Metagenome / Metatranscriptome Family F062226

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences

Select file to download:
Download

Overview

Basic Information
Family ID	F062226
Family Type	Metagenome / Metatranscriptome
Number of Sequences	131
Average Sequence Length	41 residues
Representative Sequence	MADIMLHDTYIVWNWALSLILLLAVIVLILGAAALIKYLFFR
Number of Associated Samples	96
Number of Associated Scaffolds	131

Quality Assessment
Transcriptomic Evidence	Yes
Most common taxonomic group	Bacteria
% of genes with valid RBS motifs	61.83 %
% of genes near scaffold ends (potentially truncated)	9.92 %
% of genes from short scaffolds (< 2000 bps)	77.86 %
Associated GOLD sequencing projects	84
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.55

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign

Most Common Taxonomy
Group	Bacteria (77.863 % of family members)
NCBI Taxonomy ID	2
Taxonomy	All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (15.267 % of family members)
Environment Ontology (ENVO)	Unclassified (31.298 % of family members)
Earth Microbiome Project Ontology (EMPO)	Host-associated → Plant → Plant rhizosphere (48.855 % of family members)

Multiple Sequence Alignments

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Select alignment to view:

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification:	Transmembrane (alpha-helical)	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 55.71% β-sheet: 0.00% Coil/Unstructured: 44.29%
Feature Viewer

Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.55
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.55
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

Gene Neighborhood

Neighboring Pfam domains

Pfam ID	Name	% Frequency in 131 Family Scaffolds
PF00816	Histone_HNS	6.11
PF04355	SmpA_OmlA	3.82
PF04392	ABC_sub_bind	2.29
PF01435	Peptidase_M48	2.29
PF03992	ABM	2.29
PF13410	GST_C_2	1.53
PF00903	Glyoxalase	1.53
PF12681	Glyoxalase_2	1.53
PF13417	GST_N_3	1.53
PF05656	DUF805	0.76
PF00300	His_Phos_1	0.76
PF02743	dCache_1	0.76
PF07286	D-Glu_cyclase	0.76
PF02518	HATPase_c	0.76
PF13531	SBP_bac_11	0.76
PF01548	DEDD_Tnp_IS110	0.76
PF07690	MFS_1	0.76
PF01266	DAO	0.76
PF13437	HlyD_3	0.76
PF08447	PAS_3	0.76
PF01810	LysE	0.76
PF04235	DUF418	0.76
PF11799	IMS_C	0.76
PF08327	AHSA1	0.76
PF05199	GMC_oxred_C	0.76
PF02566	OsmC	0.76
PF00043	GST_C	0.76
PF08483	Obsolete Pfam Family	0.76
PF13586	DDE_Tnp_1_2	0.76
PF00400	WD40	0.76
PF01569	PAP2	0.76
PF02384	N6_Mtase	0.76
PF01734	Patatin	0.76
PF13379	NMT1_2	0.76
PF04199	Cyclase	0.76
PF00072	Response_reg	0.76

COG ID	Name	Functional Category	% Frequency in 131 Family Scaffolds
COG2916	DNA-binding protein H-NS	Transcription [K]	6.11
COG2913	Outer membrane protein assembly factor BamE, lipoprotein component of the BamABCDE complex	Cell wall/membrane/envelope biogenesis [M]	3.82
COG2984	ABC-type uncharacterized transport system, periplasmic component	General function prediction only [R]	2.29
COG4667	Predicted phospholipase, patatin/cPLA2 family	Lipid transport and metabolism [I]	0.76
COG0435	Glutathionyl-hydroquinone reductase	Energy production and conversion [C]	0.76
COG4336	Uncharacterized conserved protein YcsI, UPF0317/DUF1446 family	Function unknown [S]	0.76
COG3621	Patatin-like phospholipase/acyl hydrolase, includes sporulation protein CotR	General function prediction only [R]	0.76
COG3547	Transposase	Mobilome: prophages, transposons [X]	0.76
COG3152	Uncharacterized membrane protein YhaH, DUF805 family	Function unknown [S]	0.76
COG2972	Sensor histidine kinase YesM	Signal transduction mechanisms [T]	0.76
COG2311	Uncharacterized membrane protein YeiB	Function unknown [S]	0.76
COG2303	Choline dehydrogenase or related flavoprotein	Lipid transport and metabolism [I]	0.76
COG1878	Kynurenine formamidase	Amino acid transport and metabolism [E]	0.76
COG1765	Uncharacterized OsmC-related protein	General function prediction only [R]	0.76
COG1764	Organic hydroperoxide reductase OsmC/OhrA	Defense mechanisms [V]	0.76
COG1752	Predicted acylesterase/phospholipase RssA, containd patatin domain	General function prediction only [R]	0.76
COG0625	Glutathione S-transferase	Posttranslational modification, protein turnover, chaperones [O]	0.76

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
All Organisms	root	All Organisms	77.86 %
Unclassified	root	N/A	22.14 %

Name	Rank	Taxonomy	Distribution
cellular organisms	root	All Organisms → cellular organisms	77.86 %
Unclassified	root	N/A	22.14 %

Name	Rank	Taxonomy	Distribution
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	77.86 %
Unclassified	root	N/A	22.14 %

Name	Rank	Taxonomy	Distribution
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	70.23 %
Unclassified	root	N/A	22.14 %
Terrabacteria group	clade	All Organisms → cellular organisms → Bacteria → Terrabacteria group	0.76 %
PVC group	clade	All Organisms → cellular organisms → Bacteria → PVC group	0.76 %
Acidobacteria	phylum	All Organisms → cellular organisms → Bacteria → Acidobacteria	0.76 %

Name	Rank	Taxonomy	Distribution
Alphaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	40.46 %
Unclassified	root	N/A	22.14 %
Gammaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	0.76 %
Actinobacteria	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	0.76 %
Verrucomicrobia	phylum	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia	0.76 %
Acidobacteria	phylum	All Organisms → cellular organisms → Bacteria → Acidobacteria	0.76 %

