanthus Rhizosphere	MRDVRASPPPVPEDARRRVINRPHAEAQKKWKDAKAAKRMK*
Ga0157378_111761942	3300013297	Miscanthus Rhizosphere	MRDVRASPPPVPEDARRQAANQAHTEAQKKKKDAEAA
Ga0157378_117427281	3300013297	Miscanthus Rhizosphere	MRDVHSSLLPVPEDARQRAINHAHGDAQKKRKDTKAAKRTK*
Ga0157378_122344331	3300013297	Miscanthus Rhizosphere	MRDVRASPPPVPEDARWRAANRAHAEAQKKKKDAKEARRNKKIL
Ga0182122_10581471	3300015267	Miscanthus Phyllosphere	MRDVRASPPPIPEDTRRRAINQAHAEAQKKWKDTKAAKRMKKILAHEELDKRCR*
Ga0182122_10679061	3300015267	Miscanthus Phyllosphere	PVPEDVRQRAANRAYVEAQKKKKDVEAAKRTRKILERE*
Ga0182154_10620192	3300015268	Miscanthus Phyllosphere	MRDIRSSLPPVPKDARRWAINRAHADAQKRQKDAKAAKRTKQIL
Ga0182113_10369001	3300015269	Miscanthus Phyllosphere	MRDVRASPPPVPEDAGRRAKNRAYVEAYKKRKDAKEARHNRKILEHEELEKRRRQ*
Ga0182172_10473831	3300015275	Miscanthus Phyllosphere	MRDVRSSPPPIPEDARRQVINWVHADAQKKWKDAKVAKR
Ga0182170_10242471	3300015276	Miscanthus Phyllosphere	MRDVRASPLPVPEDAERRAVNQAHAEAQKKKKDAEEAKHKRKNLK
Ga0182128_10507811	3300015277	Miscanthus Phyllosphere	MRDVRSSPRPVLEDAERRAVNRAHADAQKRRKDAKAAKRTKHILA
Ga0182128_10783831	3300015277	Miscanthus Phyllosphere	MRDVRASPPLVPEDAERRAVNQAHTEAQKKKKDVEEAKRKRRNLKHE*
Ga0182174_10307422	3300015279	Miscanthus Phyllosphere	MRDIRASLPPIPEDAQRRAVNRAYAEAQKKRKDAKTA
Ga0182160_10071302	3300015281	Miscanthus Phyllosphere	MRDVRSSPPPVPEDTRRWAINRAHADAQKKRKDAKAAKRTK*
Ga0182160_10772842	3300015281	Miscanthus Phyllosphere	MRDVRSSPPPVPEDTGRRAINRAHADAQKRQKDAKAAKRMKH
Ga0182124_10298042	3300015282	Miscanthus Phyllosphere	MRDVRASLPPVPEDARRRATNRAHAEAQKKKKDAEAAKRTRKILEHE*
Ga0182124_10651181	3300015282	Miscanthus Phyllosphere	MRDVRSSPPPVLEDARWRAINRTHANAQKKRKDAKVAKRTKHILV
Ga0182156_10774871	3300015283	Miscanthus Phyllosphere	MRDVRASPPPVPEDARWRAANRAHTEAQKKKKDAE
Ga0182156_10777321	3300015283	Miscanthus Phyllosphere	MRDVRASPPPVPKGAGRRAKNRAYAEVCKKWKDAKEARRNRKILEREELEKRRQQ*
Ga0182186_10489372	3300015285	Miscanthus Phyllosphere	MRDVRSSPPPVLEDAERRAVNRAHADAQKRRKDAKAAKR
Ga0182176_10070561	3300015286	Miscanthus Phyllosphere	MRDIRASLPPVPEDAQRRAVNRSYAEAQKKRKDAKTAKR
Ga0182171_10291401	3300015287	Miscanthus Phyllosphere	MRDVQASPPPVPEDAERWAVNRAHAEAQKKWKDTEEARRK
Ga0182171_10510241	3300015287	Miscanthus Phyllosphere	MRDVRASPPPVPEDARRRAANRAYAKAQKKKDAEAAKCTRKILEREQLDKCRR*
Ga0182171_10735621	3300015287	Miscanthus Phyllosphere	VRSSPPPVPEDAGWRAINRAHADAHKRRKDAKAVKRTKHILA
Ga0182173_10390611	3300015288	Miscanthus Phyllosphere	MRDVRASPPPVPEDARRRAANRAYAEAQKKKKDAEAAKRTRKILERE*
Ga0182173_10759861	3300015288	Miscanthus Phyllosphere	MRDVRACPPPVPEDAARRAVNQAHAEAQKKKKDADE
