Metagenome / Metatranscriptome Family F062457

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences

Select file to download:
Download

Overview

Basic Information
Family ID	F062457
Family Type	Metagenome / Metatranscriptome
Number of Sequences	130
Average Sequence Length	39 residues
Representative Sequence	LAEVFVGHKQLRLPGQEALNAKHPQPPNHQLIKVALRA
Number of Associated Samples	66
Number of Associated Scaffolds	130

Quality Assessment
Transcriptomic Evidence	Yes
Most common taxonomic group	Bacteria
% of genes with valid RBS motifs	0.77 %
% of genes near scaffold ends (potentially truncated)	96.15 %
% of genes from short scaffolds (< 2000 bps)	73.08 %
Associated GOLD sequencing projects	57
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.23

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign

Most Common Taxonomy
Group	Bacteria (60.769 % of family members)
NCBI Taxonomy ID	2
Taxonomy	All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake (35.385 % of family members)
Environment Ontology (ENVO)	Unclassified (66.154 % of family members)
Earth Microbiome Project Ontology (EMPO)	Free-living → Non-saline → Water (non-saline) (87.692 % of family members)

Multiple Sequence Alignments

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Select alignment to view:

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification:	Globular	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 15.15% β-sheet: 18.18% Coil/Unstructured: 66.67%
Feature Viewer

Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.23
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.23
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

Gene Neighborhood

Neighboring Pfam domains

Pfam ID	Name	% Frequency in 130 Family Scaffolds
PF16363	GDP_Man_Dehyd	4.62
PF03401	TctC	2.31
PF04055	Radical_SAM	2.31
PF05050	Methyltransf_21	2.31
PF08241	Methyltransf_11	2.31
PF00881	Nitroreductase	2.31
PF02719	Polysacc_synt_2	2.31
PF01255	Prenyltransf	1.54
PF13924	Lipocalin_5	1.54
PF01370	Epimerase	1.54
PF16861	Carbam_trans_C	1.54
PF13936	HTH_38	1.54
PF13414	TPR_11	1.54
PF00656	Peptidase_C14	1.54
PF13517	FG-GAP_3	1.54
PF00535	Glycos_transf_2	1.54
PF02397	Bac_transf	1.54
PF13439	Glyco_transf_4	1.54
PF13489	Methyltransf_23	1.54
PF11784	DUF3320	0.77
PF01551	Peptidase_M23	0.77
PF01061	ABC2_membrane	0.77
PF00589	Phage_integrase	0.77
PF13449	Phytase-like	0.77
PF14279	HNH_5	0.77
PF00890	FAD_binding_2	0.77
PF06808	DctM	0.77
PF12728	HTH_17	0.77
PF00561	Abhydrolase_1	0.77
PF10135	Rod-binding	0.77
PF02543	Carbam_trans_N	0.77
PF13844	Glyco_transf_41	0.77
PF00551	Formyl_trans_N	0.77
PF10431	ClpB_D2-small	0.77
PF00483	NTP_transferase	0.77
PF09360	zf-CDGSH	0.77
PF01507	PAPS_reduct	0.77
PF02913	FAD-oxidase_C	0.77
PF04143	Sulf_transp	0.77
PF02653	BPD_transp_2	0.77
PF02709	Glyco_transf_7C	0.77
PF13356	Arm-DNA-bind_3	0.77
PF08238	Sel1	0.77
PF13432	TPR_16	0.77
PF05509	TraY	0.77
PF03364	Polyketide_cyc	0.77
PF01050	MannoseP_isomer	0.77
PF00232	Glyco_hydro_1	0.77
PF00816	Histone_HNS	0.77
PF00353	HemolysinCabind	0.77
PF13483	Lactamase_B_3	0.77
PF00266	Aminotran_5	0.77
PF05721	PhyH	0.77
PF13580	SIS_2	0.77
PF02771	Acyl-CoA_dh_N	0.77
PF04940	BLUF	0.77
PF00852	Glyco_transf_10	0.77
PF01243	Putative_PNPOx	0.77
PF01609	DDE_Tnp_1	0.77
PF05199	GMC_oxred_C	0.77
PF00271	Helicase_C	0.77

COG ID	Name	Functional Category	% Frequency in 130 Family Scaffolds
COG0451	Nucleoside-diphosphate-sugar epimerase	Cell wall/membrane/envelope biogenesis [M]	4.62
COG0702	Uncharacterized conserved protein YbjT, contains NAD(P)-binding and DUF2867 domains	General function prediction only [R]	4.62
COG1086	NDP-sugar epimerase, includes UDP-GlcNAc-inverting 4,6-dehydratase FlaA1 and capsular polysaccharide biosynthesis protein EpsC	Cell wall/membrane/envelope biogenesis [M]	4.62
COG3181	Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctC	Energy production and conversion [C]	2.31
COG1087	UDP-glucose 4-epimerase	Cell wall/membrane/envelope biogenesis [M]	2.31
COG1088	dTDP-D-glucose 4,6-dehydratase	Cell wall/membrane/envelope biogenesis [M]	2.31
COG1089	GDP-D-mannose dehydratase	Cell wall/membrane/envelope biogenesis [M]	2.31
COG1091	dTDP-4-dehydrorhamnose reductase	Cell wall/membrane/envelope biogenesis [M]	2.31
COG2148	Sugar transferase involved in LPS biosynthesis (colanic, teichoic acid)	Cell wall/membrane/envelope biogenesis [M]	1.54
COG0020	Undecaprenyl pyrophosphate synthase	Lipid transport and metabolism [I]	1.54
COG4249	Uncharacterized conserved protein, contains caspase domain	General function prediction only [R]	1.54
COG5433	Predicted transposase YbfD/YdcC associated with H repeats	Mobilome: prophages, transposons [X]	0.77
COG3293	Transposase	Mobilome: prophages, transposons [X]	0.77
COG3385	IS4 transposase InsG	Mobilome: prophages, transposons [X]	0.77
COG5285	Ectoine hydroxylase-related dioxygenase, phytanoyl-CoA dioxygenase (PhyH) family	Secondary metabolites biosynthesis, transport and catabolism [Q]	0.77
COG5421	Transposase	Mobilome: prophages, transposons [X]	0.77
COG2303	Choline dehydrogenase or related flavoprotein	Lipid transport and metabolism [I]	0.77
COG5659	SRSO17 transposase	Mobilome: prophages, transposons [X]	0.77
COG3039	Transposase and inactivated derivatives, IS5 family	Mobilome: prophages, transposons [X]	0.77
COG2916	DNA-binding protein H-NS	Transcription [K]	0.77
COG2723	Beta-glucosidase/6-phospho-beta-glucosidase/beta-galactosidase	Carbohydrate transport and metabolism [G]	0.77
COG2391	Uncharacterized membrane protein YedE/YeeE, contains two sulfur transport domains	General function prediction only [R]	0.77
COG2192	Predicted carbamoyl transferase, NodU family	General function prediction only [R]	0.77
COG1960	Acyl-CoA dehydrogenase related to the alkylation response protein AidB	Lipid transport and metabolism [I]	0.77
COG0277	FAD/FMN-containing lactate dehydrogenase/glycolate oxidase	Energy production and conversion [C]	0.77

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
All Organisms	root	All Organisms	60.77 %
Unclassified	root	N/A	39.23 %

Name	Rank	Taxonomy	Distribution
cellular organisms	root	All Organisms → cellular organisms	60.77 %
Unclassified	root	N/A	39.23 %

Name	Rank	Taxonomy	Distribution
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	60.77 %
Unclassified	root	N/A	39.23 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	39.23 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	38.46 %
Nitrospinae/Tectomicrobia group	clade	All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group	0.77 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	39.23 %
Betaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	18.46 %
Gammaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	3.85 %
delta/epsilon subdivisions	subphylum	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions	1.54 %
Alphaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1.54 %
Nitrospinae	phylum	All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Nitrospinae	0.77 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	39.23 %
Burkholderiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	13.85 %
Methylococcales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales	1.54 %
unclassified Betaproteobacteria	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria	1.54 %
Deltaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	1.54 %
unclassified Nitrospinota	no rank	All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Nitrospinae → unclassified Nitrospinota	0.77 %
Rhodospirillales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales	0.77 %
Gammaproteobacteria incertae sedis	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis	0.77 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	39.23 %
Comamonadaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae	5.38 %
Burkholderiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae	3.85 %
Betaproteobacteria bacterium MOLA814	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium MOLA814	1.54 %
Methylococcaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae	1.54 %
Candidatus Kentron	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → Candidatus Kentron	0.77 %
Myxococcales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales	0.77 %
Nitrospinae bacterium SCGC AAA008-D05	species	All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Nitrospinae → unclassified Nitrospinota → Nitrospinae bacterium SCGC AAA008-D05	0.77 %
Desulfuromonadales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales	0.77 %
Burkholderiales genera incertae sedis	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiales genera incertae sedis	0.77 %
Rhodospirillales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales	0.77 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	39.23 %
Limnohabitans	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Limnohabitans	2.31 %
Polynucleobacter	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Polynucleobacter	2.31 %
Methylomonas	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → Methylomonas	1.54 %
Betaproteobacteria bacterium MOLA814	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium MOLA814	1.54 %
Paraburkholderia	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Paraburkholderia	0.77 %
unclassified Candidatus Kentron	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → Candidatus Kentron → unclassified Candidatus Kentron	0.77 %
Caenimonas	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Caenimonas	0.77 %
Geobacteraceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae	0.77 %
Ideonella	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiales genera incertae sedis → Ideonella	0.77 %
unclassified Comamonadaceae	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → unclassified Comamonadaceae	0.77 %
Lautropia	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Lautropia	0.77 %
Cystobacterineae	suborder	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae	0.77 %
Nitrospinae bacterium SCGC AAA008-D05	species	All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Nitrospinae → unclassified Nitrospinota → Nitrospinae bacterium SCGC AAA008-D05	0.77 %
Rhodospirillales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales	0.77 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	39.23 %
Limnohabitans	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Limnohabitans	2.31 %
unclassified Methylomonas	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → Methylomonas → unclassified Methylomonas	1.54 %
Betaproteobacteria bacterium MOLA814	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium MOLA814	1.54 %
unclassified Lautropia	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Lautropia → unclassified Lautropia	0.77 %
Comamonadaceae bacterium CG12_big_fil_rev_8_21_14_0_65_59_15	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → unclassified Comamonadaceae → Comamonadaceae bacterium CG12_big_fil_rev_8_21_14_0_65_59_15	0.77 %
Candidatus Kentron sp. UNK	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → Candidatus Kentron → unclassified Candidatus Kentron → Candidatus Kentron sp. UNK	0.77 %
unclassified Ideonella	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiales genera incertae sedis → Ideonella → unclassified Ideonella	0.77 %
unclassified Polynucleobacter	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Polynucleobacter → unclassified Polynucleobacter	0.77 %
Paraburkholderia elongata	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Paraburkholderia → Paraburkholderia elongata	0.77 %
Anaeromyxobacteraceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Anaeromyxobacteraceae	0.77 %
Caenimonas	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Caenimonas	0.77 %
Geobacteraceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae	0.77 %
Nitrospinae bacterium SCGC AAA008-D05	species	All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Nitrospinae → unclassified Nitrospinota → Nitrospinae bacterium SCGC AAA008-D05	0.77 %
Rhodospirillales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales	0.77 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	39.23 %
Limnohabitans	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Limnohabitans	2.31 %
Methylomonas sp. WSC-6	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → Methylomonas → unclassified Methylomonas → Methylomonas sp. WSC-6	1.54 %
Betaproteobacteria bacterium MOLA814	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium MOLA814	1.54 %
Ideonella sp. MAG2	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiales genera incertae sedis → Ideonella → unclassified Ideonella → Ideonella sp. MAG2	0.77 %
Polynucleobacter sp. 73C-SIWE	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Polynucleobacter → unclassified Polynucleobacter → Polynucleobacter sp. 73C-SIWE	0.77 %
Lautropia sp. SCN 66-9	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Lautropia → unclassified Lautropia → Lautropia sp. SCN 66-9	0.77 %
Anaeromyxobacter	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Anaeromyxobacteraceae → Anaeromyxobacter	0.77 %
Comamonadaceae bacterium CG12_big_fil_rev_8_21_14_0_65_59_15	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → unclassified Comamonadaceae → Comamonadaceae bacterium CG12_big_fil_rev_8_21_14_0_65_59_15	0.77 %
Candidatus Kentron sp. UNK	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → Candidatus Kentron → unclassified Candidatus Kentron → Candidatus Kentron sp. UNK	0.77 %
Paraburkholderia elongata	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Paraburkholderia → Paraburkholderia elongata	0.77 %
Caenimonas	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Caenimonas	0.77 %
Geobacteraceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae	0.77 %
Nitrospinae bacterium SCGC AAA008-D05	species	All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Nitrospinae → unclassified Nitrospinota → Nitrospinae bacterium SCGC AAA008-D05	0.77 %
Rhodospirillales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales	0.77 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
3300002140\|M2t2FKB2_1008357	Not Available	500	Open in IMG/M
3300003388\|JGI25910J50241_10040011	All Organisms → cellular organisms → Bacteria → Proteobacteria	1524	Open in IMG/M
3300003411\|JGI25911J50253_10042353	All Organisms → cellular organisms → Bacteria → Proteobacteria	1601	Open in IMG/M
3300003412\|JGI25912J50252_10002095	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	6771	Open in IMG/M
3300003986\|Ga0063233_10187376	All Organisms → cellular organisms → Bacteria	634	Open in IMG/M
3300004123\|Ga0066181_10151974	All Organisms → cellular organisms → Bacteria	653	Open in IMG/M
3300004126\|Ga0066179_10173042	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Limnohabitans	594	Open in IMG/M
3300004126\|Ga0066179_10243300	Not Available	513	Open in IMG/M
3300004794\|Ga0007751_11407774	All Organisms → cellular organisms → Bacteria	931	Open in IMG/M
3300005517\|Ga0070374_10053399	All Organisms → cellular organisms → Bacteria → Proteobacteria	2101	Open in IMG/M
3300005517\|Ga0070374_10480835	Not Available	621	Open in IMG/M
3300005517\|Ga0070374_10580991	All Organisms → cellular organisms → Bacteria → Proteobacteria	556	Open in IMG/M
3300005580\|Ga0049083_10037379	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Paraburkholderia → Paraburkholderia elongata	1727	Open in IMG/M
3300005580\|Ga0049083_10147154	Not Available	808	Open in IMG/M
3300005582\|Ga0049080_10025077	Not Available	2081	Open in IMG/M
3300005582\|Ga0049080_10025169	All Organisms → cellular organisms → Bacteria	2077	Open in IMG/M
3300005582\|Ga0049080_10077693	Not Available	1136	Open in IMG/M
3300005582\|Ga0049080_10108160	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Limnohabitans	943	Open in IMG/M
3300007545\|Ga0102873_1056294	Not Available	1200	Open in IMG/M
3300007708\|Ga0102859_1165386	Not Available	652	Open in IMG/M
3300007974\|Ga0105747_1304480	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	540	Open in IMG/M
3300008117\|Ga0114351_1269811	Not Available	828	Open in IMG/M
3300009051\|Ga0102864_1055973	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium MOLA814	1068	Open in IMG/M
3300009151\|Ga0114962_10031350	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Polynucleobacter	3644	Open in IMG/M
3300009151\|Ga0114962_10049475	All Organisms → cellular organisms → Bacteria → Proteobacteria	2775	Open in IMG/M
3300009151\|Ga0114962_10050669	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	2735	Open in IMG/M
3300009151\|Ga0114962_10053836	Not Available	2639	Open in IMG/M
3300009151\|Ga0114962_10097595	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Lautropia → unclassified Lautropia → Lautropia sp. SCN 66-9	1834	Open in IMG/M
3300009151\|Ga0114962_10232174	Not Available	1061	Open in IMG/M
3300009151\|Ga0114962_10355636	Not Available	802	Open in IMG/M
3300009151\|Ga0114962_10469190	Not Available	670	Open in IMG/M
3300009151\|Ga0114962_10646647	Not Available	545	Open in IMG/M
3300009159\|Ga0114978_10700568	Not Available	577	Open in IMG/M
3300009180\|Ga0114979_10589320	All Organisms → cellular organisms → Bacteria	636	Open in IMG/M
3300009182\|Ga0114959_10011443	All Organisms → cellular organisms → Bacteria → Proteobacteria	6059	Open in IMG/M
3300009182\|Ga0114959_10287826	Not Available	823	Open in IMG/M
3300009183\|Ga0114974_10191874	Not Available	1253	Open in IMG/M
3300009684\|Ga0114958_10137649	All Organisms → cellular organisms → Bacteria	1242	Open in IMG/M
3300009684\|Ga0114958_10262166	Not Available	852	Open in IMG/M
3300010157\|Ga0114964_10088305	Not Available	1552	Open in IMG/M
3300010158\|Ga0114960_10240812	Not Available	928	Open in IMG/M
3300010334\|Ga0136644_10806659	Not Available	504	Open in IMG/M
3300010370\|Ga0129336_10035911	All Organisms → cellular organisms → Bacteria → Proteobacteria	2989	Open in IMG/M
3300010885\|Ga0133913_10028759	All Organisms → cellular organisms → Bacteria → Proteobacteria	14897	Open in IMG/M
3300010885\|Ga0133913_10286443	All Organisms → cellular organisms → Bacteria → Proteobacteria	4369	Open in IMG/M
3300010885\|Ga0133913_10370218	Not Available	3789	Open in IMG/M
3300010885\|Ga0133913_10413598	All Organisms → cellular organisms → Bacteria → Proteobacteria	3564	Open in IMG/M
3300010885\|Ga0133913_10596545	Not Available	2900	Open in IMG/M
3300010885\|Ga0133913_10730401	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	2588	Open in IMG/M
3300010885\|Ga0133913_11163112	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → Methylomonas → unclassified Methylomonas → Methylomonas sp. WSC-6	1981	Open in IMG/M
3300010885\|Ga0133913_11371143	All Organisms → cellular organisms → Bacteria	1801	Open in IMG/M
3300010885\|Ga0133913_11595852	All Organisms → cellular organisms → Bacteria	1647	Open in IMG/M
3300010885\|Ga0133913_11623779	Not Available	1630	Open in IMG/M
3300010885\|Ga0133913_12187731	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Caenimonas	1364	Open in IMG/M
3300010885\|Ga0133913_12353219	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → unclassified Comamonadaceae → Comamonadaceae bacterium CG12_big_fil_rev_8_21_14_0_65_59_15	1305	Open in IMG/M
3300010885\|Ga0133913_12371071	All Organisms → cellular organisms → Bacteria → Proteobacteria	1299	Open in IMG/M
3300010885\|Ga0133913_12373765	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae	1298	Open in IMG/M
3300010885\|Ga0133913_12581687	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1234	Open in IMG/M
3300010885\|Ga0133913_12893683	All Organisms → cellular organisms → Bacteria	1151	Open in IMG/M
3300010885\|Ga0133913_13136245	All Organisms → cellular organisms → Bacteria	1096	Open in IMG/M
3300010885\|Ga0133913_13140359	All Organisms → cellular organisms → Bacteria	1095	Open in IMG/M
3300012013\|Ga0153805_1076962	Not Available	566	Open in IMG/M
3300013006\|Ga0164294_10036116	All Organisms → cellular organisms → Bacteria	3923	Open in IMG/M
3300013006\|Ga0164294_10049032	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	3286	Open in IMG/M
3300013006\|Ga0164294_10061575	Not Available	2872	Open in IMG/M
3300013006\|Ga0164294_10311067	All Organisms → cellular organisms → Bacteria → Proteobacteria	1091	Open in IMG/M
3300013006\|Ga0164294_10759389	All Organisms → cellular organisms → Bacteria	654	Open in IMG/M
3300013286\|Ga0136641_1005720	All Organisms → cellular organisms → Bacteria → Proteobacteria	4500	Open in IMG/M
3300018815\|Ga0187845_1299475	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → Candidatus Kentron → unclassified Candidatus Kentron → Candidatus Kentron sp. UNK	506	Open in IMG/M
3300018868\|Ga0187844_10058366	Not Available	1806	Open in IMG/M
3300018868\|Ga0187844_10424621	Not Available	543	Open in IMG/M
3300019093\|Ga0187843_10052785	All Organisms → cellular organisms → Bacteria	1938	Open in IMG/M
3300019093\|Ga0187843_10074180	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiales genera incertae sedis → Ideonella → unclassified Ideonella → Ideonella sp. MAG2	1571	Open in IMG/M
3300020160\|Ga0211733_11238515	Not Available	530	Open in IMG/M
3300020164\|Ga0194037_1042029	All Organisms → cellular organisms → Bacteria	1790	Open in IMG/M
3300020164\|Ga0194037_1066247	All Organisms → cellular organisms → Bacteria	1324	Open in IMG/M
3300020167\|Ga0194035_1068070	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1195	Open in IMG/M
3300021079\|Ga0194055_10147702	Not Available	992	Open in IMG/M
3300021340\|Ga0194041_10196564	Not Available	616	Open in IMG/M
3300021519\|Ga0194048_10044539	Not Available	1812	Open in IMG/M
3300022752\|Ga0214917_10029619	All Organisms → cellular organisms → Bacteria	4148	Open in IMG/M
3300022752\|Ga0214917_10046007	All Organisms → cellular organisms → Bacteria	3018	Open in IMG/M
3300023174\|Ga0214921_10034991	All Organisms → cellular organisms → Bacteria → Proteobacteria	4805	Open in IMG/M
3300023174\|Ga0214921_10053789	All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Nitrospinae → unclassified Nitrospinota → Nitrospinae bacterium SCGC AAA008-D05	3498	Open in IMG/M
3300023174\|Ga0214921_10157255	All Organisms → cellular organisms → Bacteria → Proteobacteria	1524	Open in IMG/M
3300023174\|Ga0214921_10372433	Not Available	746	Open in IMG/M
3300023174\|Ga0214921_10455144	Not Available	629	Open in IMG/M
3300023174\|Ga0214921_10512966	Not Available	565	Open in IMG/M
3300023174\|Ga0214921_10526751	All Organisms → cellular organisms → Bacteria	552	Open in IMG/M
3300023174\|Ga0214921_10532036	All Organisms → cellular organisms → Bacteria	547	Open in IMG/M
3300023184\|Ga0214919_10000874	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	51054	Open in IMG/M
3300023184\|Ga0214919_10009672	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales	12395	Open in IMG/M
3300023184\|Ga0214919_10023977	All Organisms → cellular organisms → Bacteria → Proteobacteria	6650	Open in IMG/M
3300023184\|Ga0214919_10040349	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	4648	Open in IMG/M
3300023184\|Ga0214919_10112354	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Anaeromyxobacteraceae → Anaeromyxobacter	2279	Open in IMG/M
3300023184\|Ga0214919_10140889	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → Methylomonas → unclassified Methylomonas → Methylomonas sp. WSC-6	1937	Open in IMG/M
3300023184\|Ga0214919_10203646	Not Available	1482	Open in IMG/M
3300023184\|Ga0214919_10249614	All Organisms → cellular organisms → Bacteria	1273	Open in IMG/M
3300023184\|Ga0214919_10525047	Not Available	721	Open in IMG/M
3300024311\|Ga0255211_1066105	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	604	Open in IMG/M
3300024501\|Ga0255208_1028194	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium MOLA814	878	Open in IMG/M
3300024563\|Ga0255236_1003182	All Organisms → cellular organisms → Bacteria	3555	Open in IMG/M
3300024566\|Ga0256309_1065488	Not Available	940	Open in IMG/M
3300027128\|Ga0255099_1000136	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae	30566	Open in IMG/M
3300027128\|Ga0255099_1007686	All Organisms → cellular organisms → Bacteria	2435	Open in IMG/M
3300027128\|Ga0255099_1010661	All Organisms → cellular organisms → Bacteria → Proteobacteria	1906	Open in IMG/M
3300027608\|Ga0208974_1003064	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	6073	Open in IMG/M
3300027679\|Ga0209769_1210042	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Limnohabitans	601	Open in IMG/M
3300027697\|Ga0209033_1002722	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae	9561	Open in IMG/M
3300027708\|Ga0209188_1120624	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Polynucleobacter → unclassified Polynucleobacter → Polynucleobacter sp. 73C-SIWE	1024	Open in IMG/M
3300027712\|Ga0209499_1098601	All Organisms → cellular organisms → Bacteria	1113	Open in IMG/M
3300027733\|Ga0209297_1347292	Not Available	539	Open in IMG/M
3300027746\|Ga0209597_1187531	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	856	Open in IMG/M
3300027749\|Ga0209084_1082754	Not Available	1450	Open in IMG/M
3300027749\|Ga0209084_1145629	Not Available	997	Open in IMG/M
3300027749\|Ga0209084_1285233	All Organisms → cellular organisms → Bacteria	628	Open in IMG/M
3300027754\|Ga0209596_1390377	Not Available	525	Open in IMG/M
3300027772\|Ga0209768_10322330	Not Available	642	Open in IMG/M
3300027892\|Ga0209550_10799154	Not Available	529	Open in IMG/M
3300028392\|Ga0304729_1080497	All Organisms → cellular organisms → Bacteria	1144	Open in IMG/M
3300031758\|Ga0315907_10726605	Not Available	751	Open in IMG/M
3300031758\|Ga0315907_10939618	Not Available	631	Open in IMG/M
3300031786\|Ga0315908_10185416	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Polynucleobacter	1722	Open in IMG/M
3300031857\|Ga0315909_10272643	Not Available	1283	Open in IMG/M
3300031857\|Ga0315909_10336868	Not Available	1109	Open in IMG/M
3300032050\|Ga0315906_11076318	Not Available	596	Open in IMG/M
3300033995\|Ga0335003_0434321	All Organisms → cellular organisms → Bacteria	555	Open in IMG/M
3300034095\|Ga0335022_0029738	All Organisms → cellular organisms → Bacteria	3617	Open in IMG/M
3300034121\|Ga0335058_0658030	Not Available	581	Open in IMG/M
3300034121\|Ga0335058_0689453	Not Available	564	Open in IMG/M

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:

Habitat	Taxonomy	Distribution
Environmental	Environmental	100.00%

Habitat	Taxonomy	Distribution
Aquatic	Environmental → Aquatic	100.00%

Habitat	Taxonomy	Distribution
Freshwater	Environmental → Aquatic → Freshwater	95.38%
Marine	Environmental → Aquatic → Marine	3.85%
Unclassified	Environmental → Aquatic → Unclassified	0.77%

Habitat	Taxonomy	Distribution
Lake	Environmental → Aquatic → Freshwater → Lake	67.69%
Lentic	Environmental → Aquatic → Freshwater → Lentic	16.92%
River	Environmental → Aquatic → Freshwater → River	5.38%
Unclassified	Environmental → Aquatic → Freshwater → Unclassified	4.62%
Intertidal Zone	Environmental → Aquatic → Marine → Intertidal Zone	2.31%
Coastal	Environmental → Aquatic → Marine → Coastal	1.54%
Ice	Environmental → Aquatic → Freshwater → Ice	0.77%
Unclassified	Environmental → Aquatic → Unclassified → Unclassified	0.77%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Aquatic → Freshwater → Lake → Unclassified	67.69%
Unclassified	Environmental → Aquatic → Freshwater → Lentic → Unclassified	16.92%
Unclassified	Environmental → Aquatic → Freshwater → River → Unclassified	5.38%
Unclassified	Environmental → Aquatic → Freshwater → Unclassified → Unclassified	4.62%
Estuary	Environmental → Aquatic → Marine → Intertidal Zone → Estuary	2.31%
Unclassified	Environmental → Aquatic → Marine → Coastal → Unclassified	1.54%
Unclassified	Environmental → Aquatic → Freshwater → Ice → Unclassified	0.77%
Unclassified	Environmental → Aquatic → Unclassified → Unclassified → Unclassified	0.77%

Habitat	Taxonomy	Distribution
Freshwater Lake	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake	35.38%
Freshwater	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater	21.54%
Freshwater Lake	Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake	11.54%
Freshwater Lentic	Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic	5.38%
Freshwater	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater	5.38%
Freshwater	Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater	5.38%
Anoxic Zone Freshwater	Environmental → Aquatic → Freshwater → Lake → Unclassified → Anoxic Zone Freshwater	4.62%
Freshwater	Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater	4.62%
Estuarine	Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine	2.31%
Freshwater, Plankton	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton	0.77%
Surface Ice	Environmental → Aquatic → Freshwater → Ice → Unclassified → Surface Ice	0.77%
Freshwater To Marine Saline Gradient	Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient	0.77%
Estuary Water	Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water	0.77%
Marine	Environmental → Aquatic → Unclassified → Unclassified → Unclassified → Marine	0.77%

Visualization

Powered by ApexCharts

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
3300002140	Marine microbial communities from the Baltic Sea, analyzing arctic terrigenous carbon compounds - M2t2FKB2 (112f)	Environmental	Open in IMG/M
3300003388	Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.SN	Environmental	Open in IMG/M
3300003411	Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.SD	Environmental	Open in IMG/M
3300003412	Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.DD	Environmental	Open in IMG/M
3300003986	Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM110.SN (v2)	Environmental	Open in IMG/M
3300004123	Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM110.SD (version 2)	Environmental	Open in IMG/M
3300004126	Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.DN (version 2)	Environmental	Open in IMG/M
3300004794	Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM110.SN (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300005517	Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (version 4)	Environmental	Open in IMG/M
3300005580	Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG MI27MSRF	Environmental	Open in IMG/M
3300005582	Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF	Environmental	Open in IMG/M
3300007545	Estuarine microbial communities from the Columbia River estuary - metaG 1547B-3	Environmental	Open in IMG/M
3300007708	Estuarine microbial communities from the Columbia River estuary - metaG 1371B-02	Environmental	Open in IMG/M
3300007974	Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460C_0.2um	Environmental	Open in IMG/M
3300008117	Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-C-NA	Environmental	Open in IMG/M
3300009051	Estuarine microbial communities from the Columbia River estuary - metaG 1449B-02	Environmental	Open in IMG/M
3300009151	Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_MF_MetaG	Environmental	Open in IMG/M
3300009159	Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG	Environmental	Open in IMG/M
3300009180	Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaG	Environmental	Open in IMG/M
3300009182	Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_EF_MetaG	Environmental	Open in IMG/M
3300009183	Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG	Environmental	Open in IMG/M
3300009684	Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130208_EF_MetaG	Environmental	Open in IMG/M
3300010157	Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_MF_MetaG	Environmental	Open in IMG/M
3300010158	Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_MF_MetaG	Environmental	Open in IMG/M
3300010334	Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_EF_MetaG (v2)	Environmental	Open in IMG/M
3300010370	Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.2_DNA	Environmental	Open in IMG/M
3300010885	northern Canada Lakes Co-assembly	Environmental	Open in IMG/M
3300012013	Freshwater microbial communities from Eastern Basin Lake Erie, Ontario, Canada - Station 67 - Surface Ice	Environmental	Open in IMG/M
3300013006	Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - GEODES005 metaG	Environmental	Open in IMG/M
3300013286	Freshwater microbial communities from Elizabeth Lake, Yosemite National Park, California, USA - 13020-23Y	Environmental	Open in IMG/M
3300018815	Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - SP09_SKY_68	Environmental	Open in IMG/M
3300018868	Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - SP09_SKY_50	Environmental	Open in IMG/M
3300019093	Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - SP09_SKY_43	Environmental	Open in IMG/M
3300020160	Freshwater lake microbial communities from Lake Erken, Sweden - P4710_105 megahit1	Environmental	Open in IMG/M
3300020164	Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Jun2016-L304-6m	Environmental	Open in IMG/M
3300020167	Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Jun2016-L239-20m	Environmental	Open in IMG/M
3300021079	Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Sep2016-L442-9m	Environmental	Open in IMG/M
3300021340	Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Jun2016-L442-9m	Environmental	Open in IMG/M
3300021519	Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Jun2016-L222-5m	Environmental	Open in IMG/M
3300022752	Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL_1208_BB	Environmental	Open in IMG/M
3300023174	Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1505	Environmental	Open in IMG/M
3300023184	Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1503	Environmental	Open in IMG/M
3300024311	Freshwater microbial communities from Mississippi River, Louisiana, United States - Miss_Yuk_RepB_8d	Environmental	Open in IMG/M
3300024501	Freshwater microbial communities from Mississippi River, Louisiana, United States - Miss_Miss_RepB_8d	Environmental	Open in IMG/M
3300024563	Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Cont_RepB_8d (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300024566	Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Colum_RepA_8d (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300027128	Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Colum_RepA_8d	Environmental	Open in IMG/M
3300027608	Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF (SPAdes)	Environmental	Open in IMG/M
3300027679	Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.DN (SPAdes)	Environmental	Open in IMG/M
3300027697	Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.DN (SPAdes)	Environmental	Open in IMG/M
3300027708	Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_EF_MetaG (SPAdes)	Environmental	Open in IMG/M
3300027712	Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130208_EF_MetaG (SPAdes)	Environmental	Open in IMG/M
3300027733	Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG (SPAdes)	Environmental	Open in IMG/M
3300027746	Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140625_MF_MetaG (SPAdes)	Environmental	Open in IMG/M
3300027749	Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_MF_MetaG (SPAdes)	Environmental	Open in IMG/M
3300027754	Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG (SPAdes)	Environmental	Open in IMG/M
3300027772	Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.SD (SPAdes)	Environmental	Open in IMG/M
3300027892	Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (SPAdes)	Environmental	Open in IMG/M
3300028392	Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_MF_MetaG (v2)	Environmental	Open in IMG/M
3300031758	Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123	Environmental	Open in IMG/M
3300031786	Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA124	Environmental	Open in IMG/M
3300031857	Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125	Environmental	Open in IMG/M
3300032050	Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA122	Environmental	Open in IMG/M
3300033995	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23May2014-rr0056	Environmental	Open in IMG/M
3300034095	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Feb2014D0-rr0091	Environmental	Open in IMG/M
3300034121	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME19May2015-rr0174	Environmental	Open in IMG/M

Geographical Distribution

Zoom:	Powered by OpenStreetMap

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
M2t2FKB2_10083571	3300002140	Marine	LAEVFVGHKQLRLPGQEALNAKHPQPPNHQLFKVALRP*
JGI25910J50241_100400112	3300003388	Freshwater Lake	VNLISFSLAEVFVFHKQLRLPGQEALNAIHPQPPNHQLIKVALRA*
JGI25911J50253_100423531	3300003411	Freshwater Lake	VSFNLAEVFAIHRRLRLEGQKALNAKHSQPPSPQLIKVALCA*
JGI25912J50252_100020951	3300003412	Freshwater Lake	NLISFSLAEVFVGHKQLRLPGQEALNAKHPQPPIHQLFKVALRA*
Ga0063233_101873761	3300003986	Freshwater Lake	SFSLAEVFVGHKQLRLPGQEALNAKHLQLLIHQLFKVALSA*
Ga0066181_101519741	3300004123	Freshwater Lake	NLISFSLAEVFVGHKQLRLPGQEALNAKHLQLLIHQLFKVALSA*
Ga0066179_101730422	3300004126	Freshwater Lake	ISFHLAEMFVIHGQLRLAGQKALNAKHSQPPALTLIKVALRA*
Ga0066179_102433002	3300004126	Freshwater Lake	FNLAEMFVVHGQLRLAGQEVLNAKHSQPPLLQLIKVAFRA*
Ga0007751_114077742	3300004794	Freshwater Lake	NLAEMFVGHGQLRLAGQEALDAKHSQPPSPQLIKVALRA*
Ga0070374_100533992	3300005517	Freshwater Lake	VFLGHKLLRQLGQEYLNAKHPQPPNHQLIKVVLRP*
Ga0070374_104808352	3300005517	Freshwater Lake	GLSVSGHKLLRQLGQEYLNAKHPQPPKHQLIKVVLRP*
Ga0070374_105809911	3300005517	Freshwater Lake	LISFNLAEMFVVHGQLRLAGQEALNAKHSQPPSLQLLKVALRA*
Ga0049083_100373792	3300005580	Freshwater Lentic	AEVFVFHKQLRLPGQEALNAIHPQPPNHQLIKVALRA*
Ga0049083_101471541	3300005580	Freshwater Lentic	VFVFHKQLRLPGQEALNAIHPQPPNHQLIKVALRA*
Ga0049080_100250773	3300005582	Freshwater Lentic	FSLAEVFVFHKQLRLPGQEALNAIHPQPPKHQLIKVALHA*
Ga0049080_100251692	3300005582	Freshwater Lentic	LAEVFVFHKQLRLPGQEALNAIHPQPPNHQLIKVALRA*
Ga0049080_100776934	3300005582	Freshwater Lentic	EMFVGHGQLRLAGQEALNAKHSQPPSPGLIKVALRA*
Ga0049080_101081602	3300005582	Freshwater Lentic	VNLISFSLAEVFVFHKQLRLPGQEALNAIHPQPLNLQLIKVALRV*
Ga0102873_10562941	3300007545	Estuarine	NLISFSLAEVFVGHKQLRLPGQEALNAKHPQPPNHPLFKVALRA*
Ga0102859_11653861	3300007708	Estuarine	VFVCHMQIRLPGQEALNAINPNLSNPQLIKVALRA*
Ga0105747_13044801	3300007974	Estuary Water	NLISFSLAEVFVGHKQLRLPGQEALNAKHPQPPNHQLFKVALRT*
Ga0114351_12698112	3300008117	Freshwater, Plankton	FVVHGQLRLAGQEALNAKHSQPPSLKLIKVALRA*
Ga0102864_10559733	3300009051	Estuarine	FSLAEVFVFHKQLRLPGQEALNAIHPQPPNHQLIKVALRA*
Ga0114962_100313501	3300009151	Freshwater Lake	EMFVIHGQLRLAGQEALNAKHSQPPSPQLIKVALRA*
Ga0114962_100494753	3300009151	Freshwater Lake	HLAEMFVVHGQLRLAGQEALNAKHSQPPSPQLIKVGLRA*
Ga0114962_100506695	3300009151	Freshwater Lake	FVGHKQLRLPGQEALNAKHPQPPNLQLIKVALRA*
Ga0114962_100538365	3300009151	Freshwater Lake	AEMFVIHGQLRLAGQEALNAKHSQPPSPQLIKVALRA*
Ga0114962_100975954	3300009151	Freshwater Lake	AEVFVFHKQLRLPGQEALNAIHPQPPIHQLIKVALRA*
Ga0114962_102321742	3300009151	Freshwater Lake	FVFHKQLRLPGQEALNAIHPQPPNHQLIKVALRA*
Ga0114962_103556362	3300009151	Freshwater Lake	AEVFVFHKQLRLPGQEALNAIHPQPPYHQLIKVALRA*
Ga0114962_104691901	3300009151	Freshwater Lake	AEVFVGHKQLRLPGQEALNAKHPQPPNLQLIKVALRA*
Ga0114962_106466472	3300009151	Freshwater Lake	FVIHGQLRLAGQEALNAKHSQPPSPQLIKVALRA*
Ga0114978_107005682	3300009159	Freshwater Lake	SFNLAEMFVIHGQLRLAGQEALNAKHSQPPSPQLIKVALRA*
Ga0114979_105893201	3300009180	Freshwater Lake	AEVFVFHKQLRLPGQEALDAIHPQPPNHQLIKVALRA*
Ga0114959_100114436	3300009182	Freshwater Lake	VFVGHKQLRLPGQEALNAKHPQPPNHQLIKVALRA*
Ga0114959_102878261	3300009182	Freshwater Lake	LISFSLAEVFVFHKQLRLPGQEALNAIHPQPPYHQLIQVALRA*
Ga0114974_101918742	3300009183	Freshwater Lake	SLAEMFVGHGQLRLAGQEALNAKHPQPPNHQLIKDAPQN*
Ga0114958_101376493	3300009684	Freshwater Lake	AEVFVFHKQLRLAGQEALNAKHPQPPNHQLIKVALRA*
Ga0114958_102621662	3300009684	Freshwater Lake	VFVGHKQLRLPGQEALNAKHPQPPNLQLIKVALRA*
Ga0114964_100883054	3300010157	Freshwater Lake	LAEMFVIHGQLRLAGQEALNAKHSQPPSPQLIKVALRA*
Ga0114960_102408121	3300010158	Freshwater Lake	EVFVGHKQLRLPGQEALNAKHPQPPNLQLIKVALRA*
Ga0136644_108066592	3300010334	Freshwater Lake	SLAEVFVFHKQLRLPGQEALNAIHPQPPNHQLIKDALRA*
Ga0129336_100359114	3300010370	Freshwater To Marine Saline Gradient	ISFSLAEVFVGRKQLRLPGHEALNAKYLQPHNHQ*