Name	Rank	Taxonomy	Distribution
Hyphomicrobiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	28.24 %
Unclassified	root	N/A	22.14 %
Verrucomicrobiae	class	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae	0.76 %
unclassified Alphaproteobacteria	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria	0.76 %
Actinomycetia	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	0.76 %
Xanthomonadales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales	0.76 %
Acidobacteria	phylum	All Organisms → cellular organisms → Bacteria → Acidobacteria	0.76 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	22.14 %
Bradyrhizobiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	9.92 %
Hyphomicrobiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae	2.29 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	0.76 %
Verrucomicrobiales	order	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales	0.76 %
Actinomycetia	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	0.76 %
Xanthomonadales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales	0.76 %
Acidobacteria	phylum	All Organisms → cellular organisms → Bacteria → Acidobacteria	0.76 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	22.14 %
Bradyrhizobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	4.58 %
unclassified Hyphomicrobiaceae	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae	1.53 %
Afipia	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Afipia	1.53 %
Hyphomicrobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium	0.76 %
Verrucomicrobiaceae	family	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobiaceae	0.76 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	0.76 %
Actinomycetia	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	0.76 %
Xanthomonadales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales	0.76 %
Acidobacteria	phylum	All Organisms → cellular organisms → Bacteria → Acidobacteria	0.76 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	22.14 %
unclassified Afipia	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Afipia → unclassified Afipia	1.53 %
Hyphomicrobiaceae bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium	1.53 %
unclassified Bradyrhizobium	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium	0.76 %
Bradyrhizobium brasilense	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium brasilense	0.76 %
Bradyrhizobium paxllaeri	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium paxllaeri	0.76 %
Verrucomicrobium	genus	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobiaceae → Verrucomicrobium	0.76 %
Hyphomicrobium denitrificans	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium → Hyphomicrobium denitrificans	0.76 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	0.76 %
Actinomycetia	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	0.76 %
Xanthomonadales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales	0.76 %
Acidobacteria	phylum	All Organisms → cellular organisms → Bacteria → Acidobacteria	0.76 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	22.14 %
Afipia sp. 1NLS2	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Afipia → unclassified Afipia → Afipia sp. 1NLS2	1.53 %
Hyphomicrobiaceae bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium	1.53 %
Bradyrhizobium sp. AS23.2	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. AS23.2	0.76 %
Verrucomicrobium spinosum	species	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobiaceae → Verrucomicrobium → Verrucomicrobium spinosum	0.76 %
Bradyrhizobium brasilense	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium brasilense	0.76 %
Bradyrhizobium paxllaeri	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium paxllaeri	0.76 %
Hyphomicrobium denitrificans	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium → Hyphomicrobium denitrificans	0.76 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	0.76 %
Actinomycetia	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	0.76 %
Xanthomonadales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales	0.76 %
Acidobacteria	phylum	All Organisms → cellular organisms → Bacteria → Acidobacteria	0.76 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
2170459005\|F1BAP7Q02FJKD7	Not Available	543	Open in IMG/M
3300000364\|INPhiseqgaiiFebDRAFT_101961498	Not Available	590	Open in IMG/M
3300000364\|INPhiseqgaiiFebDRAFT_101962812	All Organisms → cellular organisms → Bacteria → Proteobacteria	3894	Open in IMG/M
3300000364\|INPhiseqgaiiFebDRAFT_101963589	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	4477	Open in IMG/M
3300000364\|INPhiseqgaiiFebDRAFT_101964554	Not Available	754	Open in IMG/M
3300000550\|F24TB_10108398	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	1482	Open in IMG/M
3300000559\|F14TC_104879507	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	749	Open in IMG/M
3300001431\|F14TB_102403617	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	636	Open in IMG/M
3300001431\|F14TB_103292975	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	819	Open in IMG/M
3300003659\|JGI25404J52841_10039993	Not Available	992	Open in IMG/M
3300003911\|JGI25405J52794_10159399	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Afipia → unclassified Afipia → Afipia sp. 1NLS2	516	Open in IMG/M
3300004281\|Ga0066397_10000121	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	4078	Open in IMG/M
3300004479\|Ga0062595_100099380	All Organisms → cellular organisms → Bacteria → Proteobacteria	1541	Open in IMG/M
3300004479\|Ga0062595_102001345	All Organisms → cellular organisms → Bacteria → Proteobacteria	559	Open in IMG/M
3300005332\|Ga0066388_100129837	All Organisms → cellular organisms → Bacteria → Proteobacteria	3062	Open in IMG/M
3300005332\|Ga0066388_101303617	All Organisms → cellular organisms → Bacteria	1252	Open in IMG/M
3300005332\|Ga0066388_102194034	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	996	Open in IMG/M
3300005332\|Ga0066388_102479535	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	942	Open in IMG/M
3300005332\|Ga0066388_102490372	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	940	Open in IMG/M
3300005332\|Ga0066388_103286164	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	826	Open in IMG/M
3300005332\|Ga0066388_104759179	All Organisms → cellular organisms → Bacteria → Proteobacteria	690	Open in IMG/M
3300005332\|Ga0066388_107920719	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium → Hyphomicrobium denitrificans	531	Open in IMG/M
3300005337\|Ga0070682_100568500	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	890	Open in IMG/M
3300005347\|Ga0070668_100595772	All Organisms → cellular organisms → Bacteria	966	Open in IMG/M
3300005441\|Ga0070700_100161865	All Organisms → cellular organisms → Bacteria → Proteobacteria	1541	Open in IMG/M
3300005455\|Ga0070663_100165973	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1703	Open in IMG/M
3300005471\|Ga0070698_100976538	All Organisms → cellular organisms → Bacteria → Proteobacteria	794	Open in IMG/M
3300005713\|Ga0066905_100014848	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	3908	Open in IMG/M
3300005713\|Ga0066905_100161942	All Organisms → cellular organisms → Bacteria → Proteobacteria	1627	Open in IMG/M
3300005713\|Ga0066905_100802139	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	817	Open in IMG/M
3300005713\|Ga0066905_101537924	Not Available	607	Open in IMG/M
3300005764\|Ga0066903_100118513	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	3667	Open in IMG/M
3300005937\|Ga0081455_10006408	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	12623	Open in IMG/M
3300005983\|Ga0081540_1000080	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	103320	Open in IMG/M
3300005983\|Ga0081540_1053754	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1972	Open in IMG/M
3300005983\|Ga0081540_1229261	All Organisms → cellular organisms → Bacteria → Proteobacteria	657	Open in IMG/M
3300006038\|Ga0075365_10256164	All Organisms → cellular organisms → Bacteria	1230	Open in IMG/M
3300006042\|Ga0075368_10078238	All Organisms → cellular organisms → Bacteria → Proteobacteria	1343	Open in IMG/M
3300006058\|Ga0075432_10332519	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	639	Open in IMG/M
3300006163\|Ga0070715_10126571	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1224	Open in IMG/M
3300006163\|Ga0070715_10154739	All Organisms → cellular organisms → Bacteria	1127	Open in IMG/M
3300006603\|Ga0074064_11324359	All Organisms → cellular organisms → Bacteria → Proteobacteria	546	Open in IMG/M