Ga0182138_10622161	3300015289	Miscanthus Phyllosphere	MRDVRSSPPPVPEDAGRRAVNRAHADAQKRQKDAKAAKRTKHIL
Ga0182141_10284162	3300015292	Miscanthus Phyllosphere	MRDVRASLPPVPEDARRRAINRAHAEAQKKRKDAKVAKRTKQILAREKLDEHRR*
Ga0182141_10686102	3300015292	Miscanthus Phyllosphere	MRDVRASLPPVPEDAERWAVNRAHAEAQKMRKDAEEARCKRKNLEHE*
Ga0182175_10709641	3300015295	Miscanthus Phyllosphere	MRSSPPPVSEDARRRAINRAHADMQKKWKDAKAAKRTKKIL
Ga0182157_10584091	3300015296	Miscanthus Phyllosphere	MRDVRASPPSVPKDAERRAVNRAHAEAQKKRKDTEEAKHKR
Ga0182106_10234871	3300015298	Miscanthus Phyllosphere	MRDVRASPPPVPEDAAWWVVNRAHAEAQKKRKDAKEAKRMRKIL
Ga0182107_10890141	3300015299	Miscanthus Phyllosphere	MRDVRASPPPVPEDAVRRATNRAYAETCKKRKDTKEAKRTKKILECEK
Ga0182108_10290352	3300015300	Miscanthus Phyllosphere	MRDVRATPPPVPEDARRRAINRAHAEAQKKWKDAKAAKRTK*
Ga0182108_10776012	3300015300	Miscanthus Phyllosphere	MRDVRDSPPPIPEDVRRRAANQAHAEAQKKKKDAKEAR
Ga0182108_11038442	3300015300	Miscanthus Phyllosphere	MRDVRASPPPVPEDAARWAANQAHVEAQKKRKDAEE
Ga0182143_10299663	3300015302	Miscanthus Phyllosphere	MRDVRASPPPIPEDARRRATNRAHAEAQKKKKDAKEARRNNKIFEREALEKCS
Ga0182143_11051231	3300015302	Miscanthus Phyllosphere	MRDIRASPPLVPEDTQRRASNRAYAEAQKKKKDAKTAKR
Ga0182123_10890722	3300015303	Miscanthus Phyllosphere	MRDVRASPPPVPEDATRRAMNRAHAEAQKKKKDAEEAKCKRKN
Ga0182123_10921551	3300015303	Miscanthus Phyllosphere	MRDVRASPPPVPEDAKRRAVNRAHTEAQKKKKDAEEAK
Ga0182123_10961021	3300015303	Miscanthus Phyllosphere	MRDVRASPPPVLEDARQRAINWAHADVQKKRKDAEA
Ga0182123_10973751	3300015303	Miscanthus Phyllosphere	MRDVHSSLPPVPEDARRRAINCAHADAQKKQKDAKAAKRTK*
Ga0182112_10139912	3300015304	Miscanthus Phyllosphere	MRDVRASWLPVPEDVERRAVNRAHAEAQKKKKDAEEAKRKREEP*
Ga0182158_10925072	3300015305	Miscanthus Phyllosphere	MRDVRASPPPVLKDARRRAINQAHAEAQKKRKDAKVAKRTKQILVREKLDERRR*
Ga0182144_10456741	3300015307	Miscanthus Phyllosphere	MRDVRASPPPVPEDARRWAINRAHTEAQKKWKDAKADKRTKQILV
Ga0182142_10354731	3300015308	Miscanthus Phyllosphere	MRDVRASPPPIPEDAKRRAVNRAHAEAQKKKKDVEEAKRK
Ga0182142_10469411	3300015308	Miscanthus Phyllosphere	MRDVRSSPPPVPEDAGRRAVNRAHADAQKRQKDAKAAKRTKHI
Ga0182142_10625831	3300015308	Miscanthus Phyllosphere	MRDVRASPPPVLEDARRRAINRVHAEAQKKWKDAKAAKRMKQILA
Ga0182142_10673841	3300015308	Miscanthus Phyllosphere	MRDVRASPPPVPEDVRRRAINRAHAEAQKKRKDAKAAKRTKHIL
Ga0182140_10254462	3300015314	Miscanthus Phyllosphere	MRDVQASPPPVLEDAEQRAVNQAHTEAQKKRKDTEEAKRKRKN
Ga0182140_10460522	3300015314	Miscanthus Phyllosphere	MRDVRDSPPPIPEDARRRAVNRGHAEAQKKKKDAKEARRNKNILEHEALEKCHR
Ga0182140_10686691	3300015314	Miscanthus Phyllosphere	MRDVRASPPPVPEDARRRAANRAHAEAQKKNKDAEAAKRTRKILERE*