Ga0133913_100287591	3300010885	Freshwater Lake	AEVFVGHKQLRLPGQEALNAKHPQPPIHQLFKVALRD*
Ga0133913_102864431	3300010885	Freshwater Lake	SLAEVFVFHKQLRLPGQEALNAIHPQPPNHQLIKVALRA*
Ga0133913_103702183	3300010885	Freshwater Lake	FSLAEVFVFHKQLRLPGQEALNAIHPQLTNHQLIKVALRA*
Ga0133913_104135984	3300010885	Freshwater Lake	FVFHKQLRLPGQEALNAIHPQPPNHQLIKVELRA*
Ga0133913_105965454	3300010885	Freshwater Lake	EVFVFHKQLRLPGQEALNAIHPQPPNHQLIKVALRA*
Ga0133913_107304014	3300010885	Freshwater Lake	EMFVVHGQLRLAGQEALNAKHSQPPSPQLIKVALRA*
Ga0133913_111631123	3300010885	Freshwater Lake	AEVFVGHKQLRLPGQEALNAKHPQPPNHQLIKVALRA*
Ga0133913_113711433	3300010885	Freshwater Lake	VNLISFSMAEVFVFHKQLRLPGQEALNAIHPQPPNHQLIKDALRA*
Ga0133913_115958523	3300010885	Freshwater Lake	VNLISFSLAEVFVFHKQLRLPGQEALNAIHPQPPNHQLIKVPLRD*
Ga0133913_116237791	3300010885	Freshwater Lake	SLAEVFVFHKQLRLPGQEALNAIHPQPPNHQLIKVELSA*
Ga0133913_121877312	3300010885	Freshwater Lake	AEVFVCHMQIRLPGQEALNAINPNLSNPQLIKVVLRA*
Ga0133913_123532193	3300010885	Freshwater Lake	MFVIHGQLRLAGQEALNAKHSQPPSPQLIKVALRA*
Ga0133913_123710711	3300010885	Freshwater Lake	EVFVFHKQLRLPGQEDLNAMHPQPPNLQLIKLALRA*
Ga0133913_123737652	3300010885	Freshwater Lake	FHLAEMFVIHGQLRLAGQEALNAKHSQPPSPQLIKIALCA*
Ga0133913_125816871	3300010885	Freshwater Lake	SFSLAEVFVFHKQLRLPGQEALNAIHPQPPNLQLIKVALRV*
Ga0133913_128936834	3300010885	Freshwater Lake	AEMFVGHGQLRLAGQEALNAKHSQPPSPGLIKVALRA*
Ga0133913_131362452	3300010885	Freshwater Lake	EVFVFHKQLRLPGQEALNAIHPQPPNHQLIKVALRT*
Ga0133913_131403593	3300010885	Freshwater Lake	EVFVGHKQLRLPGQEALNAKHPQPPNHQLFKVALRA*
Ga0153805_10769622	3300012013	Surface Ice	GVNLISFSLAEVFVFHKQLRLPGQEALNAIHPQPPNHQLIKVALRA*
Ga0164294_100361164	3300013006	Freshwater	MFVGDGQLRLGGQEALNAKHFQPPSPQLIKVALRA*
Ga0164294_100490323	3300013006	Freshwater	ISFSLAEVFVFHKQLRLPGQEALNAIHPQPPNHQLIKVALRT*
Ga0164294_100615754	3300013006	Freshwater	LADMFIVHGQLQLTGQEALNAKHSQPSSQQLIKVALHL*
Ga0164294_103110671	3300013006	Freshwater	ISFSLAEVFVFHKQLRLPGQEALNAIHPQPPNHQLIKVALRA*
Ga0164294_107593892	3300013006	Freshwater	LAEVFVGHKQLRLPGQEALNAKHPQPPNHQLIKVALRT*
Ga0136641_10057201	3300013286	Freshwater	GVDLISFNLAEMFVGHGQLRLAGQEALNAKHSQPPSPQLIKVALRT*
Ga0187845_12994752	3300018815	Freshwater	AEMFVIHGQLRLAGQEALNAKHSQPPLPQLIKVALRA
Ga0187844_100583661	3300018868	Freshwater	VFVFHKQLRLPGQEALNAIHPQPPNHQLIKVALRA
Ga0187844_104246211	3300018868	Freshwater	AEVFVFHKQLRLPGQEALNAIHPQPPNHQLIKVALRA
Ga0187843_100527851	3300019093	Freshwater	LISFHLAEMFVIHGQLRLAGQEALNAKHSQPPSPQLIKVALRA
Ga0187843_100741801	3300019093	Freshwater	FSLAEVFVGHKQLRLPGQEALNAKHPQPPNYQLFKVALRA
Ga0211733_112385152	3300020160	Freshwater	VFVGHKQLRLPGQEALNAKHPQPSNHQLFKVALRA
Ga0194037_10420291	3300020164	Anoxic Zone Freshwater	SLAEVFVGHKQLRLPGQEALNAKHPQPPNLQLIKVALRA
Ga0194037_10662471	3300020164	Anoxic Zone Freshwater	SFSLAEVFVFHKQLRLPGQEALNAIHPQPPNHQLIKVALCA
Ga0194035_10680701	3300020167	Anoxic Zone Freshwater	SNSLAEVFVFHKQLRLPGQEAFNAIHPQPPKHQLIKVALRA
Ga0194055_101477021	3300021079	Anoxic Zone Freshwater	DLISFHLAEMFVVHRQLRLAGQEALNAKHSQPPSPQLIKVALRA
Ga0194041_101965641	3300021340	Anoxic Zone Freshwater	AEMFVIHGQLRLAGQEALNAKHSQPPSPQLIKVALRA
Ga0194048_100445395	3300021519	Anoxic Zone Freshwater	VFVGHKQLRLPGQEALNAKHPQPPNLQLIKVALRA
Ga0214917_100296191	3300022752	Freshwater	ISFSLAEVFVGHKQLRLPGQEALNAKHPQPSNHQLFKVAIRP
Ga0214917_100460071	3300022752	Freshwater	CLAEVFVFHKQLRLAGQEALNAKHPQPPHHQLIKVALRT
Ga0214921_100349916	3300023174	Freshwater	LISFSLAEVFVGHKQLRLPGQEALNAKHPQPPNHQLIKVALRA
Ga0214921_100537893	3300023174	Freshwater	FSLAEVFVFHKQLRLPGQEALNAIHPQPPNHQLIKVALRA
Ga0214921_101572551	3300023174	Freshwater	LAEVFVFHKQLRLPGQEALNAIHPQPPNLQLIKVALRA
Ga0214921_103724331	3300023174	Freshwater	LAEVFVGHKQLRLPGQEALNAKHPQPPNHQLIKVALRA
Ga0214921_104551441	3300023174	Freshwater	VFVFHKQLRLPGQEALNAIHPQPPNLQLIKVALRA
Ga0214921_105129663	3300023174	Freshwater	AEVFVFHKQLRLPGQEALNAIHPQPPNLQLIKVALRA
Ga0214921_105267511	3300023174	Freshwater	LAEVFVGHKQLRLPGQEALNAKHPQPPIHQLFKVALRA
Ga0214921_105320361	3300023174	Freshwater	VNLISFSLAEVFVFHKQLRLPGQEALNAIHPQPPNLQLIKVALRA
Ga0214919_100008741	3300023184	Freshwater	GVDLISFHLAEMFVVHGQLRLAGQEALNAKHSQPPSPQLIKVELCT
Ga0214919_1000967213	3300023184	Freshwater	EVFVGHKQLRLPGQEALNAKHPQPPNHQLIKVALRP
Ga0214919_100239771	3300023184	Freshwater	LAEVFVFHKQLRLPGQEALNAIHPQPPNHQLIKVALRA
Ga0214919_100403491	3300023184	Freshwater	SLAEVFVFHKQLRLPGQEALNAIHPQPPIHQLIKVALRA
Ga0214919_101123541	3300023184	Freshwater	HLAEMFVIHGQLRLAGQEALNAKHSQPPLPQLIKVALRA
Ga0214919_101408891	3300023184	Freshwater	EVFVGHKQLRLPGQEALNAKHPQPPNHQLIKVALRA
Ga0214919_102036461	3300023184	Freshwater	SFHLTEMFVIHGQLRLAGQEALNAKHSQPPSPQLIKVALRA
Ga0214919_102496142	3300023184	Freshwater	EVFVFHKQLRLPGQEALNAIHPQPPNLQLIKVALRA
Ga0214919_105250472	3300023184	Freshwater	MISFHLAEMFVVHGQLRLAGQEALNAKHSQPPLPQLIKVALRA
Ga0255211_10661051	3300024311	Freshwater	SFSLAEVFVGHKQLRLPGQEALNAKHPQPPNHHLFKVALRA
Ga0255208_10281941	3300024501	Freshwater	LAEVFVGHKQLRLPGQEALNAKHPQPPNHHLFKVALRA
Ga0255236_10031821	3300024563	Freshwater	EVFVGHKQLRLPGQEALNAKHPQPPNHQLFKVALRA
Ga0256309_10654882	3300024566	Freshwater	AEVFVGHKQLRLPGQEALNAKHPQPPNHQLFKVALRA
Ga0255099_100013621	3300027128	Freshwater	SLAEVFVGHKQLRLPGQEALNAKHPQPPNHQLFKVALRA
Ga0255099_10076864	3300027128	Freshwater	LAEVFVGHKQLRLPGQEALNAKHPQPPNHQLFKVALRA
Ga0255099_10106614	3300027128	Freshwater	VFVGHKQLRLPGQEALNAKHPQPPNHQLFKVALRA
Ga0208974_10030648	3300027608	Freshwater Lentic	SLAEVFVFHKQLRLPGQEALNAIHPQPPNHQLIKVALRA
Ga0209769_12100422	3300027679	Freshwater Lake	LAEMFVIHGQLRLAGQKALNAKHSQPPALTLIKVALRA
Ga0209033_100272211	3300027697	Freshwater Lake	MFVIHGQLRLAGQEALNAKHSQPPLPQLIKVALRA
Ga0209188_11206242	3300027708	Freshwater Lake	SLAEVFVGHKQLRLPGQEALNAKHPQPPIHQLFKVALRD
Ga0209499_10986014	3300027712	Freshwater Lake	LAEVFVFHKQLRLAGQEALNAKHPQPPNHQLIKVALRA
Ga0209297_13472922	3300027733	Freshwater Lake	LAEMFVVHGQLRLAGQEALNAKHSQPPSPQLIKVALRA
Ga0209597_11875312	3300027746	Freshwater Lake	VNLISFSLAEVFVFHKQLRLPGQEALNAIHPQPPNHQLIKVELRA
Ga0209084_10827543	3300027749	Freshwater Lake	LAEVFVGHKQLRLPGQEALNAKHPQPPNLQLIKVALRA
Ga0209084_11456291	3300027749	Freshwater Lake	EMFVVHGQLRLAGQEALNAKHSQPPSPQLIKVGLRA
Ga0209084_12852332	3300027749	Freshwater Lake	EMFVIHGQLRLAGQEALNAKHSQPPSPQLIKVALRA
Ga0209596_13903772	3300027754	Freshwater Lake	LAEMFVIHGQLRLAGQEALNAKHSQPPSPQLIKVALRA
Ga0209768_103223301	3300027772	Freshwater Lake	EVFVFHKQLRLPGQEALNAIHPQPPNHQLIKVALRA
Ga0209550_107991541	3300027892	Freshwater Lake	VFVCHKQLRLAGQEALNAKHPQPPHHQLFKVALRA
Ga0304729_10804971	3300028392	Freshwater Lake	LAEMFVIHGQLRLAGQEALNAKHSQPSSPQLIKVALRA
Ga0315907_107266051	3300031758	Freshwater	VFKHEAQLRLAGQEALNAKHSQPPSPQLIKVALRA
Ga0315907_109396182	3300031758	Freshwater	LAEMFVIHGQLRLAGQEALNAKHSQPPSLQLIKVALRA
Ga0315908_101854162	3300031786	Freshwater	LAEMFVVHGQLRLAGQEALNAKHSQPPSLQLIKVALRA
Ga0315909_102726432	3300031857	Freshwater	LISFNLAEMFVVHGQLRLAGQEALNAKHSQPPSLQLIKVALRA
Ga0315909_103368681	3300031857	Freshwater	RVNLISFSLVEVFVGHKRLRLPGQEALNAKHPQPSNHQLFKVALRA
Ga0315906_110763181	3300032050	Freshwater	LVEVFVGHKRLRLPGQEALNAKHPQPSNHQLFKVALRA
Ga0335003_0434321_15_131	3300033995	Freshwater	MAEVFVGHKQLRLPGQEALNAKHPQPPDHQLFKVALRA
Ga0335022_0029738_1_108	3300034095	Freshwater	MFIGHEQLRLPGQEALNAKHSQPPSPQLIKVALRA
Ga0335058_0658030_28_135	3300034121	Freshwater	MLKINAQLRLTDQEALNAKHSQSSLLALIKVALFT
Ga0335058_0689453_2_118	3300034121	Freshwater	LAEMFVIHGQLRLAGQEALNAKHSQPPLPQLIKVALRA

Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome / Metatranscriptome Family F062457

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Gene Neighborhood

Neighboring Pfam domains

Neighboring Clusters of Orthologous Genes (COGs)

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences