Basic Information | |
---|---|
Family ID | F062234 |
Family Type | Metagenome |
Number of Sequences | 131 |
Average Sequence Length | 40 residues |
Representative Sequence | MRQWIVRHERDGDNVVALWENEDGDRWYVQVVINGEVQW |
Number of Associated Samples | 86 |
Number of Associated Scaffolds | 131 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | No |
Most common taxonomic group | Unclassified |
% of genes with valid RBS motifs | 84.73 % |
% of genes near scaffold ends (potentially truncated) | 10.69 % |
% of genes from short scaffolds (< 2000 bps) | 75.57 % |
Associated GOLD sequencing projects | 73 |
AlphaFold2 3D model prediction | No |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Unclassified (52.672 % of family members) |
NCBI Taxonomy ID | N/A |
Taxonomy | N/A |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater (68.702 % of family members) |
Environment Ontology (ENVO) | Unclassified (91.603 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (92.366 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 61.54% Coil/Unstructured: 38.46% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 131 Family Scaffolds |
---|---|---|
PF04448 | DUF551 | 19.08 |
PF13730 | HTH_36 | 2.29 |
PF02592 | Vut_1 | 1.53 |
PF06067 | DUF932 | 1.53 |
PF04488 | Gly_transf_sug | 0.76 |
PF00929 | RNase_T | 0.76 |
PF07460 | NUMOD3 | 0.76 |
PF13662 | Toprim_4 | 0.76 |
PF13884 | Peptidase_S74 | 0.76 |
PF03237 | Terminase_6N | 0.76 |
PF09250 | Prim-Pol | 0.76 |
PF06120 | Phage_HK97_TLTM | 0.76 |
PF13148 | DUF3987 | 0.76 |
PF01464 | SLT | 0.76 |
COG ID | Name | Functional Category | % Frequency in 131 Family Scaffolds |
---|---|---|---|
COG1738 | Queuosine precursor transporter YhhQ, DUF165 family | Translation, ribosomal structure and biogenesis [J] | 1.53 |
COG3774 | Mannosyltransferase OCH1 or related enzyme | Cell wall/membrane/envelope biogenesis [M] | 0.76 |
COG5281 | Phage-related minor tail protein | Mobilome: prophages, transposons [X] | 0.76 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
Unclassified | root | N/A | 52.67 % |
All Organisms | root | All Organisms | 47.33 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300000203|TB18AUG2009E_c001021 | Not Available | 4974 | Open in IMG/M |
3300000553|TBL_comb47_HYPODRAFT_10083245 | Not Available | 1681 | Open in IMG/M |
3300000553|TBL_comb47_HYPODRAFT_10118566 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1238 | Open in IMG/M |
3300002092|JGI24218J26658_1010598 | Not Available | 1525 | Open in IMG/M |
3300003375|JGI26470J50227_1009360 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2497 | Open in IMG/M |
3300003375|JGI26470J50227_1055305 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 677 | Open in IMG/M |
3300003375|JGI26470J50227_1068662 | Not Available | 571 | Open in IMG/M |
3300003375|JGI26470J50227_1078971 | Not Available | 511 | Open in IMG/M |
3300003787|Ga0007811_1002163 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae | 2629 | Open in IMG/M |
3300003787|Ga0007811_1003743 | Not Available | 1838 | Open in IMG/M |
3300003789|Ga0007835_1000282 | Not Available | 7216 | Open in IMG/M |
3300003789|Ga0007835_1005132 | Not Available | 1331 | Open in IMG/M |
3300003789|Ga0007835_1012197 | Not Available | 749 | Open in IMG/M |
3300003789|Ga0007835_1021725 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Hydrogenophaga → Hydrogenophaga intermedia | 522 | Open in IMG/M |
3300003789|Ga0007835_1022386 | Not Available | 512 | Open in IMG/M |
3300003796|Ga0007865_1016793 | Not Available | 694 | Open in IMG/M |
3300003798|Ga0007842_1003522 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1204 | Open in IMG/M |
3300003798|Ga0007842_1010381 | Not Available | 615 | Open in IMG/M |
3300003812|Ga0007861_1005216 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Hydrogenophaga → Hydrogenophaga intermedia | 1293 | Open in IMG/M |
3300003820|Ga0007863_1005399 | Not Available | 1389 | Open in IMG/M |
3300003823|Ga0007875_1000578 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 5354 | Open in IMG/M |
3300003823|Ga0007875_1011195 | All Organisms → cellular organisms → Bacteria → Spirochaetes → Spirochaetia → Leptospirales → Leptospiraceae → unclassified Leptospiraceae → Leptospiraceae bacterium | 1084 | Open in IMG/M |
3300003826|Ga0007872_1011164 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 859 | Open in IMG/M |
3300003852|Ga0031655_10124725 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1018 | Open in IMG/M |
3300003852|Ga0031655_10324624 | Not Available | 574 | Open in IMG/M |
3300003852|Ga0031655_10329252 | Not Available | 569 | Open in IMG/M |
3300004685|Ga0065177_1008407 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1904 | Open in IMG/M |
3300004685|Ga0065177_1059221 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 717 | Open in IMG/M |
3300004692|Ga0065171_1054291 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 639 | Open in IMG/M |
3300004694|Ga0065170_1042809 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 607 | Open in IMG/M |
3300004770|Ga0007804_1044032 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1182 | Open in IMG/M |
3300004771|Ga0007797_1135170 | Not Available | 632 | Open in IMG/M |
3300004772|Ga0007791_10027591 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1973 | Open in IMG/M |
3300004773|Ga0007795_10058441 | All Organisms → cellular organisms → Bacteria | 1177 | Open in IMG/M |
3300004777|Ga0007827_10037078 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Sinorhizobium/Ensifer group → Sinorhizobium → Sinorhizobium meliloti | 1157 | Open in IMG/M |
3300004806|Ga0007854_10368934 | Not Available | 587 | Open in IMG/M |
3300004807|Ga0007809_10004857 | Not Available | 5202 | Open in IMG/M |
3300004807|Ga0007809_10036260 | All Organisms → Viruses → Predicted Viral | 1656 | Open in IMG/M |
3300004807|Ga0007809_10048207 | Not Available | 1393 | Open in IMG/M |
3300004807|Ga0007809_10135397 | Not Available | 733 | Open in IMG/M |
3300004807|Ga0007809_10144299 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 705 | Open in IMG/M |
3300004807|Ga0007809_10145257 | Not Available | 702 | Open in IMG/M |
3300004807|Ga0007809_10215773 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Alcaligenaceae → Achromobacter | 551 | Open in IMG/M |
3300004807|Ga0007809_10236614 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 520 | Open in IMG/M |
3300006071|Ga0007876_1071152 | Not Available | 920 | Open in IMG/M |
3300006071|Ga0007876_1096895 | Not Available | 764 | Open in IMG/M |
3300006103|Ga0007813_1041324 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 981 | Open in IMG/M |
3300006104|Ga0007882_10147518 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Hydrogenophaga → Hydrogenophaga intermedia | 833 | Open in IMG/M |
3300006104|Ga0007882_10181285 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Hydrogenophaga → Hydrogenophaga intermedia | 726 | Open in IMG/M |
3300006105|Ga0007819_1008823 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2633 | Open in IMG/M |
3300006105|Ga0007819_1095514 | Not Available | 593 | Open in IMG/M |
3300006106|Ga0007833_1042543 | Not Available | 840 | Open in IMG/M |
3300006106|Ga0007833_1066431 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 650 | Open in IMG/M |
3300006107|Ga0007836_1000087 | Not Available | 22202 | Open in IMG/M |
3300006108|Ga0007862_1048522 | Not Available | 871 | Open in IMG/M |
3300006108|Ga0007862_1071289 | All Organisms → Viruses | 679 | Open in IMG/M |
3300006112|Ga0007857_1063559 | Not Available | 693 | Open in IMG/M |
3300006112|Ga0007857_1079636 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 603 | Open in IMG/M |
3300006115|Ga0007816_1097688 | Not Available | 645 | Open in IMG/M |
3300006119|Ga0007866_1050312 | Not Available | 792 | Open in IMG/M |
3300006119|Ga0007866_1100208 | Not Available | 532 | Open in IMG/M |
3300006126|Ga0007855_1094503 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 623 | Open in IMG/M |
3300012006|Ga0119955_1065672 | Not Available | 1088 | Open in IMG/M |
3300013093|Ga0164296_1001478 | Not Available | 24898 | Open in IMG/M |
3300013093|Ga0164296_1001615 | Not Available | 23481 | Open in IMG/M |
3300013093|Ga0164296_1091843 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1293 | Open in IMG/M |
3300013093|Ga0164296_1302026 | Not Available | 599 | Open in IMG/M |
3300020704|Ga0214250_1032505 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Hydrogenophaga → Hydrogenophaga intermedia | 625 | Open in IMG/M |
3300020705|Ga0214177_1001569 | Not Available | 4246 | Open in IMG/M |
3300020705|Ga0214177_1001660 | All Organisms → Viruses → Predicted Viral | 4083 | Open in IMG/M |
3300020707|Ga0214238_1007276 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Hydrogenophaga → Hydrogenophaga intermedia | 1463 | Open in IMG/M |
3300020710|Ga0214198_1045028 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Hydrogenophaga → Hydrogenophaga intermedia | 522 | Open in IMG/M |
3300020711|Ga0214237_1006997 | Not Available | 1672 | Open in IMG/M |
3300020716|Ga0214207_1003086 | Not Available | 3054 | Open in IMG/M |
3300020716|Ga0214207_1012301 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1109 | Open in IMG/M |
3300020722|Ga0214245_1021033 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Roseobacteraceae → Phaeobacter → Phaeobacter gallaeciensis → Phaeobacter gallaeciensis DSM 26640 | 933 | Open in IMG/M |
3300020724|Ga0214244_1010084 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Hydrogenophaga → Hydrogenophaga intermedia | 1431 | Open in IMG/M |
3300020727|Ga0214246_1018874 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Hydrogenophaga → Hydrogenophaga intermedia | 1176 | Open in IMG/M |
3300021127|Ga0214193_1000797 | Not Available | 6431 | Open in IMG/M |
3300021131|Ga0214206_1036368 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Hydrogenophaga → Hydrogenophaga intermedia | 553 | Open in IMG/M |
3300021132|Ga0214196_1019962 | Not Available | 974 | Open in IMG/M |
3300021135|Ga0214247_1050996 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Hydrogenophaga → Hydrogenophaga intermedia | 654 | Open in IMG/M |
3300021137|Ga0214165_1002262 | Not Available | 9235 | Open in IMG/M |
3300021438|Ga0213920_1015309 | Not Available | 2052 | Open in IMG/M |
3300022602|Ga0248169_100587 | Not Available | 56793 | Open in IMG/M |
3300022602|Ga0248169_109091 | Not Available | 8215 | Open in IMG/M |
3300023184|Ga0214919_10592711 | Not Available | 656 | Open in IMG/M |
3300025328|Ga0208384_102340 | Not Available | 921 | Open in IMG/M |
3300025336|Ga0208619_108875 | Not Available | 733 | Open in IMG/M |
3300025340|Ga0208866_1006069 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Hydrogenophaga → Hydrogenophaga intermedia | 747 | Open in IMG/M |
3300025356|Ga0208870_1012534 | Not Available | 1036 | Open in IMG/M |
3300025356|Ga0208870_1029835 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Hydrogenophaga → Hydrogenophaga intermedia | 623 | Open in IMG/M |
3300025357|Ga0208383_1021437 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Hydrogenophaga → Hydrogenophaga intermedia | 768 | Open in IMG/M |
3300025358|Ga0208504_1003217 | All Organisms → Viruses → Predicted Viral | 2773 | Open in IMG/M |
3300025363|Ga0208385_1000245 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 11990 | Open in IMG/M |
3300025363|Ga0208385_1004599 | Not Available | 2053 | Open in IMG/M |
3300025369|Ga0208382_1021450 | Not Available | 866 | Open in IMG/M |
3300025369|Ga0208382_1033417 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 634 | Open in IMG/M |
3300025372|Ga0207957_1019611 | Not Available | 825 | Open in IMG/M |
3300025379|Ga0208738_1004114 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae | 2819 | Open in IMG/M |
3300025379|Ga0208738_1036472 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Hydrogenophaga → Hydrogenophaga intermedia | 734 | Open in IMG/M |
3300025382|Ga0208256_1033653 | Not Available | 730 | Open in IMG/M |
3300025383|Ga0208250_1001005 | Not Available | 7408 | Open in IMG/M |
3300025389|Ga0208257_1000759 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 8569 | Open in IMG/M |
3300025389|Ga0208257_1049367 | Not Available | 593 | Open in IMG/M |
3300025390|Ga0208743_1000039 | Not Available | 66188 | Open in IMG/M |
3300025391|Ga0208740_1047860 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 593 | Open in IMG/M |
3300025398|Ga0208251_1057949 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Hydrogenophaga → Hydrogenophaga intermedia | 607 | Open in IMG/M |
3300025399|Ga0208107_1091829 | Not Available | 501 | Open in IMG/M |
3300025400|Ga0208387_1006422 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2476 | Open in IMG/M |
3300025401|Ga0207955_1047095 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 706 | Open in IMG/M |
3300025403|Ga0208745_1070798 | Not Available | 511 | Open in IMG/M |
3300025410|Ga0208875_1044497 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 705 | Open in IMG/M |
3300025411|Ga0208865_1000090 | Not Available | 31722 | Open in IMG/M |
3300025420|Ga0208111_1000059 | Not Available | 60576 | Open in IMG/M |
3300025429|Ga0208500_1040026 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 560 | Open in IMG/M |
3300025466|Ga0208497_1075378 | Not Available | 639 | Open in IMG/M |
3300025532|Ga0208249_1142244 | Not Available | 515 | Open in IMG/M |
3300025578|Ga0208864_1049609 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Paraburkholderia → Paraburkholderia gardini | 1103 | Open in IMG/M |
3300025598|Ga0208379_1015773 | Not Available | 2188 | Open in IMG/M |
3300025598|Ga0208379_1032905 | Not Available | 1410 | Open in IMG/M |
3300025598|Ga0208379_1119508 | Not Available | 615 | Open in IMG/M |
3300027741|Ga0209085_1012460 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Methylobacterium → unclassified Methylobacterium → Methylobacterium sp. | 4219 | Open in IMG/M |
3300027896|Ga0209777_10092708 | All Organisms → Viruses → Predicted Viral | 2591 | Open in IMG/M |
3300027896|Ga0209777_10595118 | Not Available | 801 | Open in IMG/M |
3300027896|Ga0209777_11034141 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 559 | Open in IMG/M |
3300027896|Ga0209777_11121486 | Not Available | 530 | Open in IMG/M |
3300027896|Ga0209777_11195414 | Not Available | 508 | Open in IMG/M |
3300028393|Ga0304728_1226227 | Not Available | 637 | Open in IMG/M |
3300031759|Ga0316219_1005773 | Not Available | 8563 | Open in IMG/M |
3300032562|Ga0316226_1057578 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Hydrogenophaga → Hydrogenophaga intermedia | 1978 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 68.70% |
Freshwater | Environmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater | 9.16% |
Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 6.87% |
Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment | 6.11% |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 5.34% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 1.53% |
Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Lentic | 0.76% |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 0.76% |
Freshwater | Environmental → Aquatic → Freshwater → Creek → Unclassified → Freshwater | 0.76% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300000203 | Freshwater microbial communities from Trout Bog Lake, WI - Practice 18AUG2009 epilimnion | Environmental | Open in IMG/M |
3300000553 | Trout Bog Lake May 28 2007 Hypolimnion (Trout Bog Lake Combined Assembly 47 Hypolimnion Samples, Aug 2012 Assem) | Environmental | Open in IMG/M |
3300002092 | Lentic bog actinobacteria communities from Grosse Fuchskuhle, Germany - Sample acI-B2 co-culture F-B6 metagenome | Environmental | Open in IMG/M |
3300003375 | Freshwater actinobacteria microbial communities from Trout Bog Lake, Wisconsin, USA - enrichment TB-E6 | Environmental | Open in IMG/M |
3300003787 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE21Jul09 | Environmental | Open in IMG/M |
3300003789 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE28Sep08 | Environmental | Open in IMG/M |
3300003796 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH27Jul09 | Environmental | Open in IMG/M |
3300003798 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE10Sep07 | Environmental | Open in IMG/M |
3300003812 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH22Jun08 | Environmental | Open in IMG/M |
3300003820 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH10Sep07 | Environmental | Open in IMG/M |
3300003823 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH18Aug09 | Environmental | Open in IMG/M |
3300003826 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH29Jul08 | Environmental | Open in IMG/M |
3300003852 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies -HBP12 HB | Environmental | Open in IMG/M |
3300004685 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE18Jul08 (version 2) | Environmental | Open in IMG/M |
3300004692 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE27Jun07 (version 2) | Environmental | Open in IMG/M |
3300004694 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE17Sep08 (version 2) | Environmental | Open in IMG/M |
3300004770 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE25Aug07 | Environmental | Open in IMG/M |
3300004771 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - MA2.5M | Environmental | Open in IMG/M |
3300004772 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - MA0.5M | Environmental | Open in IMG/M |
3300004773 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - MA1M | Environmental | Open in IMG/M |
3300004777 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE16Jul07 | Environmental | Open in IMG/M |
3300004806 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH12Aug08 | Environmental | Open in IMG/M |
3300004807 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE02Aug07 | Environmental | Open in IMG/M |
3300006071 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH24Aug09 | Environmental | Open in IMG/M |
3300006103 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE29Jun09 | Environmental | Open in IMG/M |
3300006104 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH12Aug09.1 | Environmental | Open in IMG/M |
3300006105 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE07Jul09 | Environmental | Open in IMG/M |
3300006106 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE25Jul07 | Environmental | Open in IMG/M |
3300006107 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE23Oct07 | Environmental | Open in IMG/M |
3300006108 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH20Aug07 | Environmental | Open in IMG/M |
3300006112 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH10Oct08 | Environmental | Open in IMG/M |
3300006115 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE27Jul09 | Environmental | Open in IMG/M |
3300006119 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH18Jul07 | Environmental | Open in IMG/M |
3300006126 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH01Aug08 | Environmental | Open in IMG/M |
3300012006 | Freshwater microbial communities from Lake Lanier in Georgia, USA - LL_1101B | Environmental | Open in IMG/M |
3300013093 | Dystrophic lake water microbial communities from Trout Bog Lake, Wisconsin, USA - GEODES057 metaG | Environmental | Open in IMG/M |
3300020704 | Freshwater microbial communities from Trout Bog Lake, WI - 29JUN2009 hypolimnion | Environmental | Open in IMG/M |
3300020705 | Freshwater microbial communities from Trout Bog Lake, WI - 27AUG2007 epilimnion | Environmental | Open in IMG/M |
3300020707 | Freshwater microbial communities from Trout Bog Lake, WI - 05AUG2008 hypolimnion | Environmental | Open in IMG/M |
3300020710 | Freshwater microbial communities from Trout Bog Lake, WI - 20SEP2008 epilimnion | Environmental | Open in IMG/M |
3300020711 | Freshwater microbial communities from Trout Bog Lake, WI - 29JUL2008 hypolimnion | Environmental | Open in IMG/M |
3300020716 | Freshwater microbial communities from Trout Bog Lake, WI - 13JUL2009 epilimnion | Environmental | Open in IMG/M |
3300020722 | Freshwater microbial communities from Trout Bog Lake, WI - 23OCT2008 hypolimnion | Environmental | Open in IMG/M |
3300020724 | Freshwater microbial communities from Trout Bog Lake, WI - 04OCT2008 hypolimnion | Environmental | Open in IMG/M |
3300020727 | Freshwater microbial communities from Trout Bog Lake, WI - 29MAY2009 hypolimnion | Environmental | Open in IMG/M |
3300021127 | Freshwater microbial communities from Trout Bog Lake, WI - 05AUG2008 epilimnion | Environmental | Open in IMG/M |
3300021131 | Freshwater microbial communities from Trout Bog Lake, WI - 07JUL2009 epilimnion | Environmental | Open in IMG/M |
3300021132 | Freshwater microbial communities from Trout Bog Lake, WI - 25AUG2008 epilimnion | Environmental | Open in IMG/M |
3300021135 | Freshwater microbial communities from Trout Bog Lake, WI - 03JUN2009 hypolimnion | Environmental | Open in IMG/M |
3300021137 | Freshwater microbial communities from Trout Bog Lake, WI - Practice 03JUN2009 hypolimnion | Environmental | Open in IMG/M |
3300021438 | Freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 11-17 MG | Environmental | Open in IMG/M |
3300022602 | Freshwater microbial communities from Trout Bog Lake, Vilas County, Wisconsin, United States - 30JULY2014 epilimnion | Environmental | Open in IMG/M |
3300023184 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1503 | Environmental | Open in IMG/M |
3300025328 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE27Jul07 (SPAdes) | Environmental | Open in IMG/M |
3300025336 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE10Jul07 (SPAdes) | Environmental | Open in IMG/M |
3300025340 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE20Aug07 (SPAdes) | Environmental | Open in IMG/M |
3300025356 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE27Aug07 (SPAdes) | Environmental | Open in IMG/M |
3300025357 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE10Sep07 (SPAdes) | Environmental | Open in IMG/M |
3300025358 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH05Oct08 (SPAdes) | Environmental | Open in IMG/M |
3300025363 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH11Jul08 (SPAdes) | Environmental | Open in IMG/M |
3300025369 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE28Sep08 (SPAdes) | Environmental | Open in IMG/M |
3300025372 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH27Jun07 (SPAdes) | Environmental | Open in IMG/M |
3300025379 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE21Jul09 (SPAdes) | Environmental | Open in IMG/M |
3300025382 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH22Jun08 (SPAdes) | Environmental | Open in IMG/M |
3300025383 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE18Aug09 (SPAdes) | Environmental | Open in IMG/M |
3300025389 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH10Sep07 (SPAdes) | Environmental | Open in IMG/M |
3300025390 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH04Jul08 (SPAdes) | Environmental | Open in IMG/M |
3300025391 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE08Jun09 (SPAdes) | Environmental | Open in IMG/M |
3300025398 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE15Jun09 (SPAdes) | Environmental | Open in IMG/M |
3300025399 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE29Oct07 (SPAdes) | Environmental | Open in IMG/M |
3300025400 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH27Jul09 (SPAdes) | Environmental | Open in IMG/M |
3300025401 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE29Jun09 (SPAdes) | Environmental | Open in IMG/M |
3300025403 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH23Jun09 (SPAdes) | Environmental | Open in IMG/M |
3300025410 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH25Aug08 (SPAdes) | Environmental | Open in IMG/M |
3300025411 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE02Aug09 (SPAdes) | Environmental | Open in IMG/M |
3300025420 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH08Aug08 (SPAdes) | Environmental | Open in IMG/M |
3300025429 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE17Sep08 (SPAdes) | Environmental | Open in IMG/M |
3300025466 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE25Aug07 (SPAdes) | Environmental | Open in IMG/M |
3300025532 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - MA1M (SPAdes) | Environmental | Open in IMG/M |
3300025578 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - MA0.5M (SPAdes) | Environmental | Open in IMG/M |
3300025598 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE02Aug07 (SPAdes) | Environmental | Open in IMG/M |
3300027741 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027896 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies -HBP12 HB (SPAdes) | Environmental | Open in IMG/M |
3300028393 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_MF_MetaG (v2) | Environmental | Open in IMG/M |
3300031759 | Freshwater microbial communities from Trout Bog Lake, Wisconsin, USA - TBH18003P | Environmental | Open in IMG/M |
3300032562 | Freshwater microbial communities from Trout Bog Lake, Wisconsin, USA - TBH18017 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
TB18AUG2009E_0010219 | 3300000203 | Freshwater | MRQWIVRHERDGDDIFALWENDNGDRWYVQVVINGEVQW* |
TBL_comb47_HYPODRAFT_100832454 | 3300000553 | Freshwater | MRQWIVRHERDGENVVALWENEDGDRWYVQVVINGEVQW* |
TBL_comb47_HYPODRAFT_101185662 | 3300000553 | Freshwater | MRKWIVRHERDGDNVVALWENDNGDRWYVQVVVNGEVQW* |
JGI24218J26658_10105985 | 3300002092 | Lentic | MRKWIVRHERDGDNIRALWENEDGHRWYVDVVINGEVEW* |
JGI26470J50227_10093606 | 3300003375 | Freshwater | MRQWIVRHERDGDNIRALWENEDGDRWYVQVVVNGEVQW* |
JGI26470J50227_10553051 | 3300003375 | Freshwater | MRKWIVRHERDGDTVMALWENEDGDRWYVQVVINGEVQW* |
JGI26470J50227_10686623 | 3300003375 | Freshwater | MRQWIVRHERDGDNMVALWENEDGDRWYVQVVINGEVQW* |
JGI26470J50227_10789711 | 3300003375 | Freshwater | MRQWIVRHERDGDNIRALWENEDGDRWYVQVVINGEVQW* |
Ga0007811_10021638 | 3300003787 | Freshwater | MRQWIVRHERDGDNISALWENDNGDRWYVQVVVNGEVQW* |
Ga0007811_10037438 | 3300003787 | Freshwater | MRQWIVRHERDGDNVVALWXNDNGDRWYVQIVINGEVQW* |
Ga0007835_10002827 | 3300003789 | Freshwater | MRKWIVRHERDGDNVVALWENEDGDRWYVQVVINGEVQW* |
Ga0007835_10051324 | 3300003789 | Freshwater | MRKWIVRHERDGDNISALWENEDGDRWYVQVVINGEVQW* |
Ga0007835_10121973 | 3300003789 | Freshwater | MRQWIVRHERDGDNIRALWENDSGDRWYVQVVINGEVQW* |
Ga0007835_10217252 | 3300003789 | Freshwater | MRKWIVRHERDGDDICALWENEDGDRWYVQVVINGEVQW* |
Ga0007835_10223861 | 3300003789 | Freshwater | MRQWIVRHERDGDNIRALWENDNGDRWYVQVVINGEVQW* |
Ga0007865_10167932 | 3300003796 | Freshwater | MRQWIVRHERDGDDICALWENEDGDRWYVQVVTNGEVQW* |
Ga0007842_10035222 | 3300003798 | Freshwater | MRQWIVRHERDGDNVVALWENEDGDRWYVQVVINGEVQW* |
Ga0007842_10103812 | 3300003798 | Freshwater | MRQWIVRHERDGDDICALWESENGDRWYVQVVVNGEVQW* |
Ga0007861_10052162 | 3300003812 | Freshwater | MRKWIVRHERDGDNISALWENDNGDRWYVQIVINGEVQW* |
Ga0007863_10053993 | 3300003820 | Freshwater | MRQWIVRHERDGDNICALWENEDGDRWYVQVVINGEVQW* |
Ga0007875_100057810 | 3300003823 | Freshwater | MRKWIVRHERDGDNICALWENDSGDRWYVQVVINGEVQW* |
Ga0007875_10111953 | 3300003823 | Freshwater | MRQWIVRHERDGDNVMALWENEDGDRWYVQVVINGEVQW* |
Ga0007872_10111644 | 3300003826 | Freshwater | VQDNPLDAITGAAKMRKWIVRHERDGDNVVALWENEDGDRWYVQVVINGEVQW* |
Ga0031655_101247255 | 3300003852 | Freshwater Lake Sediment | MRQWVVRHERDGDNVVALWENDNGDRWYVQVVINGKVQW* |
Ga0031655_103246241 | 3300003852 | Freshwater Lake Sediment | MRQWIVRHERDGDNVVALWENDNGDRWYVXVVINGEVQW* |
Ga0031655_103292522 | 3300003852 | Freshwater Lake Sediment | MRQWIVRHERDGDNXXALWENEDGDRWYVQIVINGEVQW* |
Ga0065177_10084074 | 3300004685 | Freshwater | MRQWIVRHERDGDNICALWESDNGDRWYVQVVINGEVQW* |
Ga0065177_10592211 | 3300004685 | Freshwater | MRQWIVRHERDGDDICALWENEDGDRWYVQVMVNGEVQW* |
Ga0065171_10542912 | 3300004692 | Freshwater | MRQWIVRHERDGDNVVALWENDSGDRWYVQVVINGEVQW* |
Ga0065170_10428093 | 3300004694 | Freshwater | MRQWIVRHERDGDNVVALWENDNGDRWYVQVVINGKVQW* |
Ga0007804_10440321 | 3300004770 | Freshwater | MRKWIVRHERDGENVVALWENEDGNRWYVQVVINGEVQW* |
Ga0007797_11351701 | 3300004771 | Freshwater | MEERGSGAMRQWIVRHERDGDNIRALWENEDGDRWYVQVVVNGEVQW* |
Ga0007791_100275913 | 3300004772 | Freshwater | MRKWIVRHERDGDNVVALWENDNGDRWYVQVVINGKVQW* |
Ga0007795_100584413 | 3300004773 | Freshwater | MGNKMRQWIVRHERDGDNICALWENEDGDRWYVQVVINGEVQW* |
Ga0007827_100370785 | 3300004777 | Freshwater | MRQWIVRHERDGDDISALWENEDGDRWYVQVVINGEVQW* |
Ga0007854_103689343 | 3300004806 | Freshwater | MRQWIVRHERDGDNISALWENDSGDRWYVQVVINGEVQW* |
Ga0007809_1000485714 | 3300004807 | Freshwater | VEALEMRQWIVRHERDGDNICALWENDNGDRWYVQVMINGEVQW* |
Ga0007809_100362603 | 3300004807 | Freshwater | MEERGNGAMRQWIVRHERDGDDISALWENEDGDRWYVQVVINGEVQW* |
Ga0007809_100482072 | 3300004807 | Freshwater | MRQWIVRHERDGDNVMALWENEDGNRWYVQVVINGEVQW* |
Ga0007809_101353972 | 3300004807 | Freshwater | MRQWIVRHERDGDNICALWENDNGDRWYVQVVINGKVQW* |
Ga0007809_101442993 | 3300004807 | Freshwater | MRKWIVRHERDGDNVVALWENDSGDRWYVQVVVNGEVQW* |
Ga0007809_101452572 | 3300004807 | Freshwater | MRQWIVRHERDGDNISALWENDNGDRWYVQVVINGEVQW* |
Ga0007809_102157731 | 3300004807 | Freshwater | MRQWIVRHERDGDNICALWENEDGDRWYVQVMINGKVQW* |
Ga0007809_102366143 | 3300004807 | Freshwater | MRKWIVRHERDGDNVVALWENDNGDRWYVQVVINGEVQW* |
Ga0007876_10711524 | 3300006071 | Freshwater | MRKWIVRHERDGDNICALWENDNGDRWYVQIVINGEVQW* |
Ga0007876_10968954 | 3300006071 | Freshwater | WIVRHERDGDNVMALWENEDGDRWYVQVVINGEVQW* |
Ga0007813_10413244 | 3300006103 | Freshwater | NPLDAITGAAKMRKWIVRHERDGDNVVALWENEDGDRWYVQVVINGEVQW* |
Ga0007882_101475184 | 3300006104 | Freshwater | MRQWIVRHERDGDNVVALWENDNGDRWYVQIVINGEVQW* |
Ga0007882_101812854 | 3300006104 | Freshwater | MRKWIVRHERDGDNVVVLWENDNGDRWYMQVVVNGEVQW* |
Ga0007819_10088231 | 3300006105 | Freshwater | WIVRHERDGDNISALWENDNGDRWYVQIVINGEVQW* |
Ga0007819_10955142 | 3300006105 | Freshwater | MRQWIVRHELDGDNISALWENEDGDRWYVQVVINGEVQW* |
Ga0007833_10425432 | 3300006106 | Freshwater | MRQWIVRHERDGENVVALWENEDGNRWYVQVVINGEVQW* |
Ga0007833_10664313 | 3300006106 | Freshwater | MRQWIVRHERDGDNVVALWENDSGDRWYVQVVVNGEVQW* |
Ga0007836_100008710 | 3300006107 | Freshwater | MRQWIVRHERDGDNISALWENEDGDRWYVQVVINGEVQW* |
Ga0007862_10485223 | 3300006108 | Freshwater | MRQWIVRHERDGDNICALWENDNGDRWYVQVVINGEVQW* |
Ga0007862_10712892 | 3300006108 | Freshwater | MRQWIVRHERDGDNVVALWENDNGDRWYVQVVINGEVQW* |
Ga0007857_10635592 | 3300006112 | Freshwater | MKKWIVRHERDGDNISALWENDNGDRWYVQIVINGEVQW* |
Ga0007857_10796363 | 3300006112 | Freshwater | MRQWIVRHERDGDNVMALWENDSGDRWYVQVVVNGEVQW* |
Ga0007816_10976883 | 3300006115 | Freshwater | MRQWIVRHERDGDNVVALWENEDGDRWYVQVVVNGEVQW* |
Ga0007866_10503121 | 3300006119 | Freshwater | EMRQWIVRHERDGDNICALWENDNGDRWYVQVVINGKVQW* |
Ga0007866_11002083 | 3300006119 | Freshwater | MRQWIVRHERDGDNICALWENDNGDRWYVQVMINGEVQW* |
Ga0007855_10945031 | 3300006126 | Freshwater | WIVRHERDGDNVVALWENEDGDRWYVQVVINGEVQW* |
Ga0119955_10656723 | 3300012006 | Freshwater | MRQWIVRHERDGDNIRALWENEDGDRWYMQVVINGEVQW* |
Ga0164296_100147836 | 3300013093 | Freshwater | MRQWIVRHERDGDNVMALWENDDGDRWYVQVVINGEVQW* |
Ga0164296_100161530 | 3300013093 | Freshwater | MRQWIVRHERDGDNISALWESDNGDRWYVQVVINGEVQW* |
Ga0164296_10918432 | 3300013093 | Freshwater | MRQWIVRHERDGDNVVALWESDNGDRWYVQVVINGEVQW* |
Ga0164296_13020263 | 3300013093 | Freshwater | MRQWIVRHERDGDDICALWENDNGDRWYVQVVINGEVQW* |
Ga0214250_10325052 | 3300020704 | Freshwater | MKKWIVRHERDGDNVVALWENEDGDRWYVQVVINGEVQW |
Ga0214177_100156914 | 3300020705 | Freshwater | MRQWIVRHERDGDNVMALWENEDGDRWYVQVVINGEVQW |
Ga0214177_10016607 | 3300020705 | Freshwater | MRKWIVRHERDGDNISALWENDNGDRWYVQIVINGEVQW |
Ga0214238_10072764 | 3300020707 | Freshwater | MRQWIVRHERDGDNVVALWENEDGDRWYVQVVINGEVQW |
Ga0214198_10450283 | 3300020710 | Freshwater | MRKWIVRHERDGDNVVALWENDSGDRWYVQVVVNGEVQW |
Ga0214237_10069974 | 3300020711 | Freshwater | MRQWIVRHERDGENVVALWENEDGDRWYVQVVINGEVQW |
Ga0214207_10030862 | 3300020716 | Freshwater | MRQWIVRHERDGDDIRALWENDNGDRWYVQVVVNGEVQW |
Ga0214207_10123014 | 3300020716 | Freshwater | MRQWIVRHERDGDDIFALWENDNGDRWYVQVVINGEVQW |
Ga0214245_10210332 | 3300020722 | Freshwater | MKKWIVRHERDGDNISALWENDNGDRWYVQIVINGEVQW |
Ga0214244_10100843 | 3300020724 | Freshwater | MRKWIVRHERDGDNVVALWENEDGDRWYVQVVINGEVQW |
Ga0214246_10188742 | 3300020727 | Freshwater | MRKWIVRHERDGDNVVALWENDNGDRWYVQIVINGEVQW |
Ga0214193_100079714 | 3300021127 | Freshwater | MRQWIVRHERDGDNVMALWENDNGDRWYVQVVINGEVQW |
Ga0214206_10363682 | 3300021131 | Freshwater | MRQWIVRHERDGDNIRALWENDNGDRWYVQVVINGEVQW |
Ga0214196_10199622 | 3300021132 | Freshwater | MRKWIVRHERDGNNICALWENEDGDRWYVQVVINKEVQW |
Ga0214247_10509963 | 3300021135 | Freshwater | MRKWIVRHERDGDNVVALWENDNGDRWYVQVVVNGEVQW |
Ga0214165_100226222 | 3300021137 | Freshwater | MRKWIVRHERDGDTVMALWENEDGDRWYVQVVINGEVQ |
Ga0213920_10153098 | 3300021438 | Freshwater | MRQWIVRHERDGDNIRALWENEDGDRWYVQVVINGEVQW |
Ga0248169_1005872 | 3300022602 | Freshwater | MRQWIVRHERDGDNISALWESDNGDRWYVQVVINGEVQW |
Ga0248169_1090912 | 3300022602 | Freshwater | MRQWIVRHERDGDNISALWENDNGDRWYVQIVINGEVQW |
Ga0214919_105927112 | 3300023184 | Freshwater | MRQWIVRHEQDNDNVVALWENEDGDRWYMQVVINGEVQW |
Ga0208384_1023404 | 3300025328 | Freshwater | MRQWIVRHERDGDNIRALWENDSGDRWYVQVVINGEVQW |
Ga0208619_1088751 | 3300025336 | Freshwater | MEERGNGAMRQWIVRHERDGDDISALWENEDGDRWYVQVVINGEVQ |
Ga0208866_10060694 | 3300025340 | Freshwater | MRQWIVRHERDGDNVVALWENDSGDRWYVQVVVNGEVQW |
Ga0208870_10125345 | 3300025356 | Freshwater | MRQWIVRHERDGDDICALWESENGDRWYVQVVVNGEVQW |
Ga0208870_10298351 | 3300025356 | Freshwater | MRKWIVRHERDGDNISALWENDNGDRWYVQIVING |
Ga0208383_10214372 | 3300025357 | Freshwater | MRKWIVRHERDGDNVVVLWENDNGDRWYMQVVVNGEVQW |
Ga0208504_100321710 | 3300025358 | Freshwater | MRQWIVRHERDGDNVVALWENEDGDRWYVQIVINGEVQW |
Ga0208385_10002452 | 3300025363 | Freshwater | MRKWIVRHERDGDNISALWENEDGDRWYVQVVINGEVQW |
Ga0208385_10045998 | 3300025363 | Freshwater | MRQWIVRHERDGDNICALWENEDGDRWYVQIVVNGEVQW |
Ga0208382_10214502 | 3300025369 | Freshwater | MRQWIVRHERDGDNISALWENDSGDRWYVQVVINGEVQW |
Ga0208382_10334173 | 3300025369 | Freshwater | MRQWIVRHERDGDNVMALWENDSGDRWYVQVVVNGEVQW |
Ga0207957_10196113 | 3300025372 | Freshwater | MRQWIVRHERDGDNICALWENDNGDRWYVQVVINGKVQW |
Ga0208738_10041144 | 3300025379 | Freshwater | MRQWIVRHERDGDNISALWENDNGDRWYVQVVVNGEVQW |
Ga0208738_10364722 | 3300025379 | Freshwater | MRQWIVRHERDGDNVVALWENDNGDRWYVQIVINGEVQW |
Ga0208256_10336532 | 3300025382 | Freshwater | MRQWIVRHERDGDDISALWENEDGDRWYVQVVINGEVQW |
Ga0208250_100100519 | 3300025383 | Freshwater | MRKWIVRHERDGDNICALWENDSGDRWYVQVVINGEVQW |
Ga0208257_100075924 | 3300025389 | Freshwater | MRQWIVRHERDGDDICALWENEDGDRWYVQVVINGEVQW |
Ga0208257_10493672 | 3300025389 | Freshwater | MRQWIVRHERDGDNISALWENDNGDRWYVQVVINGEVQW |
Ga0208743_100003980 | 3300025390 | Freshwater | VEERGNGAMRKWIVRHERDGDNISALWENEDGDRWYVQVVINGEVQW |
Ga0208740_10478601 | 3300025391 | Freshwater | VQDNPLDAITGAAKMRKWIVRHERDGDNVVALWENEDGDRWYVQVVINGEVQW |
Ga0208251_10579493 | 3300025398 | Freshwater | MRKWIVRHERDGENVVALWENEDGNRWYVQVVINGEVQW |
Ga0208107_10918292 | 3300025399 | Freshwater | VVEALEMRQWIVRHERDGDNISALWENEDGDRWYVQVVINGEVQW |
Ga0208387_10064229 | 3300025400 | Freshwater | MRQWIVRHERDGDDICALWENEDGDRWYVQVVTNGEVQW |
Ga0207955_10470951 | 3300025401 | Freshwater | DNPLDAITGAAKMRKWIVRHERDGDNVVALWENEDGDRWYVQVVINGEVQW |
Ga0208745_10707982 | 3300025403 | Freshwater | MEERGNGAMRQWIVRHERDGDDISALWENEDGDRWYVQV |
Ga0208875_10444972 | 3300025410 | Freshwater | MEERGSGAMRQWIVRHERDGDNVMALWENDSGDRWYVQVVVNGEVQW |
Ga0208865_100009020 | 3300025411 | Freshwater | MRKWIVRHERDGDNICALWENDNGDRWYVQIVINGEVQW |
Ga0208111_100005985 | 3300025420 | Freshwater | MEERGNGAMRQWIVRHERDGDNICALWENEDGDRWYVQIVVNGEVQW |
Ga0208500_10400263 | 3300025429 | Freshwater | QWIVRHERDGDNVVALWENEDGDRWYVQVVINGEVQW |
Ga0208497_10753782 | 3300025466 | Freshwater | VVEALEMRQWIVRHERDGDDICALWENEDGDRWYVQVMVNGEVQW |
Ga0208249_11422442 | 3300025532 | Freshwater | MRQWIVRHERDGDNICALWENEDGDRWYVQVVINGEVQW |
Ga0208864_10496094 | 3300025578 | Freshwater | MRKWIVRHERDGDNVVALWENDNGDRWYVQVVINGKVQW |
Ga0208379_10157739 | 3300025598 | Freshwater | MRQWIVRHERDGDNICALWENDNGDRWYVQVMINGEVQW |
Ga0208379_10329051 | 3300025598 | Freshwater | KWIVRHERDGDNVVALWENDSGDRWYVQVVVNGEVQW |
Ga0208379_11195083 | 3300025598 | Freshwater | MRQWIVRHERDGDNVMALWENEDGNRWYVQVVINGEVQW |
Ga0209085_10124602 | 3300027741 | Freshwater Lake | LDAITGAAKMRQWIVRHERDGDNVVALWENEDGDRWYVQVVINGEVQW |
Ga0209777_100927083 | 3300027896 | Freshwater Lake Sediment | MRQWIVRHERDGDNVVALWEDDDGHRWYEHIVIDGEVQW |
Ga0209777_105951182 | 3300027896 | Freshwater Lake Sediment | MRQWIVRHERDGDNIRALWENDNGDRWYVQVVVNGEVQW |
Ga0209777_110341412 | 3300027896 | Freshwater Lake Sediment | MRQWIVRHERDGDNVVALWENDSGDRWYVQIVINGEVQW |
Ga0209777_111214863 | 3300027896 | Freshwater Lake Sediment | MRQWIVRHERDGDDIRALWENENGDRWYVQVVINGKVQW |
Ga0209777_111954141 | 3300027896 | Freshwater Lake Sediment | MRQWIVRHERDGDDIFALWENDNGDRWYVQVVINGE |
Ga0304728_12262272 | 3300028393 | Freshwater Lake | MRQWIVRHERDGDNVVVLWENDNGDRWYVQVVINGEVQW |
Ga0316219_100577311 | 3300031759 | Freshwater | MRQWIVRHERDGDNISALWENEDGDRWYEHIVVNGEVIW |
Ga0316226_10575788 | 3300032562 | Freshwater | MRQWIVRHERDGDNVVALWESDNGDRWYVQVVINGEVQW |
⦗Top⦘ |