3300006844\|Ga0075428_100111531	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	2980	Open in IMG/M
3300006844\|Ga0075428_100277723	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1802	Open in IMG/M
3300006852\|Ga0075433_10433118	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1159	Open in IMG/M
3300006904\|Ga0075424_102659720	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Afipia → unclassified Afipia → Afipia sp. 1NLS2	523	Open in IMG/M
3300006914\|Ga0075436_101227493	Not Available	566	Open in IMG/M
3300006914\|Ga0075436_101485940	Not Available	514	Open in IMG/M
3300006954\|Ga0079219_10010344	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	3102	Open in IMG/M
3300007076\|Ga0075435_101247991	All Organisms → cellular organisms → Bacteria → Proteobacteria	650	Open in IMG/M
3300007265\|Ga0099794_10360837	All Organisms → cellular organisms → Bacteria → Proteobacteria	757	Open in IMG/M
3300009094\|Ga0111539_10194147	All Organisms → cellular organisms → Bacteria → Proteobacteria	2368	Open in IMG/M
3300009094\|Ga0111539_11502067	All Organisms → cellular organisms → Bacteria → Proteobacteria	781	Open in IMG/M
3300009143\|Ga0099792_10086008	All Organisms → cellular organisms → Bacteria → Proteobacteria	1621	Open in IMG/M
3300009143\|Ga0099792_10631083	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	686	Open in IMG/M
3300009147\|Ga0114129_10504519	All Organisms → cellular organisms → Bacteria	1580	Open in IMG/M
3300009156\|Ga0111538_10135574	All Organisms → cellular organisms → Bacteria	3127	Open in IMG/M
3300009162\|Ga0075423_12441024	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	570	Open in IMG/M
3300009553\|Ga0105249_10681068	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium	1087	Open in IMG/M
3300009553\|Ga0105249_11317626	All Organisms → cellular organisms → Bacteria → Proteobacteria	794	Open in IMG/M
3300009792\|Ga0126374_11408547	Not Available	568	Open in IMG/M
3300009811\|Ga0105084_1102585	Not Available	541	Open in IMG/M
3300009822\|Ga0105066_1040523	Not Available	964	Open in IMG/M
3300009837\|Ga0105058_1149686	Not Available	567	Open in IMG/M
3300010046\|Ga0126384_10063102	All Organisms → cellular organisms → Bacteria → Proteobacteria	2604	Open in IMG/M
3300010047\|Ga0126382_10042634	All Organisms → cellular organisms → Bacteria → Proteobacteria	2594	Open in IMG/M
3300010047\|Ga0126382_10844673	All Organisms → cellular organisms → Bacteria → Proteobacteria	786	Open in IMG/M
3300010047\|Ga0126382_11487275	Not Available	622	Open in IMG/M
3300010159\|Ga0099796_10288500	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	692	Open in IMG/M
3300010358\|Ga0126370_12576432	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobiaceae → Verrucomicrobium → Verrucomicrobium spinosum	508	Open in IMG/M
3300010360\|Ga0126372_11872232	Not Available	644	Open in IMG/M
3300010362\|Ga0126377_10012187	All Organisms → cellular organisms → Bacteria → Proteobacteria	6769	Open in IMG/M
3300010362\|Ga0126377_10055296	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	3473	Open in IMG/M
3300010362\|Ga0126377_10203234	Not Available	1900	Open in IMG/M
3300010362\|Ga0126377_10749819	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium	1032	Open in IMG/M
3300010362\|Ga0126377_12453296	Not Available	597	Open in IMG/M
3300010400\|Ga0134122_10001240	All Organisms → cellular organisms → Bacteria → Proteobacteria	18336	Open in IMG/M
3300010401\|Ga0134121_13119915	All Organisms → cellular organisms → Bacteria → Proteobacteria	511	Open in IMG/M
3300011444\|Ga0137463_1050153	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1553	Open in IMG/M
3300012096\|Ga0137389_10211268	All Organisms → cellular organisms → Bacteria → Proteobacteria	1620	Open in IMG/M
3300012198\|Ga0137364_10178768	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1547	Open in IMG/M
3300012200\|Ga0137382_10155649	All Organisms → cellular organisms → Bacteria → Proteobacteria	1552	Open in IMG/M
3300012203\|Ga0137399_11571595	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	545	Open in IMG/M
3300012205\|Ga0137362_10109378	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	2335	Open in IMG/M
3300012208\|Ga0137376_10284307	All Organisms → cellular organisms → Bacteria → Proteobacteria	1435	Open in IMG/M
3300012359\|Ga0137385_10262422	All Organisms → cellular organisms → Bacteria → Proteobacteria	1493	Open in IMG/M
3300012685\|Ga0137397_10143449	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1767	Open in IMG/M
3300012918\|Ga0137396_10274376	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. AS23.2	1245	Open in IMG/M
3300012925\|Ga0137419_10447635	Not Available	1017	Open in IMG/M
3300012927\|Ga0137416_11233525	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium brasilense	674	Open in IMG/M
3300012948\|Ga0126375_10279459	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1147	Open in IMG/M
3300012951\|Ga0164300_10761650	Not Available	595	Open in IMG/M
3300012958\|Ga0164299_10817792	Not Available	666	Open in IMG/M
3300012971\|Ga0126369_10628319	Not Available	1146	Open in IMG/M
3300012988\|Ga0164306_11689180	Not Available	549	Open in IMG/M
3300012989\|Ga0164305_11408612	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	614	Open in IMG/M
3300013297\|Ga0157378_11752345	All Organisms → cellular organisms → Bacteria → Proteobacteria	669	Open in IMG/M
3300015374\|Ga0132255_100998564	All Organisms → cellular organisms → Bacteria → Proteobacteria	1255	Open in IMG/M
3300018051\|Ga0184620_10114509	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium paxllaeri	844	Open in IMG/M
3300019360\|Ga0187894_10024966	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	4040	Open in IMG/M
3300019789\|Ga0137408_1001738	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	4437	Open in IMG/M
3300020583\|Ga0210401_10007380	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	11027	Open in IMG/M
3300021560\|Ga0126371_13004705	Not Available	571	Open in IMG/M
3300024288\|Ga0179589_10420837	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	614	Open in IMG/M
3300024347\|Ga0179591_1200851	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	2491	Open in IMG/M
3300025905\|Ga0207685_10095451	All Organisms → cellular organisms → Bacteria → Acidobacteria	1261	Open in IMG/M
3300025927\|Ga0207687_10243584	All Organisms → cellular organisms → Bacteria → Proteobacteria	1426	Open in IMG/M
3300025942\|Ga0207689_10251594	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales	1461	Open in IMG/M
3300025961\|Ga0207712_10137435	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1871	Open in IMG/M
3300025961\|Ga0207712_11583621	Not Available	587	Open in IMG/M
3300026067\|Ga0207678_10141139	All Organisms → cellular organisms → Bacteria → Proteobacteria	2056	Open in IMG/M
3300026371\|Ga0257179_1024149	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	719	Open in IMG/M
3300026555\|Ga0179593_1120308	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	2841	Open in IMG/M
3300027646\|Ga0209466_1035663	Not Available	1015	Open in IMG/M
3300027866\|Ga0209813_10001845	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	4777	Open in IMG/M
3300027866\|Ga0209813_10005113	All Organisms → cellular organisms → Bacteria	3171	Open in IMG/M
3300027903\|Ga0209488_10327276	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1141	Open in IMG/M
3300027907\|Ga0207428_10056466	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	3120	Open in IMG/M
3300027907\|Ga0207428_10113543	All Organisms → cellular organisms → Bacteria → Proteobacteria	2082	Open in IMG/M
3300027907\|Ga0207428_10464215	All Organisms → cellular organisms → Bacteria → Proteobacteria	922	Open in IMG/M
3300027909\|Ga0209382_10478588	All Organisms → cellular organisms → Bacteria → Proteobacteria	1375	Open in IMG/M
3300027961\|Ga0209853_1120143	Not Available	654	Open in IMG/M
3300028802\|Ga0307503_10126120	All Organisms → cellular organisms → Bacteria → Proteobacteria	1130	Open in IMG/M
3300031720\|Ga0307469_10435866	Not Available	1130	Open in IMG/M
3300031720\|Ga0307469_11831264	Not Available	587	Open in IMG/M
3300031740\|Ga0307468_100035852	All Organisms → cellular organisms → Bacteria → Proteobacteria	2429	Open in IMG/M
3300031740\|Ga0307468_100141055	All Organisms → cellular organisms → Bacteria → Proteobacteria	1527	Open in IMG/M
3300031903\|Ga0307407_10460278	Not Available	925	Open in IMG/M
3300031908\|Ga0310900_11723564	Not Available	532	Open in IMG/M
3300032205\|Ga0307472_102143250	Not Available	563	Open in IMG/M
3300034817\|Ga0373948_0007992	All Organisms → cellular organisms → Bacteria → Proteobacteria	1792	Open in IMG/M

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:

Habitat	Taxonomy	Distribution
Environmental	Environmental	69.47%
Host-Associated	Host-Associated	30.53%

Habitat	Taxonomy	Distribution
Terrestrial	Environmental → Terrestrial	67.94%
Plants	Host-Associated → Plants	30.53%
Aquatic	Environmental → Aquatic	1.53%

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil	67.18%
Rhizosphere	Host-Associated → Plants → Rhizosphere	21.37%
Rhizoplane	Host-Associated → Plants → Rhizoplane	6.11%
Roots	Host-Associated → Plants → Roots	3.05%
Sediment	Environmental → Aquatic → Sediment	1.53%
Cave	Environmental → Terrestrial → Cave	0.76%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified	45.04%
Loam	Environmental → Terrestrial → Soil → Loam	19.08%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	18.32%
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	5.34%
Sand	Environmental → Terrestrial → Soil → Sand	3.05%
Bulk Soil	Host-Associated → Plants → Roots → Bulk Soil	3.05%
Soil	Host-Associated → Plants → Rhizosphere → Soil	3.05%
Unclassified	Environmental → Aquatic → Sediment → Unclassified	1.53%
Unclassified	Environmental → Terrestrial → Cave → Unclassified	0.76%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified	0.76%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified → Unclassified	32.82%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	18.32%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil	11.45%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil	5.34%
Unclassified	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified	5.34%
Agricultural Soil	Environmental → Terrestrial → Soil → Loam → Agricultural Soil	4.58%
Grasslands	Environmental → Terrestrial → Soil → Unclassified → Grasslands	3.82%
Grasslands	Environmental → Terrestrial → Soil → Loam → Grasslands	3.05%
Unclassified	Environmental → Terrestrial → Soil → Sand → Unclassified	3.05%
Unclassified	Host-Associated → Plants → Roots → Bulk Soil → Unclassified	3.05%
Unclassified	Host-Associated → Plants → Rhizosphere → Soil → Unclassified	3.05%
Agricultural Land	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land	2.29%
Unclassified	Environmental → Aquatic → Sediment → Unclassified → Unclassified	1.53%
Agricultural	Environmental → Terrestrial → Soil → Unclassified → Agricultural	0.76%
Unclassified	Environmental → Terrestrial → Cave → Unclassified → Unclassified	0.76%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified	0.76%

Habitat	Taxonomy	Distribution
Vadose Zone Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil	15.27%
Populus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere	12.98%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil	11.45%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil	11.45%
Tabebuia Heterophylla Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere	4.58%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	3.82%
Hardwood Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil	3.82%
Corn, Switchgrass And Miscanthus Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere	3.82%
Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil	3.05%
Soil	Environmental → Terrestrial → Soil → Loam → Grasslands → Soil	3.05%
Groundwater Sand	Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand	3.05%
Populus Endosphere	Host-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere	3.05%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere	3.05%
Terrestrial Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil	1.53%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil	1.53%
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	1.53%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere	1.53%
Soil	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil	0.76%
Groundwater Sediment	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment	0.76%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	0.76%
Agricultural Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil	0.76%
Grass Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil	0.76%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil	0.76%
Corn Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere	0.76%
Microbial Mat On Rocks	Environmental → Terrestrial → Cave → Unclassified → Unclassified → Microbial Mat On Rocks	0.76%
Arabidopsis Rhizosphere	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere	0.76%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere	0.76%
Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere	0.76%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	0.76%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	0.76%
Rhizosphere Soil	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere Soil	0.76%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere	0.76%

Visualization

Powered by ApexCharts

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
2170459005	Grass soil microbial communities from Rothamsted Park, UK - July 2009 direct MP BIO1O1 lysis 0-21cm	Environmental	Open in IMG/M
3300000364	Soil microbial communities from Great Prairies - Iowa, Native Prairie soil	Environmental	Open in IMG/M
3300000550	Amended soil microbial communities from Kansas Great Prairies, USA - BrdU amended with acetate total DNA F2.4 TB clc assemly	Environmental	Open in IMG/M
3300000559	Amended soil microbial communities from Kansas Great Prairies, USA - control no BrdU total DNA F1.4 TC clc assemly	Environmental	Open in IMG/M
3300001431	Amended soil microbial communities from Kansas Great Prairies, USA - BrdU F1.4TB clc assemly	Environmental	Open in IMG/M
3300003659	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1	Host-Associated	Open in IMG/M
3300003911	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1	Host-Associated	Open in IMG/M
3300004281	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 30 MoBio	Environmental	Open in IMG/M
3300004479	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs	Environmental	Open in IMG/M
3300005332	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)	Environmental	Open in IMG/M
3300005337	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG	Environmental	Open in IMG/M
3300005347	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG	Host-Associated	Open in IMG/M
3300005441	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG	Environmental	Open in IMG/M
3300005455	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG	Host-Associated	Open in IMG/M
3300005471	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG	Environmental	Open in IMG/M
3300005713	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2)	Environmental	Open in IMG/M
3300005764	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)	Environmental	Open in IMG/M
3300005937	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1	Host-Associated	Open in IMG/M
3300005983	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1	Host-Associated	Open in IMG/M
3300006038	Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5	Host-Associated	Open in IMG/M
3300006042	Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3	Host-Associated	Open in IMG/M
3300006058	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1	Host-Associated	Open in IMG/M
3300006163	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG	Environmental	Open in IMG/M
3300006603	Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMC (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300006844	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2	Host-Associated	Open in IMG/M
3300006852	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2	Host-Associated	Open in IMG/M
3300006904	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3	Host-Associated	Open in IMG/M
3300006914	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5	Host-Associated	Open in IMG/M
3300006954	Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control	Environmental	Open in IMG/M
3300007076	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4	Host-Associated	Open in IMG/M
3300007265	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1	Environmental	Open in IMG/M
3300009094	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2)	Host-Associated	Open in IMG/M
3300009143	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2	Environmental	Open in IMG/M
3300009147	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2)	Host-Associated	Open in IMG/M
3300009156	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2)	Host-Associated	Open in IMG/M
3300009162	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2	Host-Associated	Open in IMG/M
3300009553	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG	Host-Associated	Open in IMG/M
3300009792	Tropical forest soil microbial communities from Panama - MetaG Plot_12	Environmental	Open in IMG/M
3300009811	Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N3_20_30	Environmental	Open in IMG/M
3300009822	Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_30_40	Environmental	Open in IMG/M
3300009837	Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_20_30	Environmental	Open in IMG/M
3300010046	Tropical forest soil microbial communities from Panama - MetaG Plot_36	Environmental	Open in IMG/M
3300010047	Tropical forest soil microbial communities from Panama - MetaG Plot_30	Environmental	Open in IMG/M
3300010159	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3	Environmental	Open in IMG/M
3300010358	Tropical forest soil microbial communities from Panama - MetaG Plot_3	Environmental	Open in IMG/M
3300010360	Tropical forest soil microbial communities from Panama - MetaG Plot_6	Environmental	Open in IMG/M
3300010362	Tropical forest soil microbial communities from Panama - MetaG Plot_22	Environmental	Open in IMG/M
3300010400	Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2	Environmental	Open in IMG/M
3300010401	Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1	Environmental	Open in IMG/M
3300011444	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT800_2	Environmental	Open in IMG/M
3300012096	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG	Environmental	Open in IMG/M
3300012198	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG	Environmental	Open in IMG/M
3300012200	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG	Environmental	Open in IMG/M
3300012203	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG	Environmental	Open in IMG/M
3300012205	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG	Environmental	Open in IMG/M
3300012208	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG	Environmental	Open in IMG/M
3300012359	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG	Environmental	Open in IMG/M
3300012685	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG	Environmental	Open in IMG/M
3300012918	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG	Environmental	Open in IMG/M
3300012925	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly)	Environmental	Open in IMG/M
3300012927	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly)	Environmental	Open in IMG/M
3300012948	Tropical forest soil microbial communities from Panama - MetaG Plot_14	Environmental	Open in IMG/M
3300012951	Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MG	Environmental	Open in IMG/M
3300012958	Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG	Environmental	Open in IMG/M
3300012971	Tropical forest soil microbial communities from Panama - MetaG Plot_1	Environmental	Open in IMG/M
3300012988	Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MG	Environmental	Open in IMG/M
3300012989	Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG	Environmental	Open in IMG/M
3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Host-Associated	Open in IMG/M
3300015374	Col-0 rhizosphere combined assembly	Host-Associated	Open in IMG/M
3300018051	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5_b1	Environmental	Open in IMG/M
3300019360	White microbial mat communities from a lava cave in the Kipuka Kanohina Cave System on the Island of Hawaii, USA - GBC170108-1 metaG	Environmental	Open in IMG/M
3300019789	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (PacBio error correction)	Environmental	Open in IMG/M
3300020583	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M	Environmental	Open in IMG/M
3300021560	Tropical forest soil microbial communities from Panama - MetaG Plot_4	Environmental	Open in IMG/M
3300024288	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal	Environmental	Open in IMG/M
3300024347	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal (PacBio error correction)	Environmental	Open in IMG/M
3300025905	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes)	Environmental	Open in IMG/M
3300025927	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025942	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes)	Host-Associated	Open in IMG/M
3300025961	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300026067	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300026371	Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-01-B	Environmental	Open in IMG/M
3300026555	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (PacBio error correction)	Environmental	Open in IMG/M
3300027646	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 30 MoBio (SPAdes)	Environmental	Open in IMG/M
3300027866	Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes)	Host-Associated	Open in IMG/M
3300027903	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes)	Environmental	Open in IMG/M
3300027907	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes)	Host-Associated	Open in IMG/M
3300027909	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes)	Host-Associated	Open in IMG/M
3300027961	Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_30_40 (SPAdes)	Environmental	Open in IMG/M
3300028802	Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 17_S	Environmental	Open in IMG/M
3300031720	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515	Environmental	Open in IMG/M
3300031740	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05	Environmental	Open in IMG/M
3300031903	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1	Host-Associated	Open in IMG/M
3300031908	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D1	Environmental	Open in IMG/M
3300032205	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05	Environmental	Open in IMG/M
3300034817	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1	Host-Associated	Open in IMG/M

Geographical Distribution

Zoom:	Powered by OpenStreetMap

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
E41_07094450	2170459005	Grass Soil	MADIALHDSYFVGSWSLGFLFPLVVVVLLLGAPALVKYLFFR
INPhiseqgaiiFebDRAFT_1019614982	3300000364	Soil	VADRALRDAYMVWNWALASIPALAFIVLTLGAAALIKYLFWR*
INPhiseqgaiiFebDRAFT_1019628122	3300000364	Soil	MADIVLHDTYFVGXWSLGFFFLLVVVVLILXAXALIKYLFXR*
INPhiseqgaiiFebDRAFT_1019635892	3300000364	Soil	MADIVLHDTYFVGSWSLGFFFLLVVVVLILNAGALIKYLFSR*
INPhiseqgaiiFebDRAFT_1019645542	3300000364	Soil	MADIALHDTYFVGSWSLGFLLLLVVVVLVLGAAALVKYLFFR*
F24TB_101083982	3300000550	Soil	MADIFLQDTYIVWNWALSLILLLAVIVLVLGAAALIKYLFFR*
F14TC_1048795072	3300000559	Soil	VADMVFHDTYIVWNWSLSLFLLLALIVLILGAAALIKYLFFR*
F14TB_1024036171	3300001431	Soil	MNSQMALHDTYIVWNWGLSAIVLLVVVVLILGAAALIKYLFFR*
F14TB_1032929752	3300001431	Soil	MADIMLHDTYIVWNWALSLILLLAVIVLVLGAAALIKYLFFR*
JGI25404J52841_100399931	3300003659	Tabebuia Heterophylla Rhizosphere	MAFHDTYFVWNWALSLFLLLALIVLILGAAALVKYLFFR*
JGI25405J52794_101593991	3300003911	Tabebuia Heterophylla Rhizosphere	MALHDTYIVWSWELHLMIFLVIVVLILGAAALIKYLLFR*
Ga0066397_100001214	3300004281	Tropical Forest Soil	MADVVLHDTYIVGNWRLGLLLLLVVVVLILGAAALTKYLFFR*
Ga0062595_1000993801	3300004479	Soil	MALHDTYFVWSWELHLLVLLLIVVLVLGAAALIKYLFFK*
Ga0062595_1020013452	3300004479	Soil	MADIFLHDTYIVWSWTLSLILLLAVIVLVLGAAALIKYLFFR*
Ga0066388_1001298374	3300005332	Tropical Forest Soil	MADVVLHDTYIVGNSGLGLLLLLVVVVLILGAAALIKYLFFR*
Ga0066388_1013036173	3300005332	Tropical Forest Soil	MPDLVMHDTYFVWSWPLNALLVLVTIVLLLAAAALIKYLFFR*
Ga0066388_1021940342	3300005332	Tropical Forest Soil	MALHDTYFIWSWELHLTVLLVIVVLVLGAAALIKYLLFR*
Ga0066388_1024795352	3300005332	Tropical Forest Soil	MALHDTYIVWNWELSALLLLVVVVLILGAAALVKYLFFR*
Ga0066388_1024903723	3300005332	Tropical Forest Soil	MPDLVFHDTYFVWSWPLNALLVLVTIVLLLAAAALIKYLFFR*
Ga0066388_1032861641	3300005332	Tropical Forest Soil	MGDVVLHDTYIVWSWGLGFLLLLVVVVLILGAAALIKYLFF
Ga0066388_1047591791	3300005332	Tropical Forest Soil	MPDLVMHDTYFVWGWALNAIILLVIIVLLLAAAALIKYLFFR*
Ga0066388_1079207191	3300005332	Tropical Forest Soil	MPDLVMHDTYFVWSWALNAIFVLVTIVLLLAAAALIKYLFFR*
Ga0070682_1005685002	3300005337	Corn Rhizosphere	MIAQMALHDTYIVWTWELSAILLLVVIVLILSAAALIKYLFFR*
Ga0070668_1005957722	3300005347	Switchgrass Rhizosphere	MADIALHDTYFVGSWTLGFFFLLVVVVLLLGTAALVQYLFFR*
Ga0070700_1001618654	3300005441	Corn, Switchgrass And Miscanthus Rhizosphere	MALHDTYIVWNWELSALLLLVIVVLILGAAALIKYLFFR*
Ga0070663_1001659733	3300005455	Corn Rhizosphere	MALHDTYIVWTWELSAILLLVVIVLILSAAALIKYLFFR*
Ga0070698_1009765382	3300005471	Corn, Switchgrass And Miscanthus Rhizosphere	MADIFLHDTYIVWNWALSLILLLAVIVLVLGAAALIKYLFFR*
Ga0066905_1000148483	3300005713	Tropical Forest Soil	MADVVLHDTYIVGNWGLGLLLLLVVVVLILGAAALTKYLFFR*
Ga0066905_1001619423	3300005713	Tropical Forest Soil	MALHDTYIVWNWELSAILLLVVVVLILGTAALIKYLFFR*
Ga0066905_1008021391	3300005713	Tropical Forest Soil	MALHDTYFVWSWELHLIVLLVLVVLVLSAAALVKYLFFR*
Ga0066905_1015379242	3300005713	Tropical Forest Soil	MPDLVMHDTYFAWSWALNAIFVLVIIVLLLTAAALIKYLFFR*
Ga0066903_1001185132	3300005764	Tropical Forest Soil	MPDLVMHDTYFVWSWPLNALLLLVTIVLLLAAAALIKYLFFR*
Ga0081455_1000640812	3300005937	Tabebuia Heterophylla Rhizosphere	VPDIVLHDIYIVWNWTLSLFLLLALIVLVLGAAALVKYLFFR*
Ga0081540_100008042	3300005983	Tabebuia Heterophylla Rhizosphere	MALHDTYIVWNWELSALLLLVIVVLILAAAALVKYLFFR*
Ga0081540_10537542	3300005983	Tabebuia Heterophylla Rhizosphere	VADMAFHDTYFVWNWALSLFLLLALIVLILGAAALVKYLFFR*
Ga0081540_12292611	3300005983	Tabebuia Heterophylla Rhizosphere	VPDIVLHDTYIVWNWTLSLFLLLALIVLVLGAAALVKYLFFR*
Ga0075365_102561643	3300006038	Populus Endosphere	MPDMALHDTYFVGGWSLGFLFLLVVVVLILGAAALVKYLFFR*
Ga0075368_100782382	3300006042	Populus Endosphere	MPDIALHDTYFVWSWSVGFLFLLVVVVLLLGAAALVKYLFFR*
Ga0075432_103325192	3300006058	Populus Rhizosphere	MALHDTYFVWQWELHLLVLLLIVVLVLGAAALIKYLFFK*
Ga0070715_101265712	3300006163	Corn, Switchgrass And Miscanthus Rhizosphere	MALHETYIVWNWEVPIILLLVIIVLILGAAALIKFLLFR*
Ga0070715_101547392	3300006163	Corn, Switchgrass And Miscanthus Rhizosphere	MADITLHDTYFVLSWSLGFFFLLVVVVLVLGAAALVKYLVFR*
Ga0074064_113243591	3300006603	Soil	VADLVLHDTYIVWNWALDLILLLALIVLILGAAALVKYLFFR*
Ga0075428_1001115312	3300006844	Populus Rhizosphere	MPDLVIHDTYFVWSWPLNALLALVTIVLLLAAAALIKYLFFR*
Ga0075428_1002777232	3300006844	Populus Rhizosphere	MNAQMALHDTYIVWNWGLSAILLLVVVVLILGAAALIKYLFFR*
Ga0075433_104331181	3300006852	Populus Rhizosphere	MADIVLHDTYFVGSWSLGFFFLLVVVVLILSAGASIKYLLFR*
Ga0075424_1026597201	3300006904	Populus Rhizosphere	DTYFVGSWSLGFFFLLVVVVLILSAGASIKYLLFR*
Ga0075436_1012274931	3300006914	Populus Rhizosphere	MALHDTYIVWNWELGLLVLLVIVALILGIAALIKYLLFR*
Ga0075436_1014859402	3300006914	Populus Rhizosphere	MADIALHDTYIVWNWALASIPPLAVFVLVLGAGALIKYLFWR*
Ga0079219_100103441	3300006954	Agricultural Soil	MIAQMALHDTCIAWTWELSAFLLLVVIVLILAAAALIKYLFFR*
Ga0075435_1012479912	3300007076	Populus Rhizosphere	VAADIVLHETYIVWNWALGLVLLLVLIVLILGAAALVKYLFFR*
Ga0099794_103608372	3300007265	Vadose Zone Soil	MADIMLHDTYIVWNWAFSLIVLLAVIVLVLGAAALIKYLLFR*
Ga0111539_101941472	3300009094	Populus Rhizosphere	MIAQMALHDTYIVWTWELSAILLLMVIVLILGAAALIKYLFFR*
Ga0111539_115020672	3300009094	Populus Rhizosphere	MNAQMALHDTYIVWNWELSAILLLVVVVLILGAAALIKYLFFR*
Ga0099792_100860084	3300009143	Vadose Zone Soil	MADIMLHDTYIVWNWALSLIVLLAVIVLVLGAAALIKYLFFR*
Ga0099792_106310831	3300009143	Vadose Zone Soil	MVFHDTYVVWNWALSLFLLLALIVLILGAAALVKYLFFW*
Ga0114129_105045192	3300009147	Populus Rhizosphere	MADVVLHDTYIVWNWALASIPPLAVIVLVLGAAALIKFLFWR*
Ga0111538_101355742	3300009156	Populus Rhizosphere	MPDLVMHDTYFVWSWALNAIVVLVIIVLLLAAAALIKYLFFR*
Ga0075423_124410241	3300009162	Populus Rhizosphere	MADIVLHDTYFVGSWSLGFFFLLVVVVLILSAAALIKYLFFR*
Ga0105249_106810682	3300009553	Switchgrass Rhizosphere	QMALHDTYIVWNWELSALLLLVIVVLILGAAALIKYLFFR*
Ga0105249_113176262	3300009553	Switchgrass Rhizosphere	MADIALHDTYFVGSWAFGFFFLLVVVVLVLGAAALVKCLFFR*
Ga0126374_114085472	3300009792	Tropical Forest Soil	MPDIALHDTYYIVGHWGVLGFIMIMLVIIVLVLGAAALVKYLFFR*
Ga0105084_11025852	3300009811	Groundwater Sand	MPDLVMHDTYFVWSWALNAILVLVIVVLLLGAAALIKFLFFR*
Ga0105066_10405233	3300009822	Groundwater Sand	AGMPDLVMHDTYFVWSWALNAILVLVIVVLLLGAAALIKFLFFR*
Ga0105058_11496862	3300009837	Groundwater Sand	MPDLVMHDTYFVWSWALNAILVLVIVVLLLGAAALTKFLFFR*
Ga0126384_100631023	3300010046	Tropical Forest Soil	MPDLVMHDTYFVWSWPLSALLVLVTIVLLLAAAALIKYLFFR*
Ga0126382_100426344	3300010047	Tropical Forest Soil	MALHDTYFVWSWELHLIVLLVIVVLVLGVAALIKYLLFR*
Ga0126382_108446732	3300010047	Tropical Forest Soil	MVLHDTYIVWQWEVPIILLLVIVVLVLAAAALIKYLFFR*
Ga0126382_114872751	3300010047	Tropical Forest Soil	MPDLVMHDTYFVWSWPLNALLGLVTIVLLLAAAALIKYLFFR*
Ga0099796_102885002	3300010159	Vadose Zone Soil	MVFHDTYVVWNWALSLFLLLALIVLILGAAALVKYLFFR*
Ga0126370_125764322	3300010358	Tropical Forest Soil	MPDLVMHDTYFVWGWALNAILLLVIIVLLLAAAALIKYLFFR*
Ga0126372_118722322	3300010360	Tropical Forest Soil	MPDLVMHDTYFVWGWALNAILLLVIVVLLLAAAALIKYLFFR*
Ga0126377_100121876	3300010362	Tropical Forest Soil	MPDLVMHDTYFVWSWPLNALLVLVTIVLLLAAAALIKYRFFR*
Ga0126377_100552961	3300010362	Tropical Forest Soil	MALHDTYIVWNWELSALLLLVVVVLILGAAALIKYLFFR*
Ga0126377_102032341	3300010362	Tropical Forest Soil	TYIVWNWELSALLLLVVVVLILGAAALIKYLFFR*
Ga0126377_107498192	3300010362	Tropical Forest Soil	MALHDTYIVWNWELSAILLLVVIVLILGAAALIKYLFFR*
Ga0126377_124532961	3300010362	Tropical Forest Soil	MALHDTYFVWSWELHLIVLLVIVVLVLSAAALVKYLFFR*
Ga0134122_1000124020	3300010400	Terrestrial Soil	MTAQMALHDTYIVWNWELSAILLLVVVVLILGAAALIKYLFFR*
Ga0134121_131199151	3300010401	Terrestrial Soil	MIAQMALHDTYIVWTWELSAILLLVVIVLILSAAALIKYLFF
Ga0137463_10501532	3300011444	Soil	MADIMLHDTYIVWNWALSLTVPLAVIVLILGAAALIKYLFFR*
Ga0137389_102112683	3300012096	Vadose Zone Soil	MADIMLHDTYIVSNWALSLIVLLAVIVLVLGAAALIKYLFFR*
Ga0137364_101787682	3300012198	Vadose Zone Soil	MVFHDTYIVWNWALSLFLLLALIVLILGAAALVKYLFFR*
Ga0137382_101556491	3300012200	Vadose Zone Soil	VADMVFHDTYVVWNWALSLFLLLALIVLILGAAALVKYLFFR*
Ga0137399_115715951	3300012203	Vadose Zone Soil	MADITLHDTYFVWNWVLSLILLLAVIVLVLGAAALIKYLFFR*
Ga0137362_101093782	3300012205	Vadose Zone Soil	MVFHDTYIAWNWALSLFLLLALIVLILGAAALVKYLFFR*
Ga0137376_102843071	3300012208	Vadose Zone Soil	VADMVFHDTYIVWNWALSLFLLLALIVLILGAAALVKYLFFR*
Ga0137385_102624222	3300012359	Vadose Zone Soil	VADMVFHDTYVVWNWALSLFLLLALIMLILGAAALVKYLFFR*
Ga0137397_101434492	3300012685	Vadose Zone Soil	VIADIMLHDTYIVWNWALSLIVLLAVIVLVLGAAALIKYLFFR*
Ga0137396_102743761	3300012918	Vadose Zone Soil	MADITLHDTDFVWNWVLSLILLLAVIVLVLGAAALIKYLFFR*
Ga0137419_104476351	3300012925	Vadose Zone Soil	MADITIHDTYFVWNWVLSLILLLAVIVLVLGAAALIKYLFFR*
Ga0137416_112335252	3300012927	Vadose Zone Soil	MADIMLHDTYIVWNWALSLIVLLAVIVLVLGAAALIKYLF
Ga0126375_102794591	3300012948	Tropical Forest Soil	MPDLVMHDTYFVWSWPLNALLLLVTIVLLLAAAALLKYLFFR*
Ga0164300_107616502	3300012951	Soil	MSDIVLHDTYIVWNWGFGLVLLLIVFVLILGAAALIKYLLFR*
Ga0164299_108177923	3300012958	Soil	AMADIALHDTYFVGSWTLGFFFLLVVVVLVLGAAALVKYLVFR*
Ga0126369_106283192	3300012971	Tropical Forest Soil	MPDLALHDTYYVVWHGGISLILLLLVIVLILGAAALIKYLFFR*
Ga0164306_116891801	3300012988	Soil	MADIALHDTYFVGSWSLGFLLLLVVVVLVLGAAAL
Ga0164305_114086122	3300012989	Soil	MADIVLHDTYFVGSWSLGFFFLLVVVVLILSAGALIKYLFSR*
Ga0157378_117523452	3300013297	Miscanthus Rhizosphere	MALHDTYIVWNWELSALLLLVIVVLILGAAALIKYLFF
Ga0132255_1009985642	3300015374	Arabidopsis Rhizosphere	MIAQMALHGTYIVWNWELSAILLLVVVVLILRAAALIKYLFF*
Ga0184620_101145092	3300018051	Groundwater Sediment	MADIMLHDTYIVWNWALSLILLLAVIVLILGAAALIKYLFFR
Ga0187894_100249663	3300019360	Microbial Mat On Rocks	MTNLALHDTYIVWNWALGSIVLLVVLVLILSAAALIKYLFWR
Ga0137408_10017384	3300019789	Vadose Zone Soil	MADIMLHDTYIVWNWALSLIVLLAVIVLVLGAAALIKYLFFR
Ga0210401_100073809	3300020583	Soil	MVFHDTYIVWNWAPSLFLLLALIVLILGAAALVKYLFFR
Ga0126371_130047052	3300021560	Tropical Forest Soil	MPDLALHDTYYVVWHGGISLILLLLVIVLILGAAALIKYLFFR
Ga0179589_104208372	3300024288	Vadose Zone Soil	MADIALHDTYFVGSWSLGFLLLLVVVVLVLGAAALVKYLFFR
Ga0179591_12008513	3300024347	Vadose Zone Soil	MVFHDTYVVWNWALSLFLLLALIVLILGAAALVKYLFFR
Ga0207685_100954512	3300025905	Corn, Switchgrass And Miscanthus Rhizosphere	MADITLHDTYFVLSWSLGFFFLLVVVVLVLGAAALVKYLVFR
Ga0207687_102435843	3300025927	Miscanthus Rhizosphere	MADIFLHDTYIVWSWTLSLILLLAVIVLVLGAAALIKYLFFR
Ga0207689_102515942	3300025942	Miscanthus Rhizosphere	MADIFLHDTYIVWNWALSLILLLAVIVLVLGAAALIKYLFFR
Ga0207712_101374353	3300025961	Switchgrass Rhizosphere	MADIFLHDTYIVWSWTLSLILQLAVIVLVLGAAALIKYLFFR
Ga0207712_115836211	3300025961	Switchgrass Rhizosphere	QMALHDTYIVWNWELSALLLLVIVVLILGAAALIKYLFFR
Ga0207678_101411392	3300026067	Corn Rhizosphere	MALHDTYIVWTWELSAILLLVVIVLILSAAALIKYLFFR
Ga0257179_10241492	3300026371	Soil	MADIMLHDTYIVWNWAFSLIVLLAVIVLVLGAAALIKYLFFR
Ga0179593_11203085	3300026555	Vadose Zone Soil	MRGAMAGMMLHDTYIVWSWALSLILLLVVVVLILGAAALIKYLFFR
Ga0209466_10356631	3300027646	Tropical Forest Soil	MPDLVMHDTYFVWSWPLNALLVLVTIVLLLAAAALIKYLFFR
Ga0209813_100018452	3300027866	Populus Endosphere	MPDIALHDTYFVWSWSVGFLFLLVVVVLLLGAAALVKYLFFR
Ga0209813_100051132	3300027866	Populus Endosphere	MLPDTYIVWNWALASIPPLAVIVLVLGAAALVKFLIWR
Ga0209488_103272762	3300027903	Vadose Zone Soil	MVFHDTYVVWNWALSLFLLLALIVLILGAAALVKYLFFW
Ga0207428_100564664	3300027907	Populus Rhizosphere	MPDLVMHDTYFVWSWALNAIVVLVIIVLLLAAAALIKYLFFR
Ga0207428_101135432	3300027907	Populus Rhizosphere	MALHDTYFVWQWELHLLVLLLIVVLVLGAAALIKYLFFK
Ga0207428_104642152	3300027907	Populus Rhizosphere	MIAQMALHDTYIVWTWELSAILLLMVIVLILGAAALIKYLFFR
Ga0209382_104785882	3300027909	Populus Rhizosphere	MNAQMALHDTYIVWNWGLSAILLLVVVVLILGAAALIKYLFFR
Ga0209853_11201432	3300027961	Groundwater Sand	MPDLVMHDTYFVWSWALNAILVLVIVVLLLGAAALIKFLFFR
Ga0307503_101261203	3300028802	Soil	VADLVLHDTYIVWNWALDLILLLALIVLILGAAALVKYLFFR
Ga0307469_104358661	3300031720	Hardwood Forest Soil	MNAQMALHDTYIVWNWELSAILLLVVVVLILGAAALIKYLFFR
Ga0307469_118312641	3300031720	Hardwood Forest Soil	RCLVPDIVLHDTYIVWNWTLSLFLLLALIVLILGAAALVKYLFFR
Ga0307468_1000358522	3300031740	Hardwood Forest Soil	MALHDTYIVWNWELSALLLLVIVVLILGAAALIKYLFFR
Ga0307468_1001410551	3300031740	Hardwood Forest Soil	MNAQMALHDTYIVWSWELSAILLLVVVVLILGAAALIKYLFFR
Ga0307407_104602782	3300031903	Rhizosphere	MPDLVVHDTYVAWNWALGATLLLFITVLLLGAAALVKYLFFR
Ga0310900_117235642	3300031908	Soil	MSDIVLHDTYIVWNWGFGLVLLLIVLVLILGAAALIKYLLFR
Ga0307472_1021432501	3300032205	Hardwood Forest Soil	VPDIVLHDTYIVWNWTLSLFLLLALIVLILGAAALVKYLFFR
Ga0373948_0007992_757_888	3300034817	Rhizosphere Soil	MIAQMALHDTYIVWTWELSAILLLVVIVLILSAAALIKYLFFR

Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome / Metatranscriptome Family F062226

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Gene Neighborhood

Neighboring Pfam domains

Neighboring Clusters of Orthologous Genes (COGs)

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences