NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F062250

Metagenome Family F062250

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F062250
Family Type Metagenome
Number of Sequences 131
Average Sequence Length 70 residues
Representative Sequence MNIKSLTLKNKLIIDKTGEGYWDLTAPSFVYDSDLGVKALHYVMQDQVGRIDKISQKYFGSGEFIDAICV
Number of Associated Samples 119
Number of Associated Scaffolds 131

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Viruses
% of genes with valid RBS motifs 0.00 %
% of genes near scaffold ends (potentially truncated) 100.00 %
% of genes from short scaffolds (< 2000 bps) 91.60 %
Associated GOLD sequencing projects 112
AlphaFold2 3D model prediction Yes
3D model pTM-score0.43

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group unclassified viruses (92.366 % of family members)
NCBI Taxonomy ID 12429
Taxonomy All Organisms → Viruses → unclassified viruses

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine
(16.794 % of family members)
Environment Ontology (ENVO) Unclassified
(62.595 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Water (saline)
(74.809 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 21.43%    β-sheet: 6.12%    Coil/Unstructured: 72.45%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.43
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 131 Family Scaffolds
PF03382DUF285 1.53
PF01391Collagen 1.53
PF00383dCMP_cyt_deam_1 0.76
PF14550Peptidase_S78_2 0.76


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms99.24 %
UnclassifiedrootN/A0.76 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000127|SA_S1_NOR05_45mDRAFT_c10064619All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157892Open in IMG/M
3300000973|BBAY93_10065373All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157940Open in IMG/M
3300000973|BBAY93_10142959All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157603Open in IMG/M
3300001450|JGI24006J15134_10159774All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157729Open in IMG/M
3300001589|JGI24005J15628_10224409All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157511Open in IMG/M
3300005608|Ga0066840_10041074All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157926Open in IMG/M
3300005612|Ga0070723_10351912All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157705Open in IMG/M
3300006029|Ga0075466_1187279All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157518Open in IMG/M
3300006735|Ga0098038_1244436All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157568Open in IMG/M
3300006750|Ga0098058_1123430All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157692Open in IMG/M
3300006803|Ga0075467_10136477All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU1571421Open in IMG/M
3300006810|Ga0070754_10198623All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157936Open in IMG/M
3300006990|Ga0098046_1003391All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium5026Open in IMG/M
3300006990|Ga0098046_1058683All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157888Open in IMG/M
3300007539|Ga0099849_1363913All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157512Open in IMG/M
3300007692|Ga0102823_1103434All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157755Open in IMG/M
3300007722|Ga0105051_11298055All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157514Open in IMG/M
3300008120|Ga0114355_1215065All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157601Open in IMG/M
3300008961|Ga0102887_1029151All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU1571900Open in IMG/M
3300008963|Ga0102930_1029215All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU1571420Open in IMG/M
3300008999|Ga0102816_1208029All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157613Open in IMG/M
3300009420|Ga0114994_10793276All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157616Open in IMG/M
3300009422|Ga0114998_10414079All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157630Open in IMG/M
3300009436|Ga0115008_11311750All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157553Open in IMG/M
3300009449|Ga0115558_1222297All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157771Open in IMG/M
3300009467|Ga0115565_10342827All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157677Open in IMG/M
3300009706|Ga0115002_10562290All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157821Open in IMG/M
3300010149|Ga0098049_1216572All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157585Open in IMG/M
3300010318|Ga0136656_1079906All Organisms → Viruses → Predicted Viral1158Open in IMG/M
3300012920|Ga0160423_11065304All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157541Open in IMG/M
3300017710|Ga0181403_1017283All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU1571537Open in IMG/M
3300017720|Ga0181383_1138689All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157653Open in IMG/M
3300017720|Ga0181383_1187846All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157550Open in IMG/M
3300017721|Ga0181373_1067402All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157640Open in IMG/M
3300017725|Ga0181398_1021212All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU1571617Open in IMG/M
3300017727|Ga0181401_1137828All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157601Open in IMG/M
3300017729|Ga0181396_1127596All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157525Open in IMG/M
3300017730|Ga0181417_1030786All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU1571325Open in IMG/M
3300017733|Ga0181426_1019180All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU1571344Open in IMG/M
