NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F062479

Metagenome / Metatranscriptome Family F062479

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F062479
Family Type Metagenome / Metatranscriptome
Number of Sequences 130
Average Sequence Length 121 residues
Representative Sequence MLSCNKERRLNKDLQGTWEVDMVKLQDADGFSFFDYNPTGNLNISDTSVQGEITSLFQSFQGSVADTLALQGSYLLKLNESELNWVQSPDTIKNRIFVITNKNLEIEYYDAQAQQRLRYVFVKLK
Number of Associated Samples 114
Number of Associated Scaffolds 130

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 42.64 %
% of genes near scaffold ends (potentially truncated) 38.46 %
% of genes from short scaffolds (< 2000 bps) 74.62 %
Associated GOLD sequencing projects 100
AlphaFold2 3D model prediction No

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (50.769 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine
(43.077 % of family members)
Environment Ontology (ENVO) Unclassified
(42.308 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Water (saline)
(47.692 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 6.40%    β-sheet: 43.20%    Coil/Unstructured: 50.40%
Feature Viewer
Powered by Feature Viewer


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 130 Family Scaffolds
PF01883FeS_assembly_P 28.46
PF02657SufE 10.00
PF00266Aminotran_5 9.23
PF13568OMP_b-brl_2 4.62
PF08665PglZ 1.54
PF08811DUF1800 0.77
PF01966HD 0.77
PF07726AAA_3 0.77
PF04536TPM_phosphatase 0.77
PF13635DUF4143 0.77

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 130 Family Scaffolds
COG2166Sulfur transfer protein SufE, Fe-S cluster assemblyPosttranslational modification, protein turnover, chaperones [O] 10.00
COG5267Uncharacterized conserved protein, DUF1800 familyFunction unknown [S] 0.77


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms50.77 %
UnclassifiedrootN/A49.23 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000882|FwDRAFT_10451732Not Available624Open in IMG/M
3300001838|RCM33_1018006All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Crocinitomicaceae → Fluviicola → Fluviicola taffensis1001Open in IMG/M
3300002835|B570J40625_100708336Not Available900Open in IMG/M
3300005662|Ga0078894_10120367All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Crocinitomicaceae2335Open in IMG/M
3300005662|Ga0078894_10149733All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Crocinitomicaceae → Fluviicola → Fluviicola taffensis2095Open in IMG/M
3300007162|Ga0079300_10013216All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes3064Open in IMG/M
3300007545|Ga0102873_1008609All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Crocinitomicaceae3159Open in IMG/M
3300007545|Ga0102873_1150633Not Available700Open in IMG/M
3300007546|Ga0102874_1018896All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales2259Open in IMG/M
3300007547|Ga0102875_1033739All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes1681Open in IMG/M
3300007548|Ga0102877_1014066All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes2364Open in IMG/M
3300007549|Ga0102879_1012683All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Crocinitomicaceae → Fluviicola → Fluviicola taffensis2896Open in IMG/M
3300007550|Ga0102880_1169607Not Available570Open in IMG/M
3300007551|Ga0102881_1093534Not Available834Open in IMG/M
3300007557|Ga0102821_1087583Not Available795Open in IMG/M
3300007560|Ga0102913_1091547Not Available988Open in IMG/M
3300007585|Ga0102916_1018380All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes1728Open in IMG/M
3300007590|Ga0102917_1016270All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Crocinitomicaceae → Fluviicola → Fluviicola taffensis2556Open in IMG/M
3300007593|Ga0102918_1027510All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes1575Open in IMG/M
3300007597|Ga0102919_1053080All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes1266Open in IMG/M
3300007597|Ga0102919_1263393Not Available537Open in IMG/M
3300007603|Ga0102921_1012558All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes3143Open in IMG/M
3300007603|Ga0102921_1016728All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes2712Open in IMG/M
3300007606|Ga0102923_1196947All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Myroides → unclassified Myroides → Myroides sp. NP-2626Open in IMG/M
3300007617|Ga0102897_1007307All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Crocinitomicaceae → Fluviicola → Fluviicola taffensis3505Open in IMG/M
3300007618|Ga0102896_1150828Not Available743Open in IMG/M
3300007620|Ga0102871_1096559Not Available850Open in IMG/M
3300007625|Ga0102870_1127718Not Available735Open in IMG/M
3300007629|Ga0102895_1035795All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes1266Open in IMG/M
3300007630|Ga0102903_1070318All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales974Open in IMG/M
3300007630|Ga0102903_1193288Not Available553Open in IMG/M
3300007632|Ga0102894_1087190Not Available820Open in IMG/M
3300007634|Ga0102901_1022803All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales1813Open in IMG/M
3300007642|Ga0102876_1113994Not Available729Open in IMG/M
3300007644|Ga0102902_1065560All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales1087Open in IMG/M
3300007651|Ga0102900_1074456All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Myroides → unclassified Myroides → Myroides sp. NP-2725Open in IMG/M
3300007706|Ga0102899_1073164All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Myroides → unclassified Myroides → Myroides sp. NP-2825Open in IMG/M
3300007716|Ga0102867_1061826Not Available988Open in IMG/M
3300008107|Ga0114340_1200519Not Available670Open in IMG/M
3300008114|Ga0114347_1003127All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Crocinitomicaceae13416Open in IMG/M
3300008114|Ga0114347_1011525All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Crocinitomicaceae → Fluviicola → Fluviicola taffensis4434Open in IMG/M
3300008114|Ga0114347_1031425All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes2401Open in IMG/M
3300008964|Ga0102889_1061269All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes1136Open in IMG/M