Ga0182110_10525841	3300015322	Miscanthus Phyllosphere	MRDVRASPPPVPEDAGRRAKNRAYVEAYKKRKDAKEARHNRKILERE*
Ga0182110_10964331	3300015322	Miscanthus Phyllosphere	MRDVRASPPPVPKDARRRAANRAHAEVQKRRKDAKVAKCTKKILAREELEKR*
Ga0182110_11223251	3300015322	Miscanthus Phyllosphere	MRDVRASPPPVLEDARRRAANRVHAEAQKKKKDAEVAKRTRKILERE*
Ga0182129_10142131	3300015323	Miscanthus Phyllosphere	MRDVRASLPPVPEDVRRRAINWAHAEAQKKRKDAKAAKCTKQILAREKLDEH
Ga0182129_10671162	3300015323	Miscanthus Phyllosphere	MRDVRASPPPVPEDARRRVANRAHAEAQKKKKDAEVAKRIRKILESEQLDKR
Ga0182187_11484312	3300015341	Miscanthus Phyllosphere	MRDVRASPPPVPEDTRRRAINRAHTEAQKKWKDAKAAKRKK*
Ga0182109_10250352	3300015342	Miscanthus Phyllosphere	MRDVRASPPPVPEDAERRAVNRAHAEVQKKKKNAD*
Ga0182109_11598951	3300015342	Miscanthus Phyllosphere	MRDVRASPPPVPEDVRRRAVNRVNTEAQKKRKDAEAAKRT
Ga0182155_10334282	3300015343	Miscanthus Phyllosphere	MRDMRASPPPIPEDAEQQAVNRAHVEAQKKRKDAEGAKRTRK
Ga0182155_11499653	3300015343	Miscanthus Phyllosphere	MRAVRASPPPVPEDVELRAVNRAHAEAQKKKDAEEAKR
Ga0182155_11713682	3300015343	Miscanthus Phyllosphere	MRDVRASPPPVPEDARRRAANRAHAEAQKKKKDARAAK
Ga0182155_11931581	3300015343	Miscanthus Phyllosphere	MRNVRDSPPPIPEDARQQTVNRAHAEAQKKRKDAKVVKHT
Ga0182155_12101391	3300015343	Miscanthus Phyllosphere	MRDVRASPPPVPKDARRRVANRAHAEAQKKKKDAKE
Ga0182189_10734441	3300015344	Miscanthus Phyllosphere	MRDVRASPPPVPEDAVRRAANRTRAEAQKKRKDAEEAKRTRKILER
Ga0182189_11152481	3300015344	Miscanthus Phyllosphere	SPPPVPEDTRRRTINRAHAEAQKKWKDAKAAKRKK*
Ga0182189_11945291	3300015344	Miscanthus Phyllosphere	MRDVRSSPPPVPEDAGQRAINRAHTDAQKKRKDAKAAKRMKHIL
Ga0182111_12319051	3300015345	Miscanthus Phyllosphere	MRDVRSSPPPVPKDARRRAINRAHANAQKKQKDAKAAKRTKKILVREELDK
Ga0182139_10507761	3300015346	Miscanthus Phyllosphere	MRDVRASLPPVPEDARRRATNRAHAEAQKNKKDAKEARRNKKILEHEALEKRR*
Ga0182139_10933951	3300015346	Miscanthus Phyllosphere	MRDVRASPPPNLEDARRRAANRAHAEAQKKKKDARAAKRDKMILEREALEKR
Ga0182139_10982471	3300015346	Miscanthus Phyllosphere	MRDVRASPPPVPEDARRRAANQAHAEAQKKKKDAEAAKRTRKILERE*
Ga0182139_12220401	3300015346	Miscanthus Phyllosphere	MRDVRASPPPVPEDARRRAANRAHAEAQKKKKDTRAAKRDKKI
Ga0182139_12435662	3300015346	Miscanthus Phyllosphere	MRDVRASPPPIPEDAKWQVVNRAHAEAYKKKKDAEEAKRKR
Ga0182177_11445541	3300015347	Miscanthus Phyllosphere	MRDVRDSLPPVPEDARRRAANRAYAEAQKKKKDAEAAKRTRKILECEQLDKHR*
Ga0182177_11497672	3300015347	Miscanthus Phyllosphere	MRDVRDSPPPVPEDARRWAVNRAHAEAQKKKDAKEARRNKKILEREALEKHHR
Ga0182161_11489402	3300015351	Miscanthus Phyllosphere	MRDVRASPPPVPEDARRRAANRAHAEVQKKKKDAEAAKRTTKILERE*