3300017743|Ga0181402_1155398All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157578Open in IMG/M
3300017746|Ga0181389_1035983All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU1571491Open in IMG/M
3300017748|Ga0181393_1182653All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157513Open in IMG/M
3300017757|Ga0181420_1026497All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU1571913Open in IMG/M
3300017757|Ga0181420_1083653All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157993Open in IMG/M
3300017757|Ga0181420_1155202All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157681Open in IMG/M
3300017759|Ga0181414_1135634All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157644Open in IMG/M
3300017762|Ga0181422_1155741All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157699Open in IMG/M
3300017770|Ga0187217_1124344All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157870Open in IMG/M
3300017779|Ga0181395_1214015All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157596Open in IMG/M
3300017782|Ga0181380_1001940Not Available8915Open in IMG/M
3300017786|Ga0181424_10001216All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes11718Open in IMG/M
3300017786|Ga0181424_10027346All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU1572473Open in IMG/M
3300017962|Ga0181581_10058991All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU1572709Open in IMG/M
3300017968|Ga0181587_10392282All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157918Open in IMG/M
3300017968|Ga0181587_10875560All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157557Open in IMG/M
3300018423|Ga0181593_10809443All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157655Open in IMG/M
3300018424|Ga0181591_10678773All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157728Open in IMG/M
3300020054|Ga0181594_10277729All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157777Open in IMG/M
3300020173|Ga0181602_10234182All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157793Open in IMG/M
3300020191|Ga0181604_10328842All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157683Open in IMG/M
3300020347|Ga0211504_1080473All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157745Open in IMG/M
3300020352|Ga0211505_1091737All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157727Open in IMG/M
3300020469|Ga0211577_10232691All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU1571196Open in IMG/M
3300021085|Ga0206677_10300203All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157642Open in IMG/M
3300021375|Ga0213869_10432048All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157533Open in IMG/M
3300021378|Ga0213861_10208503All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU1571060Open in IMG/M
3300021378|Ga0213861_10303083All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157820Open in IMG/M
3300021958|Ga0222718_10459238All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157624Open in IMG/M
3300022061|Ga0212023_1014526All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU1571038Open in IMG/M
3300022937|Ga0255770_10435115All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157559Open in IMG/M
(restricted) 3300023114|Ga0233405_10064722All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157606Open in IMG/M
3300023117|Ga0255757_10527086All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157509Open in IMG/M
3300024221|Ga0228666_1003268All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium5751Open in IMG/M
3300024291|Ga0228660_1039925All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157893Open in IMG/M
3300024297|Ga0228658_1090568All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157759Open in IMG/M
3300024328|Ga0228635_1126630All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157553Open in IMG/M
3300024343|Ga0244777_10148852All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU1571512Open in IMG/M
3300024346|Ga0244775_11228046All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157583Open in IMG/M
3300024346|Ga0244775_11449031All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157527Open in IMG/M
3300024415|Ga0228662_1150808All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157509Open in IMG/M
3300024428|Ga0233396_1124778All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157591Open in IMG/M
3300025079|Ga0207890_1059542All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157630Open in IMG/M
3300025084|Ga0208298_1100159All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157525Open in IMG/M
3300025127|Ga0209348_1072182All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU1571116Open in IMG/M
3300025137|Ga0209336_10150664All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157615Open in IMG/M
3300025138|Ga0209634_1008208All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium6495Open in IMG/M
3300025168|Ga0209337_1171392All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157915Open in IMG/M
3300025646|Ga0208161_1102841All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157784Open in IMG/M
3300025652|Ga0208134_1064830All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU1571106Open in IMG/M
3300025769|Ga0208767_1152984All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157837Open in IMG/M
3300025771|Ga0208427_1043474All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU1571678Open in IMG/M
3300025828|Ga0208547_1050254All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU1571449Open in IMG/M
3300025869|Ga0209308_10353992All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157597Open in IMG/M
3300025889|Ga0208644_1104640All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU1571385Open in IMG/M
3300025890|Ga0209631_10533559All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157514Open in IMG/M
3300026120|Ga0209948_1034570All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU1571231Open in IMG/M
3300026189|Ga0208405_1035165All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157770Open in IMG/M
3300026453|Ga0228644_1037791All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157942Open in IMG/M
3300026491|Ga0228641_1031739All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU1571369Open in IMG/M
3300026506|Ga0228604_1002397All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU1571919Open in IMG/M
3300027582|Ga0208971_1148435All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157502Open in IMG/M
3300027753|Ga0208305_10210752All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157697Open in IMG/M
3300027820|Ga0209578_10194366All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157969Open in IMG/M
3300027845|Ga0209271_10174266All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157879Open in IMG/M
(restricted) 3300027861|Ga0233415_10306612All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157750Open in IMG/M
3300028280|Ga0228646_1107994All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157679Open in IMG/M
3300028397|Ga0228639_1049883All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU1571187Open in IMG/M
3300028414|Ga0228627_1007128All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU1574327Open in IMG/M
3300028416|Ga0228614_1042491All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU1571008Open in IMG/M
3300028418|Ga0228615_1083778All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157897Open in IMG/M
3300031143|Ga0308025_1052970All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU1571558Open in IMG/M
3300031167|Ga0308023_1014196All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU1571668Open in IMG/M
3300031569|Ga0307489_10314622All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU1571017Open in IMG/M
3300031578|Ga0307376_10318283All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU1571036Open in IMG/M
3300031599|Ga0308007_10110491All Organisms → Viruses → Predicted Viral1004Open in IMG/M
3300031601|Ga0307992_1091978All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU1571238Open in IMG/M
3300031601|Ga0307992_1134539All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157971Open in IMG/M
3300031621|Ga0302114_10130402All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU1571124Open in IMG/M
3300031621|Ga0302114_10318599All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157604Open in IMG/M
3300031644|Ga0308001_10004772All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium5917Open in IMG/M
3300031683|Ga0308006_10162622All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157692Open in IMG/M
3300031687|Ga0308008_1002143All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium6227Open in IMG/M
3300031687|Ga0308008_1131693All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157580Open in IMG/M
3300031695|Ga0308016_10122986All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU1571039Open in IMG/M
3300031721|Ga0308013_10007962All Organisms → Viruses → Predicted Viral4686Open in IMG/M
3300031766|Ga0315322_10804008All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157581Open in IMG/M
3300031773|Ga0315332_10416920All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157855Open in IMG/M
3300031848|Ga0308000_10246878All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157677Open in IMG/M
3300031851|Ga0315320_10332806All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU1571073Open in IMG/M
3300033742|Ga0314858_071069All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157865Open in IMG/M
3300034374|Ga0348335_148973All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157643Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine16.79%
SeawaterEnvironmental → Aquatic → Marine → Strait → Unclassified → Seawater16.03%
SeawaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Seawater12.98%
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous9.16%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine9.16%
Salt MarshEnvironmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh7.63%
EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine3.82%
SeawaterEnvironmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater3.05%
Marine SedimentEnvironmental → Aquatic → Marine → Coastal → Sediment → Marine Sediment2.29%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine2.29%
Pelagic MarineEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine2.29%
SeawaterEnvironmental → Aquatic → Marine → Inlet → Unclassified → Seawater1.53%
EstuarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine1.53%
Macroalgal SurfaceHost-Associated → Algae → Green Algae → Ectosymbionts → Unclassified → Macroalgal Surface1.53%
Freshwater, PlanktonEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton0.76%
FreshwaterEnvironmental → Aquatic → Freshwater → Ice → Glacial Lake → Freshwater0.76%
Surface SeawaterEnvironmental → Aquatic → Marine → Oceanic → Photic Zone → Surface Seawater0.76%
Sackhole BrineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Sackhole Brine0.76%
Freshwater To Marine Saline GradientEnvironmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient0.76%
Sea-Ice BrineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Sea-Ice Brine0.76%
MarineEnvironmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine0.76%
MarineEnvironmental → Aquatic → Marine → Intertidal Zone → Sediment → Marine0.76%
Estuarine WaterEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water0.76%
Pelagic MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine0.76%
Pond WaterEnvironmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Pond Water0.76%
Pond SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Pond Soil0.76%
SoilEnvironmental → Terrestrial → Soil → Clay → Unclassified → Soil0.76%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000127Marine microbial communities from chronically polluted sediments in Adventfjord, Norway - Svalbard Archipelago station 1 sample NOR 05_45mEnvironmentalOpen in IMG/M
3300000973Macroalgal surface ecosystem from Botany Bay, Sydney, Australia - BBAY93Host-AssociatedOpen in IMG/M
3300001450Marine viral communities from the Pacific Ocean - LP-53EnvironmentalOpen in IMG/M
3300001589Marine viral communities from the Pacific Ocean - LP-40EnvironmentalOpen in IMG/M
3300005608Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201302PF84AEnvironmentalOpen in IMG/M
3300005612Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdAd00.2EnvironmentalOpen in IMG/M
3300006029Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_<0.8_DNAEnvironmentalOpen in IMG/M
3300006735Marine viral communities from the Subarctic Pacific Ocean - 5B_ETSP_OMZ_AT15132_CsCl metaGEnvironmentalOpen in IMG/M
3300006750Marine viral communities from the Subarctic Pacific Ocean - 19_ETSP_OMZ_AT15317 metaGEnvironmentalOpen in IMG/M
3300006803Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_>0.8_DNAEnvironmentalOpen in IMG/M
3300006810Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01EnvironmentalOpen in IMG/M
3300006990Marine viral communities from the Subarctic Pacific Ocean - 11B_ETSP_OMZ_AT15265_CsCl metaGEnvironmentalOpen in IMG/M
3300007539Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1M Viral MetaGEnvironmentalOpen in IMG/M
3300007692Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.743EnvironmentalOpen in IMG/M
3300007722Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - FRY-02 (megahit assembly)EnvironmentalOpen in IMG/M
3300008120Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-3-NAEnvironmentalOpen in IMG/M
3300008961Estuarine microbial communities from the Columbia River estuary - metaG 1550B-02EnvironmentalOpen in IMG/M
3300008963Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R1_B_H2O_MGEnvironmentalOpen in IMG/M
3300008999Estuarine microbial communities from the Columbia River estuary - Flood tide non-ETM metaG S.545EnvironmentalOpen in IMG/M
3300009420Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_152EnvironmentalOpen in IMG/M
3300009422Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_138EnvironmentalOpen in IMG/M
3300009436Marine eukaryotic phytoplankton communities from Arctic Ocean - Fram Strait ARC3M MetagenomeEnvironmentalOpen in IMG/M
3300009449Pelagic marine microbial communities from North Sea - COGITO_mtgs_110426EnvironmentalOpen in IMG/M
3300009467Pelagic marine microbial communities from North Sea - COGITO_mtgs_110530EnvironmentalOpen in IMG/M
3300009706Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB11_86EnvironmentalOpen in IMG/M
3300010149Marine viral communities from the Subarctic Pacific Ocean - 13B_ETSP_OMZ_AT15268_CsCl metaGEnvironmentalOpen in IMG/M
3300010318Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_15_0.8_DNAEnvironmentalOpen in IMG/M
3300012920Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St8 metaGEnvironmentalOpen in IMG/M
3300017710Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 26 SPOT_SRF_2011-09-28EnvironmentalOpen in IMG/M
3300017720Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 6 SPOT_SRF_2009-12-23EnvironmentalOpen in IMG/M
3300017721Marine viral communities from the Subarctic Pacific Ocean - Lowphox_09 viral metaGEnvironmentalOpen in IMG/M
3300017725Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 21 SPOT_SRF_2011-04-29EnvironmentalOpen in IMG/M
3300017727Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 24 SPOT_SRF_2011-07-20EnvironmentalOpen in IMG/M
3300017729Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 19 SPOT_SRF_2011-01-11EnvironmentalOpen in IMG/M
3300017730Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 40 SPOT_SRF_2013-02-13EnvironmentalOpen in IMG/M
3300017733Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 49 SPOT_SRF_2013-12-23EnvironmentalOpen in IMG/M
3300017743Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 25 SPOT_SRF_2011-08-17EnvironmentalOpen in IMG/M
3300017746Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 12 SPOT_SRF_2010-06-29EnvironmentalOpen in IMG/M
3300017748Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 16 SPOT_SRF_2010-10-21EnvironmentalOpen in IMG/M
3300017757Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 43 SPOT_SRF_2013-05-22EnvironmentalOpen in IMG/M
3300017759Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 37 SPOT_SRF_2012-11-28EnvironmentalOpen in IMG/M
3300017762Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 45 SPOT_SRF_2013-07-18EnvironmentalOpen in IMG/M
3300017770Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 15 SPOT_SRF_2010-09-15 (version 2)EnvironmentalOpen in IMG/M
3300017779Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 18 SPOT_SRF_2010-12-16EnvironmentalOpen in IMG/M
3300017782Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 3 SPOT_SRF_2009-08-19EnvironmentalOpen in IMG/M
3300017786Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 47 SPOT_SRF_2013-09-18EnvironmentalOpen in IMG/M
3300017962Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071404AT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300017968Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071409AT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018423Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071413AT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018424Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071412AT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300020054Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071413BT metaG (spades assembly)EnvironmentalOpen in IMG/M
3300020173Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041408US metaG (spades assembly)EnvironmentalOpen in IMG/M
3300020191Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041410US metaG (spades assembly)EnvironmentalOpen in IMG/M
3300020347Marine microbial communities from Tara Oceans - TARA_B100000497 (ERX556109-ERR598994)EnvironmentalOpen in IMG/M
3300020352Marine microbial communities from Tara Oceans - TARA_B100000497 (ERX556084-ERR599144)EnvironmentalOpen in IMG/M
3300020469Marine microbial communities from Tara Oceans - TARA_B100001093 (ERX555967-ERR599052)EnvironmentalOpen in IMG/M
3300021085Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 30m 12015EnvironmentalOpen in IMG/M
3300021375Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO132EnvironmentalOpen in IMG/M
3300021378Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO131EnvironmentalOpen in IMG/M
3300021958Estuarine water microbial communities from San Francisco Bay, California, United States - C33_27DEnvironmentalOpen in IMG/M
3300022061Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 (v2)EnvironmentalOpen in IMG/M
3300022937Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071404AT metaGEnvironmentalOpen in IMG/M
3300023114 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_oxic_3_MGEnvironmentalOpen in IMG/M
3300023117Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071409AT metaGEnvironmentalOpen in IMG/M
3300024221Seawater microbial communities from Monterey Bay, California, United States - 80DEnvironmentalOpen in IMG/M
3300024291Seawater microbial communities from Monterey Bay, California, United States - 74DEnvironmentalOpen in IMG/M
3300024297Seawater microbial communities from Monterey Bay, California, United States - 71DEnvironmentalOpen in IMG/M
3300024328Seawater microbial communities from Monterey Bay, California, United States - 44DEnvironmentalOpen in IMG/M
3300024343Combined assembly of estuarine microbial communities from Columbia River, Washington, USA >3um size fractionEnvironmentalOpen in IMG/M
3300024346Whole water sample coassemblyEnvironmentalOpen in IMG/M
3300024415Seawater microbial communities from Monterey Bay, California, United States - 76DEnvironmentalOpen in IMG/M
3300024428Seawater microbial communities from Monterey Bay, California, United States - 32DEnvironmentalOpen in IMG/M
3300025079Marine viral communities from the Pacific Ocean - LP-48 (SPAdes)EnvironmentalOpen in IMG/M
3300025084Marine viral communities from the Subarctic Pacific Ocean - 14B_ETSP_OMZ_AT15311_CsCl metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025127Marine viral communities from the Pacific Ocean - ETNP_2_30 (SPAdes)EnvironmentalOpen in IMG/M
3300025137Marine viral communities from the Pacific Ocean - LP-32 (SPAdes)EnvironmentalOpen in IMG/M
3300025138Marine viral communities from the Pacific Ocean - LP-40 (SPAdes)EnvironmentalOpen in IMG/M
3300025168Marine viral communities from the Pacific Ocean - LP-53 (SPAdes)EnvironmentalOpen in IMG/M
3300025646Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300025652Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 (SPAdes)EnvironmentalOpen in IMG/M
3300025769Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 (SPAdes)EnvironmentalOpen in IMG/M
3300025771Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_>0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025828Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_<0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025869Pelagic marine microbial communities from North Sea - COGITO_mtgs_120405 (SPAdes)EnvironmentalOpen in IMG/M
3300025889Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 (SPAdes)EnvironmentalOpen in IMG/M
3300025890Pelagic Microbial community sample from North Sea - COGITO 998_met_08 (SPAdes)EnvironmentalOpen in IMG/M
3300026120Salt pond soil microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R2_C_D2_MG (SPAdes)EnvironmentalOpen in IMG/M
3300026189Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201302PF84A (SPAdes)EnvironmentalOpen in IMG/M
3300026453Seawater microbial communities from Monterey Bay, California, United States - 56DEnvironmentalOpen in IMG/M
3300026491Seawater microbial communities from Monterey Bay, California, United States - 52DEnvironmentalOpen in IMG/M
3300026506Seawater microbial communities from Monterey Bay, California, United States - 4DEnvironmentalOpen in IMG/M
3300027582Ammonia-oxidizing marine microbial communities from Monterey Bay, California, USA - CAN11_18_M0_10 (SPAdes)EnvironmentalOpen in IMG/M
3300027753Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.741 (SPAdes)EnvironmentalOpen in IMG/M
3300027820Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdAd47.2 (SPAdes)EnvironmentalOpen in IMG/M
3300027845Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdAd00.2 (SPAdes)EnvironmentalOpen in IMG/M
3300027861 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_12_MGEnvironmentalOpen in IMG/M
3300028280Seawater microbial communities from Monterey Bay, California, United States - 58DEnvironmentalOpen in IMG/M
3300028397Seawater microbial communities from Monterey Bay, California, United States - 50DEnvironmentalOpen in IMG/M
3300028414Seawater microbial communities from Monterey Bay, California, United States - 33DEnvironmentalOpen in IMG/M
3300028416Seawater microbial communities from Monterey Bay, California, United States - 15DEnvironmentalOpen in IMG/M
3300028418Seawater microbial communities from Monterey Bay, California, United States - 16DEnvironmentalOpen in IMG/M
3300031143Marine microbial communities from water near the shore, Antarctic Ocean - #422EnvironmentalOpen in IMG/M
3300031167Marine microbial communities from water near the shore, Antarctic Ocean - #418EnvironmentalOpen in IMG/M
3300031569Sea-ice brine microbial communities from Beaufort Sea near Barrow, Alaska, United States - SB 1.2EnvironmentalOpen in IMG/M
3300031578Soil microbial communities from Risofladan, Vaasa, Finland - TR-2EnvironmentalOpen in IMG/M
3300031599Marine microbial communities from water near the shore, Antarctic Ocean - #71EnvironmentalOpen in IMG/M
3300031601Marine microbial communities from Ellis Fjord, Antarctic Ocean - #133EnvironmentalOpen in IMG/M
3300031621Marine microbial communities from Western Arctic Ocean, Canada - AG5_SurfaceEnvironmentalOpen in IMG/M
3300031644Marine microbial communities from water near the shore, Antarctic Ocean - #5EnvironmentalOpen in IMG/M
3300031683Marine microbial communities from water near the shore, Antarctic Ocean - #69EnvironmentalOpen in IMG/M
3300031687Marine microbial communities from water near the shore, Antarctic Ocean - #125EnvironmentalOpen in IMG/M
3300031695Marine microbial communities from water near the shore, Antarctic Ocean - #233EnvironmentalOpen in IMG/M
3300031721Marine microbial communities from water near the shore, Antarctic Ocean - #181EnvironmentalOpen in IMG/M
3300031766Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 100m 21515EnvironmentalOpen in IMG/M
3300031773Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 100m 34915EnvironmentalOpen in IMG/M
3300031848Marine microbial communities from water near the shore, Antarctic Ocean - #3EnvironmentalOpen in IMG/M
3300031851Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 40m 21515EnvironmentalOpen in IMG/M
3300033742Sea-ice brine viral communities from Beaufort Sea near Barrow, Alaska, United States - 2018 seawaterEnvironmentalOpen in IMG/M
3300034374Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_31 (v4)EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
SA_S1_NOR05_45mDRAFT_1006461913300000127MarineMNIKSLTLKNRLTDDKTGQQYFDLTAASFKYKRELGVKALHYVTQDQVGRIDKISRIYFGSEQFLDAICVINNIFNPFSVQEGD
BBAY93_1006537313300000973Macroalgal SurfaceMNIKSLTLKNRLNDEKTGEQYFDLTAPSFKYQAEQGIKALHYVTQDQAGRIDKISETYFGTGEYIDAICIVNNIFNPFSVEEGDILVI
BBAY93_1014295923300000973Macroalgal SurfaceMDIRSLTLKNKLTIEDTGEQYFDLTAPSFTYITDQGIKALHYVMQDQVGRVDK
JGI24006J15134_1015977413300001450MarineMNIRSLELKNKLNIEETGEQYFDLSAPSFKYRRELGVKALHYVTVDQAGRVDKISEMYF
JGI24005J15628_1022440913300001589MarineMNIKSLTLKNKLSDEKTGQQYFDLTAPSFKYKRELGVKALHYVQQDQIGR
Ga0066840_1004107423300005608MarineMNIKSLGLKNKLVDENTGESYFDLTAPSFKYGTEFGIKALHFVKQDQVGRVDKISQIYFGSGEFVDAICVIN
Ga0070723_1035191223300005612Marine SedimentMNIKSLTLKNKLTIERTGQQYFDLTAPSFRYKTELGVKALHYIKQDQVGRMDKVSLQYFGKSDYVDALCIV
Ga0075466_118727913300006029AqueousMNIKSLTLKNKLTDDKNGEQYYDLTAPSFKYKRELGVKALHYVTQDQVGRIDKISTTYFGSTQFVDAICVINNIFNPFVIQEGDILAIPQ
Ga0098038_124443613300006735MarineMNIKSLTLKNKLNDEKTGEQYYDLTAPSFKYKAELGVKALHYVTADQAGRIDKVSETYFGTGEYIDAICII
Ga0098058_112343013300006750MarineMNIKSLTLKNKISDDKTGEQYYDLTAPSFKYKRELGVKALHYVTADEAGRVDKISQKYFGSGKYIDAICVVNNIFN
Ga0075467_1013647723300006803AqueousMNIKSLTLKNKLTDDKNGEQYYDLTAPSFKYKRELGVKALHYVTQDQVGRIDKI
Ga0070754_1019862323300006810AqueousMNIKSLNLKNKLIDDNTGQYYYDLTAPSFIYDSDLGVKALHYVLPDQVGRIDKISEIYFGSR
Ga0098046_100339183300006990MarineMNVKSLTLKNKLTLDKTGEGYWDLTAPSFIYDATLGVRALHYVTMDQVGRIDKISEVYFGSGEF
Ga0098046_105868313300006990MarineMNIKSLTLKNKLIIDETGEGYWDLTAPSFIYDSELGVKALHYVMLDQIGRLDKISQIYFGSGEFVDAICVVNNIFNPFSVNEG
Ga0099849_136391313300007539AqueousMNIKSLRLKNKLIDENTGQYYYDLTAPSFVYNGDLGVKALHYVLPDQVGRIDKISELYFGSGEFIDAI
Ga0102823_110343413300007692EstuarineMNVKSLTLKNKLTLDKTGEGYWDLTAPSFIYDADLGVRALHYVTQDQIGRIDKISEVY
Ga0105051_1129805513300007722FreshwaterMNIKSLTLKNKLSIEETGEQYYDLSAPSFTYKRELGVKALHYVTVDQAGRIDKISEMYFGTGAYIDAICIVNNIF
Ga0114355_121506523300008120Freshwater, PlanktonMNIRSLALKNKLVDERTGEFYFDLTAPSFIYDPGLGVKALHYVMPDQAGRIDKISEIYFGNGEYIDAIGIVNNIF
Ga0102887_102915113300008961EstuarineMNVKSLTLKNKLTLDRTGEGYWDLTAPSFIYDADLGVRALHYVTQDQIGRIDKISEVYFGSGEFIDAICVVNN
Ga0102930_102921513300008963Pond WaterMNIKSLTLKNTLIDEKTGESYFDLTAPSFKYVSEYGIKSIHYVAFDQAGRVDLVSDQYFGTTEYVDAICIINNIFNPF
Ga0102816_120802913300008999EstuarineMDVKSLTLKNKLIIDKTGEGYWDLNAPSFIYDSDLGVKALHYVMQDQVGRIDKISFKYFGSGEFIDAICVVNN
Ga0114994_1079327623300009420MarineMNIKSLTLKNRLTDETTGQQYYDLTAPSFRYKRELGVKALHYVTIDQAGRIDKISEKYFGTGSYVDAICVVNNIFNPF
Ga0114998_1041407913300009422MarineMNIKSLTLKNTLSIEETGELYYDLTAPSFTYRRELGIKGIHYVTVDQAGRIDKIAEQYFGSSQFADAICIVNNIFNPFSVN
Ga0115008_1131175013300009436MarineMNIKSLTLKNKLTDDKTGEQYYDLTAASFKYKRELGVKALHYVTQDQVGRIDKISTTYFGSTQFV
Ga0115558_122229723300009449Pelagic MarineMDIKSLALKNRLIIDETGEGYWDLTAPSFIYDYELGVRALHYVLPDQIGRIDKISEIYYGSGEFVD
Ga0115565_1034282713300009467Pelagic MarineMDIKSLALKNRLIIDETGEGYWDLTAPSFIYDYELGVRALHYVLPDQIGRIDKISEIYYG
Ga0115002_1056229033300009706MarineMNIKSLTLKNKLDDAETGEQYYDLTAPSFKYKVELGIKALHYVMQDEAGRIDK
Ga0098049_121657223300010149MarineMNIKSLTLKNRLIIDKTGEGYYDLTAPSFIYDSDLGVKALHYVMQDQVGRIDKISQKYFGSGEFVDAICVVNNIFNPFSV
Ga0136656_107990623300010318Freshwater To Marine Saline GradientMDIKSLTLKNTIVDENTGESYYDLSAPSFAYKSEYGIKGLHYVSVDQAGRMDLVSEQYFGTGEYVDALCIVNNIFNPFSLNEGYILVIPD
Ga0160423_1106530413300012920Surface SeawaterMNIKSLTLKNRLNDERTGEQYFDLTAPSFNYIAEQGVKALHYVTVDQAGRIDKISETYFGTGEFIDAIC
Ga0181403_101728323300017710SeawaterMDIKSLTLKNLLSIERTGEQYYDLTAPSFKYDKAAGLKALHYVMQDEAGRIDKICERYFGTGEYVDALCIVN
Ga0181383_113868923300017720SeawaterMNIKSLTLKNKLSDEKTGEQYFDLTAPSFKYKRELGVKGLHYVQQDQVGRVDKISQLYYGTGSYVDAICVV
Ga0181383_118784623300017720SeawaterMNIKSLTLKNKLSDEKTGQQYFDLTAPSFKYKRELGVKALHYVQQDQVGRVDK
Ga0181373_106740223300017721MarineMNIKSLTLKNKLTDDKTGQQYFDLSAPSFKYKRELGVKALHYVQQDQVGRVD
Ga0181398_102121213300017725SeawaterMDVKSLTLKNKLIIDKTGEGYWDLNAPSFIYDSDLGVKALHYVMQDQVGRIDKISFKYFGSGEFIDAICVVNNIFNPFSVSEGDIL
Ga0181401_113782813300017727SeawaterMNIKSLTLKNKLIIDKTGEGYWDLTAPSFVYDSDLGVKALHYVMQDQVGRIDKISQKYFGSGEFIDAICV
Ga0181396_112759613300017729SeawaterMNVKSLTLKNKLTLDKTGEGYWDLTAPSFIYDSDLGVRALHYVTMDQIGRIDKISEIYFGSGEFIDAICVVNNIFN
Ga0181417_103078623300017730SeawaterMNIKSLTLKNKLTDDRTGQQYFDLTAPSFKYKRELGVKALHYVQQDQIGRVDKISRIYFGSEQYVDAICIINNIF
Ga0181426_101918023300017733SeawaterMDIRSLTLKNKLTIEDTGEQYFDLTAPSFTYITDQGIKALHYVMQDQVGRVDKISEIYFGTGEYIDAICI
Ga0181402_115539823300017743SeawaterMDVKSLTLKNKLIIDKTGEGYWDLNAPSFIYDSDLGVKALHYVMQDQVGRIDKISF
Ga0181389_103598313300017746SeawaterMDIKSLTLKNKVTIEETGEQYYDLTAPSFTYLTNQGVKALHYVMQDQAGRIDKISEIYFG
Ga0181393_118265323300017748SeawaterMNIKSLTLKNKISDDKTGEQYYDLTAPSFKYKRELGVKALHYVTADEAGRVDKIS
Ga0181420_102649723300017757SeawaterMNIKSLTLKNKLNDEKTGEQYYDLTAPSFKYIAEQGVKALHYVTTDQAGRIDKISETYFGTGEYID
Ga0181420_108365323300017757SeawaterMDVKSLTLKNKLIIDKTGEGYWDLNAPSFIYDSDLGVKALHYVMQDQVGRIDKISFKYF
Ga0181420_115520223300017757SeawaterMNIKSLTLKNKISDDKTGQQYFDLTAPSFKYKRELGVKALHYVTQDQVGRVDKISRLYFG
Ga0181414_113563413300017759SeawaterMDIKSLTLKNLLSIERTGEQYYDLTAPSFKYDKAAGLKALHYVMQDEAGRIDKICERY
Ga0181422_115574123300017762SeawaterMNIKSLTLKNKLTIERTGEQYFDLTAPSFRYKPELGIKALHYIKQDQVGRMDKVSLQYFGKSDYVDALCIVNNIF
Ga0187217_112434413300017770SeawaterMNIKSLTLKNKLSDEKTGQQYFDLTAPSFKYKRELVVKALHYVQQDQVGRVDKISQIYFGTD
Ga0181395_121401513300017779SeawaterMNIKSLTLKNKLTIERTGEQYFDLTAPSFRYKPELGIKALHYIKQDQVGRMDKVSLQYFGKSDY
Ga0181380_1001940123300017782SeawaterMDIRSLTLKNKLTIEDTGEQYFDLTAPSFTYITDQGIKALHYVMQDQVGRVDKISEIY
Ga0181424_1000121613300017786SeawaterMDIKSLTLKNLLSIERTGEQYYDLTAPSFKYDKAAGLKALHYVMQDEAGRIDKI
Ga0181424_1002734613300017786SeawaterMDIKSLTLKNKLIIDKTGEGYWDLTAPSFIYDSDLGVRALHYVMQDQIGRIDKISNIYFS
Ga0181581_1005899113300017962Salt MarshMNIKSLNLKNKLIDDNTGQYYYDLTAPSFIYDSDLGVKALHYVLPDQVGRIDKISEIYFGSGEFIDAICVVNNIFNPFS
Ga0181587_1039228213300017968Salt MarshMDIKSLGLKNVLIDDRTGENYFDLTAPSFKYKVEAGVKAIHYVTQDQDGRIDKICELYFGTTQYVDAICVTNNIFNPFSVKE
Ga0181587_1087556013300017968Salt MarshMNIKSLTLKNKLTEERTGEFYYDLTAPSFIYDSDLGVKALHYVKIDQIGRIDKISEIYFGSGEFIDAICVVNNIFNPFSVNEGDVLVI
Ga0181593_1080944313300018423Salt MarshMNIKSLTLKNKLTEERTGEFYYDLTAPSFIYDSDLGVKALHYVKIDQIGRIDKISEIY
Ga0181591_1067877323300018424Salt MarshMDIKSLGLKNVLIDDRTGENYFDLTAPSFKYKVEAGVKAIHYVTQDQD
Ga0181594_1027772913300020054Salt MarshMNIKSLNLKNKLIDDNTGQYYYDLTAPSFIYDSDLGVKALHYVLPDQVGRIDKISEIYFG
Ga0181602_1023418213300020173Salt MarshMNIKSLTLKNLLSIERTGEQYYDLTAPSFKYDKAAGLKALHYVMQDEAGRIDKICERYFGTSEYVDALCIV
Ga0181604_1032884213300020191Salt MarshMNIKSLTLKNKLTEERTGEFYYDLTAPSFIYDSDLGVKALHYVKIDQIGRIDKISEIYFGSGEFIDAICVVN
Ga0211504_108047313300020347MarineMDIKSLTLKNLLSIERTGEQYYDLTAPSFKYDKAAGLKALHYVMQDEAGRIDKICEKYFGTGEYVDALCIVNNIFNPFSVQEGDVLV
Ga0211505_109173723300020352MarineMNIKSLTLKNRLVDERTGENYWNITVPSFTYRAELGIKAIHYVTVDQAMRPDLISIIYFGTGENLDAICYTN
Ga0211577_1023269123300020469MarineMNIKSLTLKNKLSDEKTGQQYFDLTAPSFKYKRELGVKALHYVQQDQVGRVDKISQIYFGTDAYLDAICIVNNIFN
Ga0206677_1030020313300021085SeawaterMDIKSLTLKNKLIIDKTGEGYWDLTAPSFIYDSDLGVRALHYVMQDQIGRIDKISNIYFGSGEFIDAICVVNNIFNPFSVNEGDILII
Ga0213869_1043204813300021375SeawaterMDIKSLTLKNKLIIDKTGEGYWDLTAPSFIYDSELGVKSLHYVMQDQVGRIDKISYKYFG
Ga0213861_1020850313300021378SeawaterMNIKSLTLKNKLTDDKTGQQYFDLSAPSFKYKRELGVKALHYVQQDQVGRV
Ga0213861_1030308323300021378SeawaterMNIKSLTLKNKLIVDETGEGYWDLTAPSFIYESDLGVKALHYVMQDEVGRMDKIANTYFGSGEFVD
Ga0222718_1045923823300021958Estuarine WaterMDIKSLSLKNKLINENTGENYYDLTAPSFLYKSELGIKSVHYVSQDQEGRMDKISELYFGTTEHIDALCVVNNIFNPFSLKE
Ga0212023_101452613300022061AqueousMNIRSLTLKNKLTDDKTGEQYYDLTAASFKYKRELGVKALHYVTQDQVGRIDKISTTYFGSTQFVDAICVINNIFNPFVIQE
Ga0255770_1043511523300022937Salt MarshMNIKSLNLKNKLIDDNTGQYYYDLTAPSFIYDSDLGVKALHYVLPDQVGRIDKISEIYFGSGEFIDAICVVNNIFNPFSLSEGDI
(restricted) Ga0233405_1006472213300023114SeawaterMNIKSLTLKNKISDDKTGEQYYDLTAPSFKYKRELGVKALHYVTADEAGRVDK
Ga0255757_1052708623300023117Salt MarshMNIKSLTLKNKLTEERTGEFYYDLTAPSFIYDSDLGVKALHYVKIDQIGRIDKISEIYFGSGEFI
Ga0228666_100326813300024221SeawaterMDIKSLTLKNKLIIDKTGEGYWDLTAPSFIYDSDLGVRALHYVMQDQIGRIDKISNIYF
Ga0228660_103992523300024291SeawaterMEIKSLTLKNRLIIDETGEGYWDLTAPSFVYDSDLGVRALHYVQLDQIGRIDKISNLYFGSGEFIDAICVVNNIFNPFTISEG
Ga0228658_109056813300024297SeawaterMNIKSLTLKNKISDDKTGEQYYDLTAPSFKYKRELGVKALHYVTADEAGRVDKISQ
Ga0228635_112663013300024328SeawaterMDVKSLTLKNKLIIDETGEGYWDLTAPSFIYDSDLGVKALHYVMQDEVGR
Ga0244777_1014885223300024343EstuarineMNVKSLTLKNKLTLDKTGEGYWDLTAPSFIYDAELGVRALHYVTQDQIGRIDKISEVYFGSGEFIDAICVVNNIFN
Ga0244775_1122804613300024346EstuarineMDVKSLTLKNKLIIDKTGEGYWDLTAPSFIYDSDLGVKSLHYVMQDQVGRIDKISYKYFGSGEFVDAICVVN
Ga0244775_1144903123300024346EstuarineMDIKSLTLKNKVTIEETGEQYYDLTAPSFTYLTNQGVKALHYVMQDQAGRIDKISEIYFGTGEYIDAICIVNNLFNPFSVNEGD
Ga0228662_115080823300024415SeawaterMDVKSLTLKNKLIIDETGEGYWDLTAPSFIYDSDLGVKALHYVMQDEVGRIDKISN
Ga0233396_112477823300024428SeawaterMDVKSLTLKNKLIIDKTGEGYWDLNAPSFIYDSDLGVKALHYVMQDQV
Ga0207890_105954223300025079MarineMNIKSLTLKNKLTIERTGEQYFDLTAPSFRYKPELGIKALHYIKQDQVGRMDKVSLQYFGKSDYVDALCIVNNIFNPFS
Ga0208298_110015913300025084MarineMNIKSLTLKNKLTDDKTGQQYFDLSAPSFKYKRELGVKALHYVQQDQVGRVDKISEIYFGTGAYIDAICIV
Ga0209348_107218223300025127MarineMNIKSLGLKNKLVDENTGESYFDLTAPSFKYGTEFGIKALHFVKQDQVGRVDKISQIYFG
Ga0209336_1015066413300025137MarineMNIKSLTLKNKLSDDKTGEQYFDLTAPSFKYKRELGVKALHYVTANEAGRIDKISQKYFGSGKYIDAICVVNNIFNPFSLQE
Ga0209634_1008208103300025138MarineMDIKVLALKNRLTIEKTGEQYLDLTAPSFTFIPEQGIKALHYVLANEA
Ga0209337_117139223300025168MarineMNIRSLELKNKLSIEKTGEQYYDLSAPSFSYRRELGVKAIHYVTVDQAGRIDKVSEQYFGTGSYVDAICIINNIFN
Ga0208161_110284123300025646AqueousMNIKSLSLKNKLIDENNGENYFDLTAPSFVYDANAGIKALHYVTIDQVGRIDKISELYFGTGEYVDA
Ga0208134_106483023300025652AqueousMNVKSLTLKNKLIIDKTGEGYWDLTAPSFIYDSELGVRALHYVMQDQIGRIDKISNIYFGSGEFIDAICVV
Ga0208767_115298423300025769AqueousMNIKSLTLKNKLTDDKTGQQYFDLTAPSFKYKRELGVKALHYVTQDQAGRIDKISEVYFGTGAYVDA
Ga0208427_104347423300025771AqueousMNIKSLALKNKLIEERTGEFYYDLTAPSFTYDADLGVKALHYVQIDQVGRIDKISELYFGSGEFIDAICVVNNI
Ga0208547_105025423300025828AqueousMNIKSLALKNKLIEERTGEFYYDLTAPSFTYDADLGVKALHYVQIDQVGRIDKISELYFGSGEFIDAICVVNN
Ga0209308_1035399223300025869Pelagic MarineMNIKSLTLKNKLIIDKTGEGYWDLTAPSFIYDSDLGVKSLHYVMPDQVGRMDKISQIY
Ga0208644_110464013300025889AqueousMNIKSLALKNKLIEERTGEFYYDLTAPSFTYDADLGVKALHYVQIDQVGRIDKISELYFGSGEF
Ga0209631_1053355923300025890Pelagic MarineMNVKSLTLKNKLTLDKTGEGYWDLTAPSFIYDADLGVRALHYVTQDQVGRIDKISEVYFGSGEFIDAICVVNNIFNPFSVNEGD
Ga0209948_103457023300026120Pond SoilMNIKSLTLKNTLIDEKTGESYFDLTAPSFKYVSEYGIKSIHYVSFDQAGRIDLVSDQYFGTTEYVDAICIINNIFNPFSVQEGDLLIIPNLKN
Ga0208405_103516513300026189MarineMNIKSLGLKNKLVDENTGESYFDLTAPSFKYGTEFGIKALHFVKQDQVGRVDKISQIYFGSGEFVDAICVINNI
Ga0228644_103779113300026453SeawaterMDIKSLTLKNKLIIDKTGEGYWDLTAPSFIYDSDLGVRALHYVMQDQIGRIDKISNIYFG
Ga0228641_103173923300026491SeawaterMDVKSLTLKNKLIIDKTGEGYWDLNAPSFIYDSDLGVKALHYVMQDQVGRIDKI
Ga0228604_100239723300026506SeawaterMDVKSLTLKNKLIIDETGEGYWDLTAPSFIYDSDLGVKALHYVMQDEVGRIDKISNTYFG
Ga0208971_114843513300027582MarineMNVKSLTLKNKLTLDKTGEGYWDLTAPSFIYDSDLGVRALHYVTMDQIGRIDKISEIYFGSGEFIDA
Ga0208305_1021075223300027753EstuarineMNVKSLTLKNKLTLDKTGEGYWDLTAPSFIYDADLGVRALHYVTQDQIGRIDKISEVYFGSGEFIDAICVVNN
Ga0209578_1019436613300027820Marine SedimentMNIKSLTLKNTLSIEKTGELYYDLTAPSFTYKRELGLRGIHYVTQDQAGRIDKIAMQYFGSSQFVDAICIVNNIFNP
Ga0209271_1017426623300027845Marine SedimentMDIKSLTLKNKLIIDKTGEGYWDLTAPSFIYDSELGVKSLHYVMQDQVGRIDKISYKYFGSSEFVDAICVVN
(restricted) Ga0233415_1030661223300027861SeawaterMNVKSLTLKNKLTLDRTGEGYWDLTAPSFIYDADLGVRALHYVTQDQIGRIDKISEVYFGSGEFIDAICVVNNIFNPFSVNEGDVLII
Ga0228646_110799413300028280SeawaterMEIKSLTLKNRLIIDETGEGYWDLTAPSFVYDSDLGVRALHYVQPDQIGRIDKISNLYFGSGEFIDAICVVNNIFNPFTVSEGDILV
Ga0228639_104988323300028397SeawaterMDVKSLTLKNKLIIDETGEGYWDLTAPSFIYDSDLGVKALHYVMQDEVGRIDKISNTYFGSAEFIDAICVVNNIFNPFSVNEGDVLVI
Ga0228627_100712813300028414SeawaterMEIKSLTLKNRLIIDETGEGYWDLTAPSFVYDSDLGVRALHYVQPDQIGRIDKISN
Ga0228614_104249123300028416SeawaterMDIKSLSLKNSLVDETTGENYFDLTAPSFNYKAELGVRAIHYVTQDQVGRIDKISELYYGTGEYIDALCVTNNIFNPFSLNEG
Ga0228615_108377823300028418SeawaterMNIKSLTLKNKISDDKTGEQYYDLTAPSFKYKRELGVKALHYVTADEAGRVDKISQKYFGSGKYIDAICVVNNIFNPFS
Ga0308025_105297013300031143MarineMNIESLTLKNRLTIEKTGEQYFDLSAPSFQYKRELGAKAIHYVTVDQAGRIDKISEQYFGTSAYVDAICIINNIFNPF
Ga0308023_101419623300031167MarineMNIESLTLKNRLTIEKTGEQYFDLSAPSFQYKRELGAKAIHYVTVDQAGRIDKISEQYFGTSAYV
Ga0307489_1031462223300031569Sackhole BrineMNIKSLTLKNTLSIEETGELYYDLTAPSFSYKRELGVKGIHYVTVDQAGRIDKIAELYFGGSQYVDAICIVNNIFN
Ga0307376_1031828323300031578SoilMNVKSLTLKNKLIIDKTGEGYWDLTAPSFIYDSDLGVKALHYVTVDQVGRIDKISEVYYGSGEFVDALC
Ga0308007_1011049123300031599MarineMNIRSLELKNKLSIEDTGEQYFDLSAPSFKYRRELGVKALHYVTVDQVGRIDKISEMYFGTGSYVDAICIVNSIFNPFTVSEGDVLAI
Ga0307992_109197823300031601MarineMNIKSLTLKNKLNIEETGEQYYDLSAPSFTYKRELGIKALHYVTVDQIGRVDK
Ga0307992_113453923300031601MarineMNIRSLELKNKLSVEKTGEQYYDLSAPSFTYDRNLGVKAIHYVTVDQVGRIDKVSEQYFGTGAYVDAICIINSIF
Ga0302114_1013040223300031621MarineMNIKSLTLKNRLTDDKTGQQYFDLTAASFKYKRELGVKALHYVTQDQVGRIDKISRIYFGSEQF
Ga0302114_1031859913300031621MarineMNIKSLTLKNKLSIEKTGEQYFDLTAPSFKYRRELGVKALHYVTQDQVGRIDKISEKYFGTGQYIDAICVINNIFNPFSVN
Ga0308001_1000477293300031644MarineMNIESLTLKNRLTIEKTGEQYFDLSAPSFQYKRELGAKAIHYVTVDQAGRIDKISEQYFGTSAYVDAICIINNIFNPFTVEEGDVLAIPQLD
Ga0308006_1016262213300031683MarineMNIESLTLKNRLTIEKTGEQYFDLSAPSFQYKRELGAKAIHYVTVDQAGRIDKISEQYFGTSAYVDAICIINNIFNPFTV
Ga0308008_100214393300031687MarineMNIESLTLKNRLTIEKTGEQYFDLSAPSFQYKRELGAKAIHYVTVDQAGR
Ga0308008_113169313300031687MarineMNIRSLELKNKLSIEDTGEQYFDLSAPSFKYRRELGVKALHYVTVDQVGRIDKISEMYFGTGSYVDAICIVNSIFNTFTVS
Ga0308016_1012298623300031695MarineMNIRSLELKNKLSIEDTGEQYFDLSAPSFKYRRELGVKALHYVTVDQVGRIDKISEMYFGTGSYVDAICIVNSIF
Ga0308013_1000796213300031721MarineMNIKSLTLKNRLSIEDTGEQYYDLSAPSFTYKRELGVKALHYVTVDQVGRIDKISEMYFGTGAYI
Ga0315322_1080400823300031766SeawaterMNVKSLTLKNKLTLDKTGEGYWDLTAPSFIYDSDLGVRALHYVTMDQIGRIDKISEIYFGSGEFIDAIC
Ga0315332_1041692013300031773SeawaterMDIRSLTLKNKLTIEDTGEQYFDLTAPSFTYITDQGIKALHYVMQDQVGRVDKISEIYFGTGEYIDAICIVNNIFNPFSLNEGDILV
Ga0308000_1024687823300031848MarineMNIRSLELKNKLSIEETGEQYYDLSAPSFSYKRELGVKALHYVTVDQAGRVDKISEQYFGTGAYIDAICIVNNIFNPFSVSE
Ga0315320_1033280613300031851SeawaterMNVKSLTLKNKLTLDKTGEGYWDLTAPSFIYDADLGVRALHYVTQDQIGRIDKISEVYFGSGEFIDAICVVNNIFNPFSVNEGDVL
Ga0314858_071069_649_8643300033742Sea-Ice BrineMNIKSLTLKNRLIIDETGEGYWDLTAPSFIYDSELGVKALHYVMVDEIGRIDKISYKYFGSGEFVDALCVVN
Ga0348335_148973_412_6423300034374AqueousMNIKSLNLKNKLIDDNTGQYYYDLTAPSFIYDSDLGVKALHYVMPDQVGRIDKISEIYFGSGEFIDAICVVNNIFNP

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.