3300008996|Ga0102831_1019417All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Crocinitomicaceae2330Open in IMG/M
3300009024|Ga0102811_1247919Not Available665Open in IMG/M
3300009059|Ga0102830_1203180Not Available580Open in IMG/M
3300009068|Ga0114973_10072495All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes1988Open in IMG/M
3300009079|Ga0102814_10605471Not Available600Open in IMG/M
3300009086|Ga0102812_10717816Not Available551Open in IMG/M
3300009152|Ga0114980_10026802All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Crocinitomicaceae → Fluviicola → Fluviicola taffensis3572Open in IMG/M
3300009158|Ga0114977_10412233Not Available751Open in IMG/M
3300009184|Ga0114976_10637064Not Available538Open in IMG/M
3300009187|Ga0114972_10138655All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales1556Open in IMG/M
3300010312|Ga0102883_1195851Not Available572Open in IMG/M
3300010318|Ga0136656_1292039Not Available531Open in IMG/M
3300010354|Ga0129333_10034936All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes4745Open in IMG/M
3300010885|Ga0133913_11907505All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes1481Open in IMG/M
3300011268|Ga0151620_1199293Not Available606Open in IMG/M
3300012726|Ga0157597_1022665Not Available510Open in IMG/M
3300013004|Ga0164293_10182786All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes1530Open in IMG/M
3300013004|Ga0164293_10572838All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Myroides → unclassified Myroides → Myroides sp. NP-2736Open in IMG/M
3300020162|Ga0211735_10125631Not Available601Open in IMG/M
3300020172|Ga0211729_11026901Not Available1471Open in IMG/M
3300020527|Ga0208232_1023604All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes866Open in IMG/M
3300020574|Ga0208221_1009056All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes1914Open in IMG/M
3300021961|Ga0222714_10010697All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Crocinitomicaceae7898Open in IMG/M
3300021963|Ga0222712_10140535All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Myroides → unclassified Myroides → Myroides sp. NP-21641Open in IMG/M
3300024289|Ga0255147_1006198All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes2715Open in IMG/M
3300024298|Ga0255178_1098966Not Available536Open in IMG/M
3300024343|Ga0244777_10035943All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales3154Open in IMG/M
3300024343|Ga0244777_10156797Not Available1469Open in IMG/M
3300024346|Ga0244775_10333106All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes1255Open in IMG/M
3300024348|Ga0244776_10032609All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Crocinitomicaceae → Lishizhenia → Lishizhenia tianjinensis4181Open in IMG/M
3300024354|Ga0255171_1071591Not Available632Open in IMG/M
3300024357|Ga0255165_1010445All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes1824Open in IMG/M
3300024507|Ga0255176_1058744Not Available694Open in IMG/M
3300024509|Ga0255175_1039367All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes906Open in IMG/M
3300024536|Ga0256338_1026360All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes1305Open in IMG/M
3300024550|Ga0255266_1049093Not Available1022Open in IMG/M
3300024565|Ga0255273_1029871Not Available1249Open in IMG/M
3300024855|Ga0255281_1006116All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes2296Open in IMG/M
3300024865|Ga0256340_1023160All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes1573Open in IMG/M
3300024865|Ga0256340_1085667Not Available775Open in IMG/M
3300026569|Ga0255277_1007868All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes2684Open in IMG/M
3300026573|Ga0255269_1031090All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes1482Open in IMG/M
3300027084|Ga0208443_1040472Not Available1007Open in IMG/M
3300027217|Ga0208928_1027304Not Available910Open in IMG/M
3300027220|Ga0208927_1056721Not Available689Open in IMG/M
3300027222|Ga0208024_1075742Not Available592Open in IMG/M
3300027223|Ga0208169_1086365Not Available536Open in IMG/M
3300027227|Ga0208929_1029639Not Available1221Open in IMG/M
3300027242|Ga0208806_1028533All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes1154Open in IMG/M
3300027244|Ga0208173_1040201Not Available869Open in IMG/M
3300027260|Ga0208027_1064874Not Available720Open in IMG/M
3300027261|Ga0208933_1019983All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes1097Open in IMG/M
3300027281|Ga0208440_1071015Not Available735Open in IMG/M
3300027387|Ga0208311_1004748All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Crocinitomicaceae3531Open in IMG/M
3300027418|Ga0208022_1122219Not Available525Open in IMG/M
3300027518|Ga0208787_1008212All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Crocinitomicaceae3771Open in IMG/M
3300027531|Ga0208682_1074270Not Available840Open in IMG/M
3300027756|Ga0209444_10213056Not Available693Open in IMG/M
3300027973|Ga0209298_10210867Not Available789Open in IMG/M
(restricted) 3300027977|Ga0247834_1095608Not Available1346Open in IMG/M
(restricted) 3300028044|Ga0247838_1255533Not Available593Open in IMG/M
3300028103|Ga0255172_1079937Not Available586Open in IMG/M
3300028286|Ga0256331_1081867Not Available731Open in IMG/M
3300031758|Ga0315907_10001232All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Crocinitomicaceae35016Open in IMG/M
3300031758|Ga0315907_10004642All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Crocinitomicaceae15346Open in IMG/M
3300031784|Ga0315899_10505778Not Available1156Open in IMG/M
3300031784|Ga0315899_10510500Not Available1150Open in IMG/M
3300031786|Ga0315908_10863402Not Available736Open in IMG/M
3300032092|Ga0315905_10183415All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales2069Open in IMG/M
3300032116|Ga0315903_10016240All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Crocinitomicaceae8457Open in IMG/M
3300033978|Ga0334977_0521553Not Available539Open in IMG/M
3300033979|Ga0334978_0099451All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Myroides → unclassified Myroides → Myroides sp. NP-21476Open in IMG/M
3300033980|Ga0334981_0200128All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Myroides → unclassified Myroides → Myroides sp. NP-2930Open in IMG/M
3300033992|Ga0334992_0001986All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Crocinitomicaceae15814Open in IMG/M
3300033996|Ga0334979_0000417All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Crocinitomicaceae32718Open in IMG/M
3300033996|Ga0334979_0734414Not Available513Open in IMG/M
3300034018|Ga0334985_0247671Not Available1146Open in IMG/M
3300034018|Ga0334985_0461270Not Available743Open in IMG/M
3300034023|Ga0335021_0236482All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes1003Open in IMG/M
3300034023|Ga0335021_0445458Not Available667Open in IMG/M
3300034082|Ga0335020_0628091Not Available500Open in IMG/M
3300034106|Ga0335036_0361312All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes945Open in IMG/M
3300034106|Ga0335036_0579863Not Available684Open in IMG/M
3300034108|Ga0335050_0004934All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Crocinitomicaceae9068Open in IMG/M
3300034200|Ga0335065_0856695Not Available504Open in IMG/M
3300034356|Ga0335048_0118749All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes1560Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine43.08%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater16.92%
FreshwaterEnvironmental → Aquatic → Freshwater → River → Unclassified → Freshwater12.31%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake5.38%
FreshwaterEnvironmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater5.38%
Freshwater, PlanktonEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton3.08%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater2.31%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake2.31%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater1.54%
Freshwater To Marine Saline GradientEnvironmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient1.54%
Estuarine WaterEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water1.54%
Deep SubsurfaceEnvironmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface1.54%
Marine PlanktonEnvironmental → Aquatic → Freshwater → Lotic → Unclassified → Marine Plankton0.77%
FreshwaterEnvironmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater0.77%
Freshwater And MarineEnvironmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater And Marine0.77%
EstuarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine0.77%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000882Freshwater microbial communities from the Columbia RiverEnvironmentalOpen in IMG/M
3300001838Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM33, ROCA_DNA217_0.2um_bLM_C_2aEnvironmentalOpen in IMG/M
3300002835Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605)EnvironmentalOpen in IMG/M
3300005662Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 4)EnvironmentalOpen in IMG/M
3300007162Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Utica-2 Time Series HT 2014_7_11EnvironmentalOpen in IMG/M
3300007545Estuarine microbial communities from the Columbia River estuary - metaG 1547B-3EnvironmentalOpen in IMG/M
3300007546Estuarine microbial communities from the Columbia River estuary - metaG 1547A-02EnvironmentalOpen in IMG/M
3300007547Estuarine microbial communities from the Columbia River estuary - metaG 1547B-02EnvironmentalOpen in IMG/M
3300007548Estuarine microbial communities from the Columbia River estuary - metaG 1548B-3EnvironmentalOpen in IMG/M
3300007549Estuarine microbial communities from the Columbia River estuary - metaG 1548B-02EnvironmentalOpen in IMG/M
3300007550Estuarine microbial communities from the Columbia River estuary - metaG 1549A-3EnvironmentalOpen in IMG/M
3300007551Estuarine microbial communities from the Columbia River estuary - metaG 1549B-3EnvironmentalOpen in IMG/M
3300007557Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.715EnvironmentalOpen in IMG/M
3300007560Estuarine microbial communities from the Columbia River estuary - metaG 1560A-02EnvironmentalOpen in IMG/M
3300007585Estuarine microbial communities from the Columbia River estuary - metaG 1562A-3EnvironmentalOpen in IMG/M
3300007590Estuarine microbial communities from the Columbia River estuary - metaG 1562A-02EnvironmentalOpen in IMG/M
3300007593Estuarine microbial communities from the Columbia River estuary - metaG 1563A-3EnvironmentalOpen in IMG/M
3300007597Estuarine microbial communities from the Columbia River estuary - metaG 1563A-02EnvironmentalOpen in IMG/M
3300007603Estuarine microbial communities from the Columbia River estuary - metaG 1568-02EnvironmentalOpen in IMG/M
3300007606Estuarine microbial communities from the Columbia River estuary - metaG 1569-02EnvironmentalOpen in IMG/M
3300007617Estuarine microbial communities from the Columbia River estuary - metaG 1554B-02EnvironmentalOpen in IMG/M
3300007618Estuarine microbial communities from the Columbia River estuary - metaG 1554A-02EnvironmentalOpen in IMG/M
3300007620Estuarine microbial communities from the Columbia River estuary - metaG 1546C-02EnvironmentalOpen in IMG/M
3300007625Estuarine microbial communities from the Columbia River estuary - metaG 1546B-02EnvironmentalOpen in IMG/M
3300007629Estuarine microbial communities from the Columbia River estuary - metaG 1554B-3EnvironmentalOpen in IMG/M
3300007630Estuarine microbial communities from the Columbia River estuary - metaG 1555C-02EnvironmentalOpen in IMG/M
3300007632Estuarine microbial communities from the Columbia River estuary - metaG 1554A-3EnvironmentalOpen in IMG/M
3300007634Estuarine microbial communities from the Columbia River estuary - metaG 1555A-02EnvironmentalOpen in IMG/M
3300007642Estuarine microbial communities from the Columbia River estuary - metaG 1548A-3EnvironmentalOpen in IMG/M
3300007644Estuarine microbial communities from the Columbia River estuary - metaG 1555B-02EnvironmentalOpen in IMG/M
3300007651Estuarine microbial communities from the Columbia River estuary - metaG 1555C-3EnvironmentalOpen in IMG/M
3300007706Estuarine microbial communities from the Columbia River estuary - metaG 1555B-3EnvironmentalOpen in IMG/M
3300007716Estuarine microbial communities from the Columbia River estuary - metaG 1546B-3EnvironmentalOpen in IMG/M
3300008107Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-3-NAEnvironmentalOpen in IMG/M
3300008114Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-C-NAEnvironmentalOpen in IMG/M
3300008964Estuarine microbial communities from the Columbia River estuary - metaG 1551A-02EnvironmentalOpen in IMG/M
3300008996Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.747EnvironmentalOpen in IMG/M
3300009024Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.705EnvironmentalOpen in IMG/M
3300009059Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.703EnvironmentalOpen in IMG/M
3300009068Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_MF_MetaGEnvironmentalOpen in IMG/M
3300009079Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.741EnvironmentalOpen in IMG/M
3300009086Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.713EnvironmentalOpen in IMG/M
3300009152Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaGEnvironmentalOpen in IMG/M
3300009158Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaGEnvironmentalOpen in IMG/M
3300009184Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaGEnvironmentalOpen in IMG/M
3300009187Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_EF_MetaGEnvironmentalOpen in IMG/M
3300010312Estuarine microbial communities from the Columbia River estuary - metaG 1549B-02EnvironmentalOpen in IMG/M
3300010318Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_15_0.8_DNAEnvironmentalOpen in IMG/M
3300010354Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNAEnvironmentalOpen in IMG/M
3300010885northern Canada Lakes Co-assemblyEnvironmentalOpen in IMG/M
3300011268Sub-surface freshwater microbial communities from San Francisco Estuary Delta, California, USA . Combined Assembly of Gp0173482, Gp0175554, Gp0175555EnvironmentalOpen in IMG/M
3300012726Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES115 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300013004Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES118 metaGEnvironmentalOpen in IMG/M
3300020162Freshwater lake microbial communities from Lake Erken, Sweden - P4710_201 megahit1EnvironmentalOpen in IMG/M
3300020172Freshwater lake microbial communities from Lake Erken, Sweden - P4710_102 megahit1EnvironmentalOpen in IMG/M
3300020527Freshwater microbial communities from Lake Mendota, WI - 24AUG2012 deep hole epilimnion (SPAdes)EnvironmentalOpen in IMG/M
3300020574Freshwater microbial communities from Lake Mendota, WI - 26JUN2009 deep hole epilimnion (SPAdes)EnvironmentalOpen in IMG/M
3300021961Estuarine water microbial communities from San Francisco Bay, California, United States - C33_3DEnvironmentalOpen in IMG/M
3300021963Estuarine water microbial communities from San Francisco Bay, California, United States - C33_657DEnvironmentalOpen in IMG/M
3300024289Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Miss_RepA_8hEnvironmentalOpen in IMG/M
3300024298Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atlam_RepC_8dEnvironmentalOpen in IMG/M
3300024343Combined assembly of estuarine microbial communities from Columbia River, Washington, USA >3um size fractionEnvironmentalOpen in IMG/M
3300024346Whole water sample coassemblyEnvironmentalOpen in IMG/M
33000243480.2um to 3um size fraction coassemblyEnvironmentalOpen in IMG/M
3300024354Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Yuk_RepB_8dEnvironmentalOpen in IMG/M
3300024357Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Cont_RepB_8dEnvironmentalOpen in IMG/M
3300024507Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atlam_RepA_8dEnvironmentalOpen in IMG/M
3300024509Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atl_RepC_8dEnvironmentalOpen in IMG/M
3300024536Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atl_RepC_8h (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300024550Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Cont_RepB_0h (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300024565Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atlam_RepC_8h (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300024855Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Yuk_RepC_8d (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300024865Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Colum_RepC_8h (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026569Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Cont_RepA_8d (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026573Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Yuk_RepC_8h (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300027084Estuarine microbial communities from the Columbia River estuary - metaG 1554A-02 (SPAdes)EnvironmentalOpen in IMG/M
3300027217Estuarine microbial communities from the Columbia River estuary - metaG 1547A-3 (SPAdes)EnvironmentalOpen in IMG/M
3300027220Estuarine microbial communities from the Columbia River estuary - metaG 1546C-02 (SPAdes)EnvironmentalOpen in IMG/M
3300027222Estuarine microbial communities from the Columbia River estuary - metaG 1546B-02 (SPAdes)EnvironmentalOpen in IMG/M
3300027223Estuarine microbial communities from the Columbia River estuary - metaG 1548B-3 (SPAdes)EnvironmentalOpen in IMG/M
3300027227Estuarine microbial communities from the Columbia River estuary - metaG 1548A-02 (SPAdes)EnvironmentalOpen in IMG/M
3300027242Estuarine microbial communities from the Columbia River estuary - metaG 1554B-02 (SPAdes)EnvironmentalOpen in IMG/M
3300027244Estuarine microbial communities from the Columbia River estuary - metaG 1555C-02 (SPAdes)EnvironmentalOpen in IMG/M
3300027260Estuarine microbial communities from the Columbia River estuary - metaG 1563A-02 (SPAdes)EnvironmentalOpen in IMG/M
3300027261Estuarine microbial communities from the Columbia River estuary - metaG 1563A-3 (SPAdes)EnvironmentalOpen in IMG/M
3300027281Estuarine microbial communities from the Columbia River estuary - metaG 1547B-02 (SPAdes)EnvironmentalOpen in IMG/M
3300027387Estuarine microbial communities from the Columbia River estuary - metaG 1562A-02 (SPAdes)EnvironmentalOpen in IMG/M
3300027418Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.747 (SPAdes)EnvironmentalOpen in IMG/M
3300027518Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Utica-2 Time Series HT 2014_7_11 (SPAdes)EnvironmentalOpen in IMG/M
3300027531Estuarine microbial communities from the Columbia River estuary - metaG 1568-02 (SPAdes)EnvironmentalOpen in IMG/M
3300027756Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.DN (SPAdes)EnvironmentalOpen in IMG/M
3300027973Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300027977 (restricted)Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_12mEnvironmentalOpen in IMG/M
3300028044 (restricted)Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_15mEnvironmentalOpen in IMG/M
3300028103Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Yuk_RepC_8dEnvironmentalOpen in IMG/M
3300028286Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Cont_RepA_8h (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031758Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123EnvironmentalOpen in IMG/M
3300031784Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA112EnvironmentalOpen in IMG/M
3300031786Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA124EnvironmentalOpen in IMG/M
3300032092Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA121EnvironmentalOpen in IMG/M
3300032116Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA119EnvironmentalOpen in IMG/M
3300033978Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME28Sep2014-rr0002EnvironmentalOpen in IMG/M
3300033979Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME30Aug2017-rr0003EnvironmentalOpen in IMG/M
3300033980Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME09Aug2015-rr0007EnvironmentalOpen in IMG/M
3300033992Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME16Jun2014-rr0035EnvironmentalOpen in IMG/M
3300033996Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2016-rr0004EnvironmentalOpen in IMG/M
3300034018Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME04Jul2014-rr0021EnvironmentalOpen in IMG/M
3300034023Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME21Oct2016-rr0090EnvironmentalOpen in IMG/M
3300034082Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME05Jun2015-rr0088EnvironmentalOpen in IMG/M
3300034096Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME15Oct2015-rr0098EnvironmentalOpen in IMG/M
3300034106Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23Aug2013-rr0131EnvironmentalOpen in IMG/M
3300034108Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME24Jun2014-rr0157EnvironmentalOpen in IMG/M
3300034200Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Jul2013-rr0190EnvironmentalOpen in IMG/M
3300034356Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jun2014-rr0152EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
FwDRAFT_1045173223300000882Freshwater And MarineMRSILFFFCLVFMLSCNKERRLNKDLQGTWEVDMVKLQDADGFSFFDYNPTGNLNISDTSVQGEITSLFQSFQGSVSDTLTLQGSYLLKLNESELNWVQAPDTIKNRIFVITNKNLEIEYYDLQAQQRLRYVFRKVN*
RCM33_101800623300001838Marine PlanktonMLSCNKARRFNKDIQGTWEVDMVKLQDADGFSFFDYNPTGNLNISETSVQGEITSLFQSFQGSVTDTLKLQGSYQLKLNQSELNWIQAPDTIRNRIFVITNKNLEIEHYDAKAQHRLRYVFKKVL*
B570J40625_10070833613300002835FreshwaterMRIFSLFVCVILFVSCNKERRFNRNLQGTWEVDMVKLQDADGFSFFDYNPVGALKITDESVQGELTAAFQTFQGSVADTLSLQGKYLLKLNESELNWVQAPDTIKNRIFVITNKNLEIEYYNVQAQQRLRYVFKKIN*
Ga0078894_1012036743300005662Freshwater LakeLQGTWEVDMVKLQDADGFSFFDYNPKGNLNFSDTSVQGEITSLFQSFQGSVADTLTLQGSYLLKLNESELNWVQSPDTIKNRIFVITNKNLEIEYYDWQAQQRLRYVFRKVN*
Ga0078894_1014973323300005662Freshwater LakeMRKILFFFCLVFMLSCNKERRLNKDLQGTWEVDMVKLQDADGFSFFDYNPTGNLNISDTSVQGEITSLFQSFQGSVADTLALNGSFLLKLNESELNWVQAPDTIKNRIFVITNKNLEIEYYDAQAQQRLRYVFKKVN*
Ga0079300_1001321633300007162Deep SubsurfaceMRIAVLCFIALLFLSCNKERRLNRHLQGTWEVNMVKLQDADGFSFFDYNPSGVMMISNESVQGELTSSFQTFQGLVLDTLALQGSYWLNINDAELNWVQTSDTIKNRIFVITNKNLEIEYYNAQAQQRLRYVFKKVN*
Ga0102873_100860953300007545EstuarineMRKILFFFCLVFVLSCNKERRLNKDLQGTWEVDMVKLQDADGFSFFDYNPTGNLNISDTSVQGEITSLFQSFQGSVSDTLTLQGSYLLKLNESELNWVQSPDTIKNRIFVITNKNLEIEYYDAQAQQRLRYVFVKLK*
Ga0102873_115063323300007545EstuarineMRIFSLFVCVIVFVSCNKERRFNRNLQGTWEVDMVKLQDADGFSFFDYNPAGALKITDESVQGELTAAFQTFQGSVADTLALQGTYLLKLNESELNWVQATDTIKNRIFVITNKNLEIEYYDVQAQQRLRYVFKKVN*
Ga0102874_101889653300007546EstuarineMRKILFFFCLVFVLSCNKERRLNKDLQGTWEVDMVKLQDADGFSFFDYNPTGNLNISDTSVQGEITSLFQSFQGSVADTLALQGSYLLKLNESELNWVQSPDTIKNRIFVITNKNLEIEHYDAQAQLRLRYVFVKLK*
Ga0102875_103373923300007547EstuarineMRKILFFFCLVFVLSCNKERRLNKDLQGTWEVDMVKLQDADGFSFFDYNPTGNLNISDTSVQGEITSLFQSFQGSVADTLALQGSYLLKLNESELNWVQAPDTIKNRIFVITNKNLEIEHYDAQAQQRLRYVFVKLK*
Ga0102877_101406653300007548EstuarineMLSCNKERRFNKDLQGTWEVDMVKLQDADGFSFFDYNPTGNLNISDTSVQGEITSLFQSFQGSVSDTLTLQGSYLLKLNESELNWVQSPDTIKNRIFVITNKNLEIEYYDAQAQQRLRYVFVKLK*
Ga0102879_101268323300007549EstuarineMFSCNKERRFSKDLQGTWEVDMVKLQDADGFSFFDYNPTGNLSISDTSVQGEITSLFQSFQGSVADTLALQGSYLLKLNESELNWVQAPDTIKNRIFVITNKNLEIEHYDAQAQQRLRYVFVKLK*
Ga0102880_116960713300007550EstuarineMLSCNKERRFNKDLQGTWEVDMVKLQDADGFSFFDYNPTGNLNISDTSVQGEITSLFQSFQGSVSDTLKLQGSYLLKLNESELNWVQAPDTIKNRIFVITNKNLEIEHYDAQAQQRLRYV
Ga0102881_109353433300007551EstuarineYNPAGALKITDESVQGELTAAFQTFQGSVADTLALQGTYLLKLNESELNWVQAPDTIKNRIFVITNKNLEIEYYDAQAQQRLRYVFKKVN*
Ga0102821_108758313300007557EstuarineMLSCNKERRFNKDLQGTWEVDMVKLQDADGFSFFDYNPTGNLSISDTSVQGEITSMFQSFQGSVADTLALQGSYLLNLNESELNWVQSPDTIKNRIFVITNKNLEIEYYDLQAQQRLRYVFRKVN*
Ga0102913_109154723300007560EstuarineMRKILFFFCLVFVLSCNKERRLNKDLQGTWEVDMVKLQDADGFSFFDYNPTGNLNISDTSVQGEITSLFQSFQGSVSDTLTLQGSYLLKLNESELNWVQAPDTIKNRIFVITNKNLEIEHYDAQAQQRLRYVFVKL
Ga0102916_101838013300007585EstuarineMRSLLFFFCLVFMLSCNKERRFNKDLQGTWEVDMVKLQDADGFSFFDYNPTGNLNISDTSVQGEITSLFQSFQGSVSDTLTLQGSYLLKLNESELNWVQAPDTIKNRIFVITNKNLEIEYYDAQAQQRLRYVFKKVN*
Ga0102917_101627023300007590EstuarineMLSCNKERRLNKDLQGTWEVDMVKLQDADGFSFFDYNPTGNLNISDTSVQGEITSLFQSFQGSVADTLALQGSYLLKLNESELNWVQSPDTIKNRIFVITNKNLEIEYYDAQAQQRLRYVFVKLK*
Ga0102918_102751053300007593EstuarineVKLQDADGFSFFDYNPTGNLSISDTSVQGEITSLFQSFQGSVADTLAIQGSYLLKLNESELNWVQAPDTIKNRIFVITNKNLEIEHYDAQAQQRLRYVFVKLK*
Ga0102919_105308013300007597EstuarineMLSCNKERRLNKDLQGTWEVDMVKLQDADGFSFFDYNPTGNLNISDTSVQGEITSLFQSFQGSVSDTLTLQGSYLLKLNESELNWVQSPDTIKNRIFVITNKNLEIEYYDAQAQQRLRYVFVKLK*
Ga0102919_126339323300007597EstuarineVCVIVFVSCNKERRFNRNLQGTWEVDMVKLQDADGFSFFDYNPAGALKITDESVQGELTAAFQTFQGSVADTLALQGTYLLKLNESELNWVQAPDTIKNRIFVITNKNLEIEYYDVQAQQRLRYVFKKIN*
Ga0102921_101255813300007603EstuarineMLSCNKERRLNKDLQGTWEVDMVKLQDADGFSFFDYNPTGNLNISDTSVQGEITSLFQSFQGSVADTLALQGSYLLKLNESELNWVQAPDTIKNRIFVITNKNLEIEHYDAQAQQRLRYVFVKLK*
Ga0102921_101672833300007603EstuarineMVKLQDADGFSFFDYNPAGALKITDESVQGELTAAFQTFQGSVADTLALQGTYLLKLNESELNWVQATDTIKNRIFVITNKNLEIEYYDVQAQQRLRYVFKKVN*
Ga0102923_119694723300007606EstuarineLQDADGFSFFDYNPTGNLSISDTSVQGEITSLFQSFQGSVSDTLTLQGSYLLKLNESELNWVQSPDTIKNRIFVITNKNLEIEYYDAQAQQRLRYVFVKLK*
Ga0102897_100730723300007617EstuarineMLSCNKERRFNKDLQGTWEVDMVKLQDADGFSFFDYNPSGNLSISETSVQGEITSLFQSFQGSVADTLTLQGSYLLKLNESEFNWVQAPDTIKNRIFVITNKNLEIEYYDAQAQQRLRYVFKKVN*
Ga0102896_115082823300007618EstuarineVCVIVFVSCNKERRFNRNLQGTWEVDMVKLQDADGFSFFDYNPAGALKITDESVQGELTAAFQTFQGSVADTLALQGTYLLKLNESELNWVQATDTIKNRIFVITNKNLEIEYYDVQAQQRLRYVFKKVN*
Ga0102871_109655923300007620EstuarineMRKILFFFCLVFMLSCNKERRLNKDLQGTWEVDMVKLQDADGFSFFDYNPTGNLNISDTSVQGEITSLFQSFQGSVSDTLTLQGSYLLKLNESELNWVQAPDTIKNRIFVITNKNLEIEYYDAQA
Ga0102870_112771823300007625EstuarineMRKILFFFCLVFVLSCNKERRLNKDLQGTWEVDMVKLQDADGFSFFDYNPTGNLNISDTSVQGEITSLFQSFQGSVSDTLTLQGSYLLKLNESELNWVQAPDTIKNRIFVITNKNLEIEYYDAQAQQRLRYVFKKVN*
Ga0102895_103579523300007629EstuarineMRKILFFFCLVFVLSCNKERRLNKDLQGTWEVDMVKLQDADGFSFFDYNPTGNLNISDTSVQGEITSLFQSFQGSVADTLALQGSYLLKLNESELNWVQAPDTIKNRIFVITNKNLEIE*
Ga0102903_107031833300007630EstuarineMRKILFFFCLVFMLSCNKERRFNKDLQGTWEVDMVKLQDADGFSFFDYNPTGNLSISDTSVEGEITSLFQSFQGSVSDTLTLQGSYLLKLNESELNWVQSPDTIKNRIFVITNKNLEIEYYDAQAQQRLRYVFVKLK*
Ga0102903_119328813300007630EstuarineMRKILFFFCLVFMLSCNKERRLNKDLQGTWEVDMVKLQDADGFSFFDYNPTGNLSISDTSVQGEITSLFQSFQGSVADTLALQGSYLLKLNESELNWVQAPDTIKNRIFVITNKNLEIEHYDAQAQQRLRYVFVKLK*
Ga0102894_108719023300007632EstuarineMLSCNKERRFNKDLQGTWEVDMVKLQDADGFSFFDYNPTGNLSISETSVQGEITSLFQSFQGSVSDTLKLQGSYLLKLNESELNWVQSPDTIKNRIFVITNKNLEIEHYDAQAQLRLRYVFVKLK*
Ga0102901_102280323300007634EstuarineMLSCNKERRLNKDLQGTWEVDMVKLQDADGFSFFDYNPTGNLNISDTSVQGEITSLFQSFQGSVSDTLTLQGSYLLKLNESELNWVQAPDTIKNRIFVITNKNLEIEHYDAQAQQRLRYVFVKLK*
Ga0102876_111399423300007642EstuarineMRKILFFFCLVFVLSCNKERRLNKDLQGTWEVDMVKLQDADGFSFFDYNPTGNLNISDTSVQGEITSLFQSFQGSVSDTLTLQGSYLLKLNESELNWVQSPDTIKNRIFVI
Ga0102902_106556023300007644EstuarineMLSCNKERRLNKDLQGTWEVDMVKLQDADGFSFFDYNPTGNLNISDTSVQGEITSLFQSFQGSVADTLALQGSYLLKLNESELNWVQSPDTIKNRIFVITNKNLEIEHYDAQAQQRLRYVFIKLK*
Ga0102900_107445613300007651EstuarineSCNKERRLNKDLQGTWEVDMVKLQDADGFSFFDYNPTGNLNISDTSVQGEITSLFQSFQGSVADTLALQGSYLLKLNESELNWVQAPDTIKNRIFVITNKNLEIEHYDAQAQQRLRYVFVKLK*
Ga0102899_107316423300007706EstuarineMRKILFFFCLVFVLSCNKERRLNKDLQGTWEVDMVKLQDADGFSFFDYNPTGNLNISDTSVQGEITSLFQSFQGSVADTLALQGSYLLKLNESELNWVQSPDTIKNRIFVITNKNLEIEYYDAQAQQRLRYVFVKLK*
Ga0102867_106182613300007716EstuarineMRKILFFFCLVFVLSCNKERRLNKDLQGTWEVDMVKLQDADGFSFFDYNPTGNLNISDTSVQGEITSLFQSFQGSVSDTLTLQGSYLLKLNESELNWVQSPDTIKNRIFVITNKNLEIEYYDAQAQQRLRYVFV
Ga0114340_120051913300008107Freshwater, PlanktonMVKLQDADGFSFFDYNPVGALKITDESVQGELTAAFQTFQGSVADTLSLQGKYLLKLNEPELNWVQAPDTIKNRIF
Ga0114347_100312773300008114Freshwater, PlanktonMRIAVLCFIALLFFSCNKERRLNRHLQGAWEVDMVKLQDADGFSFFDYNPTGSVMISDESVQGEVTSSFQTFQGLVSDTLALQGSYLLNLQDSELNWVQTSDTIKNRIFVITNKNLEIEYYDAQAQQRLRYVFKKVN*
Ga0114347_101152563300008114Freshwater, PlanktonMLSCNKERRFNKDLQGTWEVDMVKLQDADGFSFFDYNPKGNLNFSDTSVQGEITSLFQSFQGSVADTLALQGSYLLKLNESELNWVQAPDTIKNRIFVITNKNLEIEYYDAQAQQRLRYVFVKLK*
Ga0114347_103142533300008114Freshwater, PlanktonMVKLQDADGFSFFDYNPVGALKITDESVQGELTAAFQTFQGSVADTLSLQGKYLLKLNESELNWVQAPDTIKNRIFVITNKNLEIEYYNVQAQQRLRYVFKKIN*
Ga0102889_106126923300008964EstuarineMRKILFFFCLVFVLSCNKERRLNKDLQGTWEVDMVKLQDADGFSFFDYNPTGNLNISDTSVQGEITSLFQSFQGSVSDTLKLQGSYLLKLNESELNWVQAPDTIKNRIFVITNKNLEIEYYDAQAQQRLRYVFIKLK*
Ga0102831_101941753300008996EstuarineMLSCNKERRLNKDLQGTWEVDMVKLQDADGFSFFDYNPTGNLNISDTSVQGEITSLFQSFQGSVSDTLTLQGSYLLKLNESELNWVQAPDTIKNRIFVITNKNLEIEYYDAQAQQRLRYVFKKVN*
Ga0102811_124791923300009024EstuarineVCVIVFVSCNKERRFNRNLQGTWEVDMVKLQDADGFSFFDYNPAGALKITDESVQGELTAAFQTFQGSVADTLALQGTYLLKLNESELNWVQATDTIKNRIFVITNK
Ga0102830_120318023300009059EstuarineSCNKERRFNKDLQGTWEVDMVKLQDADGFSFFDYNPTGNLSISDTSVQGEITSLFQSFQGSVSDTLTLQGSYLLKLNESELNWVQAPDTIKNRIFVITNKNLEIEYYDAQAQQRLRYVFKKVN*
Ga0114973_1007249523300009068Freshwater LakeLQGTWKVDMVKLQDADGFSFFDYNPTGSLNFSGESVQGELSSAFQTFQGSVEDTLALQGSYLLKLNESELNWVQSLDTIKNRIFVITNKNLEIEYYDAQAQQRLRYVFVKLK*
Ga0102814_1060547123300009079EstuarineMLSCNKERRLNKDLQGTWEVDMVKLQDADGFSFFDYNPTGNLNISDTSVQGEITSLFQSFQGSVSDTLTLQGSYLLKLNESELNWVQATDTIKNRIFVITNKNLEIEYYDVQAQQRLRYVFKKVN*
Ga0102812_1071781613300009086EstuarineWEVDMVKLQDADGFSFFDYNPTGNLSISETSVQGEITSLFQSFQGSVSDTLKLQGSYLLKLNESELNWVQAPDTIKNRIFVITNKNLEIEYYDAQAQQRLRYVFKKVN*
Ga0114980_1002680233300009152Freshwater LakeMVKLQDADGFSFFDYNPTGSLNFSGESVQGELSSAFQTFQGSVADTLALQGSYLLKLNESELNWVQSLDTIKNRIFVITNKNLEIEYYDAQAQQRLRYVFVKLK*
Ga0114977_1041223313300009158Freshwater LakeMLSCNKERRLNKDLQGTWEVDMVKLQDADGFSFFDYNPTGNLNISDTSVQGEITSLFQSFQGYVADTLMLQGSYLLKLNESELNWVQSPDTIKNRIFVITNKNLEIEYYDAQAQ
Ga0114976_1063706423300009184Freshwater LakeMRSILFFFCLVFMLSCNKERRLNKDLQGTWEVDMVKLQDADGFSFFDYNPTGNLNISDTSVQGEITSLFQSFQGYVADTLMLQGSYLLKLNESELNWVQSPDTIKNRIFVI
Ga0114972_1013865523300009187Freshwater LakeMVKLQDADGFSFFDYNPTGSLNFSGESVQGELSSAFQTFQGSVEDTLALQGSYLLKLNESELNWVQSLDTIKNRIFVITNKNLEIEYYDAQAQQRLRYVFVKLK*
Ga0102883_119585113300010312EstuarineDADGFSFFDYNPVGALKITDESVQGELTAAFQTFQGSVADTLALQGTYLLKLNESELNWVQATDTIKNRIFVITNKNLEIEYYDVQAQQRLRYVFKKIN*
Ga0136656_129203923300010318Freshwater To Marine Saline GradientVKLQDADGFSFFDYNPSGVMMISDESVQGELTSSFQTFQGLVSDTLALQGSYWLNINDAELNWVQTTDTIKNRIFVITNKNLEIEYYNAQAQQRLRYVFKKVN*
Ga0129333_1003493623300010354Freshwater To Marine Saline GradientMLSCNKERRFNKYLQGTWEVDMVKLQDADGFSFFDYNPSGNLSISETSVQGEITSLFQSFQGSVSDTLTLEGSYLLKLNESELNWVQSPDTIKNRIFVITNKNLEIEYYDAQAQQRLRYVFVKLK*
Ga0133913_1190750523300010885Freshwater LakeMRSILFFFCLVFMLSCNKERRLNKDLQGTWEVDMVKLQDADGFSFFDYNPTGNLNISDTSVQGEITSLFQSFQGYVADTLMLQGSYLLKLNESELNWVQSPDTIKNRIFVITNKNLEIEYYDAQAQQRLRYVFVKLK*
Ga0151620_119929313300011268FreshwaterMLSCNKERRFNKDLQGTWEVDMVKLQDADGFSFFDYNPTGNLSISETSVQGEITSLFQSFQGSVSDTLKLQGSYLLKLNESELNWVQSPDTIKNRIFVITNKNLEIEHYDAQAQQRLRYV
Ga0157597_102266513300012726FreshwaterKLQDADGFSFFDYNPTGSLNFSGESVQGELSSAFQTFQGSVADTLALQGSYLLKLNESELNWVQSLDTIKNRIFVITNKNLEIEYYDAQAQQRLRYVFVKLK*
Ga0164293_1018278643300013004FreshwaterMVKLQDADGFSFFDYNPAGALKITDESVQGELTAAFQTFQGSVADTLALQGTYLLKLNESELNWVQAPDTIKNRIFVITNKNLEIEYYDVQAQQRLRYVFKKIN*
Ga0164293_1057283813300013004FreshwaterRFNRHLQGTWEVDMVKLQDADGFSFFDYNPTGSLNFSGESVQGELSSAFQTFQGSVKDTLALQGSYLLKLNESELNWVQSLDTIKNRIFVITNKNLEIEYYDAQAQQRLRYVFVKLK*
Ga0211735_1012563113300020162FreshwaterERRFNRNLQGTWEVDMVKLQDADGFSFFDYNPVGALKISDESVQGELTAAFQTFQGSVADTLALQGTYLLKLNESELNWVQATDTIKNRIFVITNKNLEIEYYDVQAQQRLRYVFKKVN
Ga0211729_1102690143300020172FreshwaterMRIFSLFVCVILFVSCNKERRFNRNLQGTWEVDMVKLQDADGFSFFDYNPAGALKISDESVQGELTAAFQTFQGSVADTLALQGKYLLKLNESELNWVQAPDTIKNRIFVITNKNLEIEYYDVQAQQRLRYVFKKVN
Ga0208232_102360413300020527FreshwaterMRIAVLCFCALLFFSCNKERRLNRYLQGSWAVDMVKLQDADGFSFFDYNPTGVLMISDQSVQGELASAFQTFQGSVVDTLALQGSYLLKLNEAELNWVQTPDTIKNRIFVLTNKNLEIEYYDAQAQQRLRYVFKKMN
Ga0208221_100905623300020574FreshwaterMRIFSLFVCVILFVSCNKERRFNRNLQGTWEVDMVKLQDADGFSFFDYNPVGALKITDESVQGELTAAFQTFQGSVADTLSLQGKYLLKLNESELNWVQAPDTIKNRIFVITNKNLEIEYYNVQAQQRLRYVFKKIN
Ga0222714_1001069743300021961Estuarine WaterMLENIKFFVLCLIVILFFSCNKERRINRNLQGRWEVDKVKLQDVDGFSFFDNNPKGKLLISDKTVQGEITSSFQTFLGSVSDTLALYGSYYLNLDNAELNWLQSPDTIKNRIFVITNKNLEIECYNAISQQRMRYVFKKIR
Ga0222712_1014053543300021963Estuarine WaterMRSILFFFCLVFMLSCNKERRFNKYLQGTWEVDMVKLQDADGFSFFDYNPSGNLSISETSVQGEITSMFQSFQGSVTDTLSLQGSYLLKLNESELNWVQSPDTIKNRIFVITNKNLEIEYYDAQAQQRLRYVFIKLK
Ga0255147_100619833300024289FreshwaterMRIVGVLLCLILLISCSKERRFNRDLQGTWEVDMVKLQDQDGFSFFDYNPKGNLQIADNTVQGELTAAFETFQGSLADTLSLQGTYELKLTDSELNWIQAPDTIKNRIFVITNKNLEIEHYDATSQLRLRYVFKKVK
Ga0255178_109896623300024298FreshwaterMRIVGVLLCLTLLISCNKERRFNRNLQGTWEVDMVKLQDVDGFSFFDYNPKGNLQIADNTVQGELTAAFETFQGLVADTLALQGKYLLKLNESELNWIQAPDTIKNRIFVITNKNLEIEHYDATSQLRLRYVFKKVK
Ga0244777_1003594333300024343EstuarineMRKILFFFCLVFVLSCNKERRLNKDLQGTWEVDMVKLQDADGFSFFDYNPTGNLNISDTSVQGEITSLFQSFQGSVADTLALQGSYLLKLNESELNWVQAPDTIKNRIFVITNKNLEIEHYDAQAQQRLRYVFVKLK
Ga0244777_1015679733300024343EstuarineMRIFSLFVCVIVFVSCNKERRFNRNLQGTWEVDMVKLQDADGFSFFDYNPAGALKITDESVQGELTAAFQTFQGSVADTLALQGTYLLKLNESELNWVQATDTIKNRIFVITNKNLEIEYYDVQAQQRLRYVFKKVN
Ga0244775_1033310633300024346EstuarineMRSILFFFCLVFMLSCNKERRFNKDLQGTWEVDMVKLQDADGFSFFDYNPTGNLSISDTSVQGEITSLFQSFQGSVSDTLTLQGSYLLKLNESELNWVQAPDTIKNRIFVITNKNLEIEYYDAQAQQRLRYVFKKVN
Ga0244776_1003260963300024348EstuarineMVKLQDADGFSFFDYNPTGNLNISDTSVQGEITSLFQSFQGSVSDTLTLQGSYLLKLNESELNWVQAPDTIKNRIFVITNKNLEIEYYDAQAQQRLRYVFKKVN
Ga0255171_107159113300024354FreshwaterGFSFFDYNPKGNLQIADNTVQGVLTASFQSFQGVVANTLSLQGTYELKLTDSELNWIQAPDTIKNRIFVITNKNLEIEHYDATSQLRLRYVFKKVK
Ga0255165_101044533300024357FreshwaterMRIVGVLLCLTLLISCNKERRFNRNLQGTWEVDMVKLQDVDGFSFFDYNPKGNLQIADNTVQGVLTASFQSFQGVVANTLSLQGTYELKLTDSELNWIQAPDTIKNRIFVITNKNLEIEHYDATSQLRLRYVFKKVK
Ga0255176_105874413300024507FreshwaterMRTILVFFCLVFMLSCNKERRFNKDLQGTWEVDMVKLQDADGFSFFDYNPTGNLSISETSVQGEITSLFQSFQGFVSDTLTLQGSYLLKLNESELNWVQSPDTIKNRIFVITSKNLEIEYYDAQAQQRLRYVFVKLK
Ga0255175_103936713300024509FreshwaterVKLQDVDGFSFFDYNPKGNLQIADNTVQGVLTASFQSFQGVVANTLSLQGTYELKLTDSELNWIQAPDTIKNRIFVITNKNLEIEHYDATSQLRLRYVFKKVK
Ga0256338_102636043300024536FreshwaterLLCLILLISCSKERRFNRDLQGTWEVDMVKLQDQDGFSFFDYNPKGNLQIADNTVQGELTAAFETFQGSLADTLSLQGTYELKLTDSELNWIQAPDTIKNRIFVITNKNLEIEHYDATSQLRLRYVFKKVK
Ga0255266_104909323300024550FreshwaterMRIVGVLLCLTLLISCNKERRFNRNLQGTWEVDMVKLQDVDGFSFFDYNPKGNLQIADNTVQGELTAAFETFQGSLADTLSLQGTYELKLTDSELNWIQAPDTIKNRIFVITNKNLEIEHYDATSQLRLRYVFKKVK
Ga0255273_102987123300024565FreshwaterMRIVGVLLCLILLISCSKERRFNRDLQGTWEVDMVKLQDQDGFSFFDYNPKGNLQIADNTVQGVLTASFQSFQGVVANTLSLQGTYELKLTDSELNWIQAPDTIKNRIFVITNKNLEIEHYDATSQLRLRYVFKKVK
Ga0255281_100611643300024855FreshwaterVDSTGIYKELGKWIWLSCKTKMGFPFFDYNPKGNLQIADNTVQGELTAAFETFQGSLADTLSLQGTYELKLTDSELNWIQAPDTIKNRIFVITNKNLEIEHYDATSQLRLRYVFKKVK
Ga0256340_102316013300024865FreshwaterISCSKERRFNRDLQGTWEVDMVKLQDQDGFSFFDYNPKGNLQIADNTVQGELTAAFETFQGSLADTLSLQGTYELKLTDSELNWIQAPDTIKNRIFVITNKNLEIEHYDATSQLRLRYVFKKVK
Ga0256340_108566723300024865FreshwaterMRIVGVLLCLTLLISCNKERRFNRNLQGTWEVDMVKLQDVDGFSFFDYNPKGNLQIADNTVQGVLTASFQSFQGVVANTLSLQGTYELKLTDSELNWIQAPDTIKNRIFVITNKNLEIE
Ga0255277_100786853300026569FreshwaterISCNKERRFNRNLQGTWEVDMVKLQDVDGFSFFDYNPKGNLQIADNTVQGELTAAFETFQGSLADTLSLQGTYELKLTDSELNWIQAPDTIKNRIFVITNKNLEIEHYDATSQLRLRYVFKKVK
Ga0255269_103109043300026573FreshwaterQDQDGFSFFDYNPKGNLQIADNTVQGELTAAFETFQGSLADTLSLQGTYELKLTDSELNWIQAPDTIKNRIFVITNKNLEIEHYDATSQLRLRYVFKKVK
Ga0208443_104047213300027084EstuarineMRSILFFFCLVFMLSCNKERRLNKDLQGTWEVDMVKLQDADGFSFFDYNPTGNLNISDTSVQGEITSLFQSFQGSVADTLALQGSYLLKLNESELNWVQAPDTIKNRIFVITNKNLEIEYYDAQAQQR
Ga0208928_102730423300027217EstuarineMRKILFFFCLVFVLSCNKERRLNKDLQGTWEVDMVKLQDADGFSFFDYNPTGNLNISDTSVQGEITSLFQSFQGSVADTLALQGSYLLKLNESELNWVQAPDTIKNRIFV
Ga0208927_105672113300027220EstuarineMRKILFFFCLVFMLSCNKERRLNKDLQGTWEVDMVKLQDADGFSFFDYNPTGNLNISDTSVQGEITSLFQSFQGSVADTLALQGSYLLKLNESELNWVQSPDTIKNRIFVITNKNLEI
Ga0208024_107574213300027222EstuarineMRKILFFFCLVFVLSCNKERRLNKDLQGTWEVDMVKLQDADGFSFFDYNPTGNLNISDTSVQGEITSLFQSFQGSVSDTLTLQGSYLLKLNESELNWVQAPDTIKNRIFVITNKNLEI
Ga0208169_108636513300027223EstuarineLVFMLSCNKERRLNKDLQGTWEVDMVKLQDADGFSFFDYNPTGNLNISDTSVQGEITSLFQSFQGSVSDTLTLQGSYLLKLNESELNWVQAPDTIKNRIFVITNKNLEIEYYDAQAQQRLRYVFKKVN
Ga0208929_102963933300027227EstuarineMRKILFFFCLVFMLSCNKERRLNKDLQGTWEVDMVKLQDADGFSFFDYNPTGNLNISDTSVQGEITSLFQSFQGSVADTLALQGSYLLKLNESELNWVQSPDTIKNRIFVITNKNLEIEYYDAQAQQ
Ga0208806_102853313300027242EstuarineNKERRLNKDLQGTWEVDMVKLQDADGFSFFDYNPTGNLNISDTSVQGEITSLFQSFQGSVSDTLTLQGSYLLKLNESELNWVQAPDTIKNRIFVITNKNLEIEYYDAQAQQRLRYVFKKV
Ga0208173_104020123300027244EstuarineMRKILFFFCLVFVLSCNKERRLNKDLQGTWEVDMVKLQDADGFSFFDYNPTGNLNISDTSVQGEITSLFQSFQGSVADTLALQGSYLLKLNESELNWVQAPDTIKNRIFVITNKNL
Ga0208027_106487413300027260EstuarineMRSILFFFCLVFMLSCNKERRLNKDLQGTWEVDMVKLQDADGFSFFDYNPTGNLNISDTSVQGEITSLFQSFQGSVSDTLTLQGSYLLKLNESELNWVQAPDTIKNRIFVITNKNLEIEY
Ga0208933_101998313300027261EstuarineKDLQGTWEVDMVKLQDADGFSFFDYNPTGNLNISDTSVQGEITSLFQSFQGSVADTLALQGSYLLKLNESELNWVQAPDTIKNRIFVITNKNLEIEHYDAQAQQRLRYVFVKLK
Ga0208440_107101513300027281EstuarineMRKILFFFCLVFVLSCNKERRLNKDLQGTWEVDMVKLQDADGFSFFDYNPTGNLNISDTSVQGEITSLFQSFQGSVADTLALQGSYLLKLNESELNWVQAPDTIKNRIFVITNKNLEIEYYDAQAQQRLRYVFKKVN
Ga0208311_100474843300027387EstuarineMRKILFFFCLVFVLSCNKERRLNKDLQGTWEVDMVKLQDADGFSFFDYNPTGNLNISDTSVQGEITSLFQSFQGSVADTLALQGSYLLKLNESELNWVQSPDTIKNRIFVITNKNLEIEYYDAQAQQRLRYVFVKLK
Ga0208022_112221913300027418EstuarineILFFFCLVFMLSCNKERRLNKDLQGTWEVDMVKLQDADGFSFFDYNPTGNLNISDTSVQGEITSLFQSFQGSVSDTLTLQGSYLLKLNESELNWVQAPDTIKNRIFVITNKNLEIEYYDAQAQQRLRYVFKKVN
Ga0208787_100821243300027518Deep SubsurfaceMRIAVLCFIALLFLSCNKERRLNRHLQGTWEVNMVKLQDADGFSFFDYNPSGVMMISNESVQGELTSSFQTFQGLVLDTLALQGSYWLNINDAELNWVQTSDTIKNRIFVITNKNLEIEYYNAQAQKRLRYVFKKVN
Ga0208682_107427013300027531EstuarineMRSILFFFCLVFMLSCNKERRLNKDLQGTWEVDMVKLQDADGFSFFDYNPTGNLNISDTSVQGEITSLFQSFQGSVADTLALQGSYLLKLNESELNWVQAPDTIKNRIFVI
Ga0209444_1021305613300027756Freshwater LakeMRIAVLCFCAFLFFSCNKERRLNRYLQGSWAVDMVKLQDADGFSFFDYNPTGVLMISDQSVQGELASAFQTFQGSVADTLALQGSYLLKLNEAELNWVQTLGTIKNRIFVLTNKNLEIEYYDAQAQQRLRYVFKKMN
Ga0209298_1021086723300027973Freshwater LakeMRIFSLFVCVILYVSCNKERRFNRHLQGTWKVDMVKLQDADGFSFFDYNPTGSLNFSGESVQGELSSAFQTFQGSVADTLALQGSYLLKLNESELNWVQSLDTIKNRIFVITNKNLEIEYYDAQAQQRLRYVFVKLK
(restricted) Ga0247834_109560823300027977FreshwaterMRIAVVCFSAFLFFSCSKERRLNRYLQGSWAIDMVKLQDADGFSFFDYNPTGILMISDQSVQGELAAAFQTFQGSVADTLTLQGSYLLILNDTELNWVQTQDTIKNRIFVLTNKNLEIENYNAQAQQRLRYVFKKVN
(restricted) Ga0247838_125553323300028044FreshwaterDGFSFFDYNPTGILMISDQSVQGELAAAFQTFQGSVADTLTLQGSYLLILNDTELNWVQTQDTIKNRIFVLTNKNLEIENYNAQAQQRLRYVFKKVN
Ga0255172_107993713300028103FreshwaterVDMVKLQDVDGFSFFDYNPKGNLQIADNTVQGVLTASFQSFQGVVANTLSLQGTYELKLTDSELNWIQAPDTIKNRIFVITNKNLEIEHYDATSQLRLRYVFKKVK
Ga0256331_108186733300028286FreshwaterLGKWIWLSCKTKMGFPFFDYNPKGNLQIADNTVQGELTAAFETFQGSLADTLSLQGTYELKLTDSELNWIQAPDTIKNRIFVITNKNLEIEHYDATSQLRLRYVFKKVK
Ga0315907_10001232143300031758FreshwaterMRIAVLCFIALLFFSCNKERRLNRHLQGAWEVDMVKLQDADGFSFFDYNPTGSVMISDESVQGEVTSSFQTFQGLVSDTLALQGSYLLNLQDSELNWVQTSDTIKNRIFVITNKNLEIEYYDAQAQQRLRYVFKKVN
Ga0315907_1000464283300031758FreshwaterMLSCNKERRFNKDLQGTWEVDMVKLQDADGFSFFDYNPKGNLNFSDTSVQGEITSLFQSFQGSVADTLALQGSYLLKLNESELNWVQAPDTIKNRIFVITNKNLEIEYYDAQAQQRLRYVFVKLK
Ga0315899_1050577813300031784FreshwaterMRIFSLFVCVFLFVSCNKERRFNKDLQGTWEVDMVKLQDADGFSFFDNNPSGNLSISETSVQGEITSMFQSFQGSVSDTLTLQGSYLLKLNESELNWVQSPDTIKNRIFVITNKNLEIEYYDAQAQQRLRYVFVKLK
Ga0315899_1051050023300031784FreshwaterMRIAVLCFIALLFFSCNKERRLNRYLQGTWEVDMVKRQDSDGFSFFDYNPLGALMISDESVQGELTSSFQTFQGLVADTLALQGSYLLNINDAELNWVQTSDTIKNRIFVLTNKNLEIEYYNAQAQQRLRYVFKKVN
Ga0315908_1086340223300031786FreshwaterMRSILFFFCLVFMLSCNKERRFNKDLQGTWEVDMVKLQDADGFSFFDYNPSGNLSISETSVQGEITSMFQSFQGSVADTLALQGSYLLKLNESELNWVQTPDTIKNRIFVITNKNLEIEHYDAQAQQRLRYVFVKRK
Ga0315905_1018341543300032092FreshwaterMRIFSLFVCVILFVSCNKERRFNRHLQGTWEVDMVKLQDADGFSFFDYNPTGSLNFSGESVQGELSSAFQTFQGSVADTLALQGSYLLKLNESELNWVQSLDTIKNRIFVITNKNLEIEYYDAQEQQRLRYVFVKLK
Ga0315903_1001624033300032116FreshwaterMRSILFFFCLVLMLSCNKERRFNKDLQGTWEVDMVKLQDADGFSFFDYNPKGNLNFSDTSVQGEITSLFQSFQGSVADTLALQGSYLLKLNESELNWVQAPDTIKNRIFVITNKNLEIEYYDAQAQQRLRYVFVKLK
Ga0334977_0521553_185_5383300033978FreshwaterMRIAVLCFIALLFFSCNKERRLNRYLQGTWEVDMVKRQDSDGFSFFDYNPLGALMISDESVQGELTSSFQTFQGLVADTLALQGSYLLNINDAELNWVQTSDTIKNRIFVLTNKNLEI
Ga0334978_0099451_715_10923300033979FreshwaterMLSCNKERRFNKDLQGTWEVDMVKLQDADGFSFFDYNPTGNLSISDTSVQGEITSLFQSFQGSVADTLALQGSYLLKLNESELNWVQSPDTIKNRIFVITNKNLEIEYYDAQAQQRLRYVFVKLK
Ga0334981_0200128_1_2973300033980FreshwaterADGFSFFDYNPKGNLNFSDTSVQGEITSLFQSFQGSVADTLALQGSYLLKLNESELNWVQSPDTIKNRIFVITNKNLEIEYYDAQAQQRLRYVFVKLK
Ga0334992_0001986_5077_53913300033992FreshwaterMVKLQDADGFSFFDYNPEGALKITDESVQGELTAAFQTFQGSVADTLALQGTYLLKLNESELNWVQAPDTIKNRIFVITNKNLEIEYYDVQAQQRLRYVFKKIN
Ga0334979_0000417_16258_165963300033996FreshwaterLQGTWEVDMVKLQDADGFSFFDYNPTGSLNFSGESVQGELSSAFQTFQGSVADTLALQGSYLLKLNESELNWVQSLDTIKNRIFVITNKNLEIEYYDAQAQQRLRYVFVKLK
Ga0334979_0734414_3_3023300033996FreshwaterMVKLQDADGFSFFDYNPVGALKITDESVQGELTAAFQTFQGSVADTLSLQGKYLLKLNESELNWVQAPDTIKNRIFVITNKNLEIEYYDVQAQQRLRYVF
Ga0334985_0247671_328_7053300034018FreshwaterMLSCNKERRFNKDLQGTWEVDMVKLQDADGFSFFDYNPTGNLSISETSVQGEITSFFQSFQGSVADTLELQGSYLLKLNESELNWVQAPDTIKNRIFVITNKNLEIEHYDAQAQQRLRYVFKKVK
Ga0334985_0461270_225_5393300034018FreshwaterMVKLQDADGFSFFDYNPVGALKITDESVQGELTAAFQTFQGSVADTLSLQGKYLLKLNESELNWVQAPDTIKNRIFVITNKNLEIEYYDVQAQQRLRYVFKKIN
Ga0335021_0236482_107_4213300034023FreshwaterMVKLQDADGFSFFDYNPAGALKITDESVQGELTAAFQTFQGSVVDTLSIQGTYLLKLNESELNWVQAPDTIKNRIFVITNKNLEIEYYDVQAQQRLRYVFKKIN
Ga0335021_0445458_274_5883300034023FreshwaterMVKLQDSDGFSFFDYNPLGALMISDESVQGELTSSFQTFQGLVADTLALQGSYLLNINDAELNWVQTSDTIKNRIFVLTNKNLEIEYYNAQAQQRLRYVFKKVN
Ga0335020_0628091_119_4573300034082FreshwaterLQGSWAVDMVKLQDADGFSFFDYNPTGVLMISDQSVQGELASAFQTFQGSVADTLALQGSYLLKLNEAELNWVQTLDTIKNRIFVLTNKNLEIEYYDAQAQQRLRYVFKKMN
Ga0335025_0608039_1_2793300034096FreshwaterFDYNPAGALKITDESVQGELTAAFQTFQGSVVDTLSIQGTYLLKLNESELNWVQAPDTIKNRIFVITNKNLEIEYYDVQAQQRLRYVFKKIN
Ga0335036_0361312_612_9263300034106FreshwaterMVKRQDSDGFSFFDYNPLGALMISDESVQGELTSSFQTFQGLVADTLALQGSYLLNINDAELNWVQTSDTIKNRIFVLTNKNLEIEYYNAQAQQRLRYVFKKVN
Ga0335036_0579863_391_6843300034106FreshwaterMVKLQDADGFSFFDYNPKGNLNFSDTSVQGEITSLFQSFQGSVADTLALQGSYLLKLNESELNWVQSLDTIKNRIFVITNKNLEIEYYDAQAQQRLRY
Ga0335050_0004934_1200_15143300034108FreshwaterMVKLQDADGFSFFDYNPVGALKITDESVQGELTAAFQTFQGSVADTLSLQGKYLLKLNESELNWVQAPDTIKNRIFVITNKNLEIEYYNVQAQQRLRYVFKKIN
Ga0335065_0856695_255_5033300034200FreshwaterMVKLQDADGFSFFDYNPVGALKITDESVQGELTAAFQTFQGSVADTLSLQGKYLLKLNESELNWVQAPDTIKNRIFVITNKNL
Ga0335048_0118749_2_2863300034356FreshwaterMVKLQDADGFSFFDYNPVGALKITDESVQGELTAAFQTFQGSVADTLSLQGKYLLKLNESELNWVQAPDTIKNRIFVITNKNLEIEYYNVQAQQR


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.