Ga0182161_11539842	3300015351	Miscanthus Phyllosphere	MRDVRSSPAPVPEDAERRAVNRAHADAQKRRKDAKAAK
Ga0182161_11667942	3300015351	Miscanthus Phyllosphere	MRDVQASPPPVPEDAKRRAVNRAHAEAQKKKKDAEEAKRKG
Ga0182161_11929802	3300015351	Miscanthus Phyllosphere	VRASPPPVPEDARWRAVNRAHTEAQKRRKDAKVARR
Ga0182159_11617581	3300015355	Miscanthus Phyllosphere	VRASPPLVPEDARWRAANRAHAEAQKKKKDTRAAKRD
Ga0182159_12166002	3300015355	Miscanthus Phyllosphere	SPPPVLEDARRRAANRVHAEAQKKKKDAEVAKRTRKILERE*
Ga0182159_12279151	3300015355	Miscanthus Phyllosphere	MRDVRSSPLPVLEDAERRAVNRAHADAQKRRKDAKAAKRTKHILAR
Ga0182159_12455331	3300015355	Miscanthus Phyllosphere	MRDMRDSPLPIPEDAQRRAANRAHAEAQKRQKDAEVAKRTTKILAREELEKRRRQ*
Ga0182145_10289223	3300015361	Miscanthus Phyllosphere	MRDVRASPPPVPKDVEWWAVNRAHAEAQKRWKDAAEAKRKRK
Ga0182145_11059022	3300015361	Miscanthus Phyllosphere	MRDVRASPPPVPEDARRRAANRAHAEVQKKKKDAEAAKRTRKILERE
Ga0182145_11779321	3300015361	Miscanthus Phyllosphere	MRDVRASLPPVPEDVRRRAINWAHAEAQKKRKDAKAAKCTKQILAREKLDEHRRQ
Ga0182145_11808461	3300015361	Miscanthus Phyllosphere	MRDVRASPPPVPKDARWRAINRAHAEAQKKRKDAKVAKRMKQILA
Ga0182145_11950061	3300015361	Miscanthus Phyllosphere	MRDVRASPPPIPEDTRRRAINQAHAEAQKKWKDTKAAKRMKKILAH
Ga0182220_10547832	3300017407	Miscanthus Phyllosphere	VRSSPPPVPEDAGQRAINRAHADVQKKRKDAKAAKRMKHILARE
Ga0182220_10923721	3300017407	Miscanthus Phyllosphere	LPFLQWMRDVRASPPPVPKDVEWWAANRAHAEAYKEQKDAEEARRKRK
Ga0182204_10595662	3300017409	Miscanthus Phyllosphere	MRASLLPVPEDTRRRAINRAHAEAQKKRKDAKAVKRTK
Ga0182204_10904201	3300017409	Miscanthus Phyllosphere	MRDVRASPPPVPEDVERRVVNRAHAEAQKRWKDAKE
Ga0182204_10924581	3300017409	Miscanthus Phyllosphere	VRASPPPVLKDAGRQAKNRAYAEAYKKGKDAKEARRNRKILEREELEKRHRQ
Ga0182207_10304312	3300017410	Miscanthus Phyllosphere	MRDVRAYPPPVPEDARRRAINRAHAEAQEKWKDAKAAKRTKQILVR
Ga0182207_10837551	3300017410	Miscanthus Phyllosphere	MRDVRDSPPPVPEDARWRAANRAHAEAQKKKKDARAAKCDKKILEREALEKC
Ga0182222_10719062	3300017413	Miscanthus Phyllosphere	MRDVRASLPPVPEDARRRAVNRAYAEAQKNKKDAEVAKRTRKILERE
Ga0182222_10767011	3300017413	Miscanthus Phyllosphere	MRDVRSSPPPVPEDARRRVINRAYADVNKKWKDAKAAKRTKQILARE
Ga0182230_10845831	3300017417	Miscanthus Phyllosphere	VRASPPPVPEDAGRRAKNRAYAEAYKKRKDTKEARRNRKILE
Ga0182228_10948993	3300017420	Miscanthus Phyllosphere	MRDVHASPLPVPEDARWQAINRAHAEAQKKRKDAKAAKR
Ga0182219_10412702	3300017424	Miscanthus Phyllosphere	VRASPPPVPEDARRRVINRAHAEAQKKQKDVKAAKRTKKILAHEELDKRRRQ
Ga0182219_10941482	3300017424	Miscanthus Phyllosphere	MRDVRTSPSPVPKDARRRAINRAHVEAQKKWKDAKVAKRTKK
Ga0182219_11130981	3300017424	Miscanthus Phyllosphere	VRASLSPVPEDARRWAINRAHAEAQKKWKDAKAAKRTKQIL
Ga0182224_10400311	3300017425	Miscanthus Phyllosphere	VRSSPPPVPKDAQRRAMNRVYAEEQKKKKDAKEAR
Ga0182224_10677292	3300017425	Miscanthus Phyllosphere	MRDVRASPPPVPEDVRRWAVNWAYAEAQKKKKDAEAAKRTRKILERE
Ga0182190_11076321	3300017427	Miscanthus Phyllosphere	LQGMRDVRASPPLVPEDAERRAVNQAHTEAQKKKKDVEEAKRKRRNLKHE
Ga0182192_10244852	3300017430	Miscanthus Phyllosphere	MRDVRSSPPPIPEDARRRAINHAHADAQKKRKDAKAAKR
Ga0182192_11186072	3300017430	Miscanthus Phyllosphere	VRSSPPPVPEDARRRAINRAHADAQKKWKDTEAAKRTKKILVHEELDK
Ga0182206_10796212	3300017433	Miscanthus Phyllosphere	MRDVRASPPPIPEDAVRRAVNQTRAKVQKKRKDAKEA
Ga0182209_10987692	3300017436	Miscanthus Phyllosphere	VRASPPPVPEDARRRVANRAHAEAQKKKKDAKVARRN
Ga0182191_10433761	3300017438	Miscanthus Phyllosphere	MRDGRAAPPPGPKDARRRAINRAHAEAQKKWKDAKATKRTKKILTREE
Ga0182221_10925331	3300017442	Miscanthus Phyllosphere	VRASLPPVPEDARRRAVNRAHAEAQKKKKDAEVAKHTRKILEREQLDKRRR
Ga0182221_11074372	3300017442	Miscanthus Phyllosphere	VRASPPPVPKDAARQAANRAHAEAQKKRKDTKQAK
Ga0182193_11084261	3300017443	Miscanthus Phyllosphere	VRASPPPVPEDIERRAVNRAHTEAQKKQKDAEEAKRKRKIL
Ga0182218_10625971	3300017683	Miscanthus Phyllosphere	VRASPPPVPEDARRRAVNRAHAEAQKKKKDARIAKRDKKILEREALEK
Ga0182218_10972183	3300017683	Miscanthus Phyllosphere	MYLQGMRDMRASPPPVPEDVRRRAANQAHAEEAKHKKKILEREELEKHCW
Ga0182218_11091972	3300017683	Miscanthus Phyllosphere	VRSSPPPVPEDAGQRAINRAHADAQKKRKDAKAAKR
Ga0182225_10444022	3300017684	Miscanthus Phyllosphere	MRDVRTSPSPVPKDARRRAINRAHAEAQEKWKDAKAAKRTKQILVR
Ga0182225_10793821	3300017684	Miscanthus Phyllosphere	VRASLPPIPKDARRWVANRADAEVQKRWKDAKVAKRTKTIL
Ga0182225_10887142	3300017684	Miscanthus Phyllosphere	MRDSSPPVPEDARRRVANRVHAEAQKRRKDAEVVKRTRKILA
Ga0182225_11100532	3300017684	Miscanthus Phyllosphere	VRSSLPPILDDARRRAINRAHADAQKKQKDAKVAK
Ga0182205_10663091	3300017686	Miscanthus Phyllosphere	MRDVRDSPPPVPEDARQWAANRAHAEAQKKKKDAKEARRNKKILEREAL
Ga0182205_11130652	3300017686	Miscanthus Phyllosphere	VRASPPPVPEDARQQAANRAHAEAQKKTKDARAAKSDKKILE
Ga0182205_11537092	3300017686	Miscanthus Phyllosphere	MRDIRASLPPVPEDAQRRAVNRAYAEAQKKREDAKTAKRKTKIIEHDALEKRRRK
Ga0182232_10669791	3300021060	Phyllosphere	VRSSPPPVLEDAERRAVNRAHADAQKRRKDAKAVKHT
Ga0207704_108516441	3300025938	Miscanthus Rhizosphere	VRSSPPPVPEDAERRAVNRAHADAQKRRKDAKAAK
Ga0207689_117318242	3300025942	Miscanthus Rhizosphere	VRASPPPVPKDARRWAANRAHVEAQKKKKDAEAAKRTRKIL

Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome Family F062506

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Gene Neighborhood

Neighboring Pfam domains

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences