| Basic Information | |
|---|---|
| Family ID | F062225 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 131 |
| Average Sequence Length | 53 residues |
| Representative Sequence | MRQIRKRRHGSGRRQPAPLPADARDPDIVHAHRVARRRQSRDHAPAGPARGRR |
| Number of Associated Samples | 113 |
| Number of Associated Scaffolds | 131 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 93.89 % |
| % of genes near scaffold ends (potentially truncated) | 20.61 % |
| % of genes from short scaffolds (< 2000 bps) | 76.34 % |
| Associated GOLD sequencing projects | 102 |
| AlphaFold2 3D model prediction | No |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (67.176 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere (18.321 % of family members) |
| Environment Ontology (ENVO) | Unclassified (34.351 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (52.672 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 16.98% β-sheet: 0.00% Coil/Unstructured: 83.02% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 131 Family Scaffolds |
|---|---|---|
| PF02467 | Whib | 54.96 |
| PF04055 | Radical_SAM | 10.69 |
| PF01938 | TRAM | 4.58 |
| PF00196 | GerE | 3.82 |
| PF13401 | AAA_22 | 2.29 |
| PF01966 | HD | 0.76 |
| PF12697 | Abhydrolase_6 | 0.76 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 67.18 % |
| Unclassified | root | N/A | 32.82 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2170459010|GIO7OMY02GKSWN | Not Available | 521 | Open in IMG/M |
| 2199352025|deepsgr__Contig_182169 | All Organisms → cellular organisms → Bacteria | 546 | Open in IMG/M |
| 3300000156|NODE_c0631329 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1962 | Open in IMG/M |
| 3300001867|JGI12627J18819_10420781 | Not Available | 545 | Open in IMG/M |
| 3300005164|Ga0066815_10001659 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1915 | Open in IMG/M |
| 3300005166|Ga0066674_10155600 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1080 | Open in IMG/M |
| 3300005169|Ga0066810_10007868 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1490 | Open in IMG/M |
| 3300005171|Ga0066677_10255244 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 996 | Open in IMG/M |
| 3300005177|Ga0066690_10772169 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 628 | Open in IMG/M |
| 3300005328|Ga0070676_10775581 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 706 | Open in IMG/M |
| 3300005332|Ga0066388_100804059 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1532 | Open in IMG/M |
| 3300005332|Ga0066388_101938379 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1053 | Open in IMG/M |
| 3300005332|Ga0066388_102978158 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 865 | Open in IMG/M |
| 3300005334|Ga0068869_100393303 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1138 | Open in IMG/M |
| 3300005336|Ga0070680_100123837 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 2159 | Open in IMG/M |
| 3300005338|Ga0068868_100349796 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1265 | Open in IMG/M |
| 3300005344|Ga0070661_100251935 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1363 | Open in IMG/M |
| 3300005356|Ga0070674_100392491 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1132 | Open in IMG/M |
| 3300005367|Ga0070667_100064092 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 3117 | Open in IMG/M |
| 3300005434|Ga0070709_10039622 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2892 | Open in IMG/M |
| 3300005434|Ga0070709_10453572 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 966 | Open in IMG/M |
| 3300005434|Ga0070709_11225813 | Not Available | 603 | Open in IMG/M |
| 3300005435|Ga0070714_100905711 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 856 | Open in IMG/M |
| 3300005436|Ga0070713_100306819 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1463 | Open in IMG/M |
| 3300005437|Ga0070710_10264401 | All Organisms → cellular organisms → Bacteria | 1110 | Open in IMG/M |
| 3300005437|Ga0070710_10302392 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1044 | Open in IMG/M |
| 3300005437|Ga0070710_10661101 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales → Paenibacillaceae → Cohnella | 733 | Open in IMG/M |
| 3300005438|Ga0070701_10088626 | Not Available | 1690 | Open in IMG/M |
| 3300005445|Ga0070708_100029663 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 4719 | Open in IMG/M |
| 3300005445|Ga0070708_100039764 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 4117 | Open in IMG/M |
| 3300005467|Ga0070706_100643160 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 985 | Open in IMG/M |
| 3300005468|Ga0070707_100677747 | Not Available | 994 | Open in IMG/M |
| 3300005471|Ga0070698_100486455 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1171 | Open in IMG/M |
| 3300005471|Ga0070698_101348945 | All Organisms → cellular organisms → Bacteria | 664 | Open in IMG/M |
| 3300005543|Ga0070672_101237366 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 666 | Open in IMG/M |
| 3300005561|Ga0066699_10575421 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 808 | Open in IMG/M |
| 3300005569|Ga0066705_10202643 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1243 | Open in IMG/M |
| 3300005598|Ga0066706_11184830 | Not Available | 581 | Open in IMG/M |
| 3300005616|Ga0068852_100381115 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1383 | Open in IMG/M |
| 3300005617|Ga0068859_100108903 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2831 | Open in IMG/M |
| 3300005764|Ga0066903_101736362 | Not Available | 1190 | Open in IMG/M |
| 3300005834|Ga0068851_10032587 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2593 | Open in IMG/M |
| 3300005843|Ga0068860_100948481 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 877 | Open in IMG/M |
| 3300006028|Ga0070717_11225997 | Not Available | 683 | Open in IMG/M |
| 3300006163|Ga0070715_10209899 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 995 | Open in IMG/M |
| 3300006175|Ga0070712_100130004 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1907 | Open in IMG/M |
| 3300006237|Ga0097621_100199693 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1735 | Open in IMG/M |
| 3300006603|Ga0074064_11798183 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1082 | Open in IMG/M |
| 3300006755|Ga0079222_10958269 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes | 728 | Open in IMG/M |
| 3300006804|Ga0079221_10295487 | Not Available | 947 | Open in IMG/M |
| 3300006804|Ga0079221_10315472 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 925 | Open in IMG/M |
| 3300006806|Ga0079220_10588367 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 787 | Open in IMG/M |
| 3300006852|Ga0075433_11517794 | Not Available | 579 | Open in IMG/M |
| 3300006903|Ga0075426_11198758 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 576 | Open in IMG/M |
| 3300006914|Ga0075436_100233567 | Not Available | 1307 | Open in IMG/M |
| 3300006914|Ga0075436_100586106 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 821 | Open in IMG/M |
| 3300006954|Ga0079219_10081446 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1522 | Open in IMG/M |
| 3300006954|Ga0079219_11047530 | Not Available | 684 | Open in IMG/M |
| 3300006954|Ga0079219_11775273 | Not Available | 576 | Open in IMG/M |
| 3300006954|Ga0079219_11868909 | Not Available | 565 | Open in IMG/M |
| 3300009176|Ga0105242_10038096 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae | 3864 | Open in IMG/M |
| 3300009176|Ga0105242_10104305 | Not Available | 2407 | Open in IMG/M |
| 3300009545|Ga0105237_11842673 | Not Available | 613 | Open in IMG/M |
| 3300009792|Ga0126374_10059487 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1987 | Open in IMG/M |
| 3300010043|Ga0126380_10171272 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1418 | Open in IMG/M |
| 3300010359|Ga0126376_10075388 | Not Available | 2486 | Open in IMG/M |
| 3300010360|Ga0126372_10045263 | Not Available | 2924 | Open in IMG/M |
| 3300010362|Ga0126377_11446640 | All Organisms → cellular organisms → Bacteria | 760 | Open in IMG/M |
| 3300010396|Ga0134126_11085307 | All Organisms → cellular organisms → Bacteria | 893 | Open in IMG/M |
| 3300012198|Ga0137364_10994736 | Not Available | 634 | Open in IMG/M |
| 3300012199|Ga0137383_10084096 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2302 | Open in IMG/M |
| 3300012210|Ga0137378_10749672 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 888 | Open in IMG/M |
| 3300012502|Ga0157347_1057637 | All Organisms → cellular organisms → Bacteria | 549 | Open in IMG/M |
| 3300012683|Ga0137398_10532898 | Not Available | 809 | Open in IMG/M |
| 3300012915|Ga0157302_10017539 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1771 | Open in IMG/M |
| 3300012944|Ga0137410_10812208 | Not Available | 786 | Open in IMG/M |
| 3300013100|Ga0157373_10088490 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2181 | Open in IMG/M |
| 3300013100|Ga0157373_11209727 | Not Available | 570 | Open in IMG/M |
| 3300014968|Ga0157379_10589835 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1037 | Open in IMG/M |
| 3300015371|Ga0132258_11270445 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1861 | Open in IMG/M |
| 3300015373|Ga0132257_100694579 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1264 | Open in IMG/M |
| 3300015374|Ga0132255_100115074 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3683 | Open in IMG/M |
| 3300016294|Ga0182041_10813164 | Not Available | 836 | Open in IMG/M |
| 3300017792|Ga0163161_10728447 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 828 | Open in IMG/M |
| 3300018431|Ga0066655_10078546 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1790 | Open in IMG/M |
| 3300018433|Ga0066667_10795243 | Not Available | 803 | Open in IMG/M |
| 3300018482|Ga0066669_11078092 | Not Available | 725 | Open in IMG/M |
| 3300020002|Ga0193730_1078421 | Not Available | 935 | Open in IMG/M |
| 3300020070|Ga0206356_10719367 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2116 | Open in IMG/M |
| 3300020081|Ga0206354_10733345 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1648 | Open in IMG/M |
| 3300020579|Ga0210407_10054225 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2996 | Open in IMG/M |
| 3300021088|Ga0210404_10139959 | Not Available | 1260 | Open in IMG/M |
| 3300021178|Ga0210408_10018929 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 5521 | Open in IMG/M |
| 3300021403|Ga0210397_10086434 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2089 | Open in IMG/M |
| 3300021404|Ga0210389_11362032 | Not Available | 542 | Open in IMG/M |
| 3300021445|Ga0182009_10278626 | Not Available | 837 | Open in IMG/M |
| 3300021475|Ga0210392_10113308 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1804 | Open in IMG/M |
| 3300021479|Ga0210410_11067683 | Not Available | 697 | Open in IMG/M |
| 3300021560|Ga0126371_11657665 | Not Available | 764 | Open in IMG/M |
| 3300024347|Ga0179591_1135045 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2635 | Open in IMG/M |
| 3300024347|Ga0179591_1157866 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 3339 | Open in IMG/M |
| 3300025898|Ga0207692_10396319 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 860 | Open in IMG/M |
| 3300025906|Ga0207699_10110307 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1762 | Open in IMG/M |
| 3300025909|Ga0207705_10332608 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1168 | Open in IMG/M |
| 3300025910|Ga0207684_10234503 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → environmental samples → uncultured Corynebacteriales bacterium | 1583 | Open in IMG/M |
| 3300025910|Ga0207684_10264729 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1483 | Open in IMG/M |
| 3300025915|Ga0207693_10949232 | Not Available | 658 | Open in IMG/M |
| 3300025922|Ga0207646_10046934 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3875 | Open in IMG/M |
| 3300025928|Ga0207700_12044860 | Not Available | 500 | Open in IMG/M |
| 3300025929|Ga0207664_11281550 | Not Available | 652 | Open in IMG/M |
| 3300025940|Ga0207691_10020582 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 6238 | Open in IMG/M |
| 3300025942|Ga0207689_10016328 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 6289 | Open in IMG/M |
| 3300025945|Ga0207679_10373521 | Not Available | 1248 | Open in IMG/M |
| 3300026498|Ga0257156_1007972 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1990 | Open in IMG/M |
| 3300026557|Ga0179587_10693511 | Not Available | 671 | Open in IMG/M |
| 3300026899|Ga0209326_1007955 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 795 | Open in IMG/M |
| 3300027725|Ga0209178_1085892 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1038 | Open in IMG/M |
| 3300028715|Ga0307313_10035037 | Not Available | 1432 | Open in IMG/M |
| 3300028768|Ga0307280_10221704 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 673 | Open in IMG/M |
| 3300028784|Ga0307282_10002041 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 7258 | Open in IMG/M |
| 3300028881|Ga0307277_10028811 | Not Available | 2203 | Open in IMG/M |
| 3300031723|Ga0318493_10030243 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2457 | Open in IMG/M |
| 3300031893|Ga0318536_10354131 | Not Available | 743 | Open in IMG/M |
| 3300032770|Ga0335085_10044374 | All Organisms → cellular organisms → Bacteria | 6065 | Open in IMG/M |
| 3300032770|Ga0335085_10149018 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2938 | Open in IMG/M |
| 3300032782|Ga0335082_10052061 | Not Available | 4229 | Open in IMG/M |
| 3300032783|Ga0335079_10137333 | Not Available | 2750 | Open in IMG/M |
| 3300032805|Ga0335078_10686947 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1271 | Open in IMG/M |
| 3300032955|Ga0335076_10160366 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2162 | Open in IMG/M |
| 3300033475|Ga0310811_11331584 | Not Available | 566 | Open in IMG/M |
| 3300034817|Ga0373948_0208512 | Not Available | 513 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 18.32% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 7.63% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 6.87% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 6.11% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 5.34% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 4.58% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 4.58% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.82% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 3.82% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 3.05% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 3.05% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 3.05% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.29% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 2.29% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 2.29% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 2.29% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 1.53% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 1.53% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 1.53% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.53% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.53% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.53% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.53% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.76% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 0.76% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.76% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.76% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.76% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.76% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Unclassified → Arabidopsis Rhizosphere | 0.76% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.76% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.76% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.76% |
| Rhizosphere Soil | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere Soil | 0.76% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.76% |
| Sugar Cane Bagasse Incubating Bioreactor | Engineered → Solid Waste → Grass → Composting → Bioreactor → Sugar Cane Bagasse Incubating Bioreactor | 0.76% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2170459010 | Grass soil microbial communities from Rothamsted Park, UK - December 2009 direct MP BIO1O1 lysis 0-9cm (no DNA from 10 to 21cm!!!) | Environmental | Open in IMG/M |
| 2199352025 | Soil microbial communities from Rothamsted, UK, for project Deep Soil - DEEP SOIL | Environmental | Open in IMG/M |
| 3300000156 | Sugar cane bagasse incubating bioreactor microbial communities from Sao Carlos, Brazil, that are aerobic and semianaerobic | Engineered | Open in IMG/M |
| 3300001867 | Texas A ecozone_OM1H0_M2 (Combined assembly for Texas A ecozone Site metagenome samples, ASSEMBLY_DATE=20130705) | Environmental | Open in IMG/M |
| 3300005164 | Soil and rhizosphere microbial communities from Laval, Canada - mgLAC | Environmental | Open in IMG/M |
| 3300005166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123 | Environmental | Open in IMG/M |
| 3300005169 | Soil and rhizosphere microbial communities from Laval, Canada - mgHPA | Environmental | Open in IMG/M |
| 3300005171 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 | Environmental | Open in IMG/M |
| 3300005177 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 | Environmental | Open in IMG/M |
| 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Host-Associated | Open in IMG/M |
| 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Environmental | Open in IMG/M |
| 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Host-Associated | Open in IMG/M |
| 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
| 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
| 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
| 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Environmental | Open in IMG/M |
| 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
| 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 | Environmental | Open in IMG/M |
| 3300005569 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 | Environmental | Open in IMG/M |
| 3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
| 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Host-Associated | Open in IMG/M |
| 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Host-Associated | Open in IMG/M |
| 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) | Host-Associated | Open in IMG/M |
| 3300006603 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMC (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
| 3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012502 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 | Host-Associated | Open in IMG/M |
| 3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
| 3300012915 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S103-311B-2 | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Host-Associated | Open in IMG/M |
| 3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300020002 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1a1 | Environmental | Open in IMG/M |
| 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
| 3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
| 3300021445 | Bulk soil microbial communities from the field in Mead, Nebraska, USA - 072115-187_1 MetaG | Environmental | Open in IMG/M |
| 3300021475 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300024347 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026498 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NI-49-A | Environmental | Open in IMG/M |
| 3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300026899 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM1H0_O3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027725 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 (SPAdes) | Environmental | Open in IMG/M |
| 3300028715 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_203 | Environmental | Open in IMG/M |
| 3300028768 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_119 | Environmental | Open in IMG/M |
| 3300028784 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_121 | Environmental | Open in IMG/M |
| 3300028881 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_116 | Environmental | Open in IMG/M |
| 3300031723 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23 | Environmental | Open in IMG/M |
| 3300031893 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f28 | Environmental | Open in IMG/M |
| 3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
| 3300032782 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1 | Environmental | Open in IMG/M |
| 3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
| 3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
| 3300032955 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5 | Environmental | Open in IMG/M |
| 3300033475 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YC | Environmental | Open in IMG/M |
| 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Host-Associated | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| F62_00063850 | 2170459010 | Grass Soil | MRQIRKRRHGSGRPQPAPLPADARDPDIVHAHRVARRHQSRDHAPAGPARGRR |
| deepsgr_03117360 | 2199352025 | Soil | GCLRSVPSVPTTASEGDPLMRQIRKRRHGSSRRHTAPLPADARDPDIVHAHQVARRQSRDHAPAGPARGRR |
| NODE_06313291 | 3300000156 | Sugar Cane Bagasse Incubating Bioreactor | MRQIHKSKRRPGSGRRQPTPLPADARDPDIVHAHRVASRRQSRDHAPARPARSRR* |
| JGI12627J18819_104207812 | 3300001867 | Forest Soil | MRQIYKSKRRPGSGWRQPTPLPADARDPDIVHAHRVARRRRSRDHAP |
| Ga0066815_100016591 | 3300005164 | Soil | MRQVRKRRHGSGRGQPAPLPADARDPDIVHAHRVARRQSRDHAPAGPARGRR* |
| Ga0066674_101556002 | 3300005166 | Soil | MRQIHKTRRRHGPGRGQPGPLPADARDPDIVHAHRVARRQQSRDHAPAGPARGRR* |
| Ga0066810_100078683 | 3300005169 | Soil | MRQVRKRRHGSGRGQHAPLPADARDPDIVHAHRVARRQSRDHAPAGPARGRR* |
| Ga0066677_102552442 | 3300005171 | Soil | MRQIHKTRRRHGPGRGQPGPLPADARDPDVVHAHRVARRQQSRDHAPAGPARGRR* |
| Ga0066690_107721692 | 3300005177 | Soil | MRQIQMSKRRHGSARRQPAPLPDDARDPDIVHAHRVARRPQSRDHGPARPARGR* |
| Ga0070676_107755811 | 3300005328 | Miscanthus Rhizosphere | MRQIRKRRHGSGRQQPAPLPADARDPDIVHAHRVARRQSRDHAPAGPARGRR* |
| Ga0066388_1008040592 | 3300005332 | Tropical Forest Soil | MRQIYKSKRRLGSGRRQPTLLPADARDPDIVHAHRVARRRQSRDHAPARPARGRR* |
| Ga0066388_1019383792 | 3300005332 | Tropical Forest Soil | MRQIRKRRHGSGPRQPEPLAADARDPDIVHAHRVARRGQSRDHAPA |
| Ga0066388_1029781583 | 3300005332 | Tropical Forest Soil | MRQIYKSKRRPGSGRRQPTPLPADARDPDIVHAHRVARRGQSRDHAPARPARGRR* |
| Ga0068869_1003933032 | 3300005334 | Miscanthus Rhizosphere | MRQIRKRRHGSGRPQPAPLPADARDPDIVHAHRVARRLQSRDHAPAGPARGRR* |
| Ga0070680_1001238373 | 3300005336 | Corn Rhizosphere | MRQIRKRRHGSGRPQPELLSADARDPDIVHAHRVARRGQSRDHAPAGPARGRR* |
| Ga0068868_1003497962 | 3300005338 | Miscanthus Rhizosphere | MRQIRKRRHGSGRPQPALLPTDARDPDIVHAHRVARRGQSRDHAPAGPARGRR* |
| Ga0070661_1002519352 | 3300005344 | Corn Rhizosphere | MRQIRKRRHGSGRPQPAPLPADARDPDIVHAHRVARRGQSRDHAPAGPARGRR* |
| Ga0070674_1003924911 | 3300005356 | Miscanthus Rhizosphere | MRQIRKRRHGSGRPQPAPLPADARDPDIVHAHRVARRHQSRDHAPAGPARGRR* |
| Ga0070667_1000640921 | 3300005367 | Switchgrass Rhizosphere | MRQIRKRRHGSGRPQPELLPADARDPDIVHAHRVARRGQSRDHAPAGPARGRR* |
| Ga0070709_100396222 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | MRQIQKGKRRHGPGRGQPGPLPADARDPDIVHAHRVARRQQSRDHAPAGSARGRR* |
| Ga0070709_104535723 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | SEGDPLMRQIRKRRHGSGRPQPAPLPADARDPDIVHAHRVARRLQSRDHAPAGPARGRR* |
| Ga0070709_112258131 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | TTASEGDPLMRQIRKRRHGSGRPQPAPLPADARDPDIVHAHRVARRHQSRDRAPARPARGRR* |
| Ga0070714_1009057112 | 3300005435 | Agricultural Soil | MRQIQKSKRRHGPGRGQPGPLPADARDPDIVHAHRVARRQQSRDHAPAGP |
| Ga0070713_1003068192 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | MRQIHKTKRHHGPGRRQPMPLPADARDPDIVHAHRVARRRQFRDPAPARPARGGR* |
| Ga0070710_102644012 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | MRQIRKRRHGSGRPQPAPLPADARDPDIVHAHRVGRRLQSRDHAPAGPARGRR* |
| Ga0070710_103023922 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | MRQIRKRRHGSGRPQPAPLPADARDPDIVYAHRVARRHQSRDHAPARPARGRR* |
| Ga0070710_106611011 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | MRQIHKTRRRHGPGRGQPGPLPADARDPDIVHAHRVARRQQSRDHAPAGPARG |
| Ga0070701_100886263 | 3300005438 | Corn, Switchgrass And Miscanthus Rhizosphere | MRQIRKRRHGSGRPQPALLPADARDPDIVHAHRVARRGQSRDHAPAGPARGRR* |
| Ga0070708_1000296632 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MRQVHKSKRHHGQGGRQPAPLPADARDPDIVHAHRVARRQRSRDHAPAGQARGRR* |
| Ga0070708_1000397642 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MRQIHKTKRHHGPGRRQPMPLPADARDPDIVHAHRVARRRQFRDPAPARPTRGGR* |
| Ga0070706_1006431602 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | MRQVRKRRHGSVRRQPDPLPADARDPDIVHAHRVARRQSRDHAPAGPARGRR* |
| Ga0070707_1006777471 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | MRQIHKTRRRHGPGRGQPAPLPADARDPDIVHAHQVARRQQSRDHAPAGPGRGRR* |
| Ga0070698_1004864552 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | MRQIHKTKRHHGPGRREPMPLPADARDPDIVHAHRVARRRQFRDPAPARPTRGGR* |
| Ga0070698_1013489451 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | MRQIRKRRHGSGRPQPAPLPADARDPDIVHAHRVARRGQSRDHAPAG |
| Ga0070672_1012373661 | 3300005543 | Miscanthus Rhizosphere | PLMRQIRKRRHGSGRPQPAPLPADARDPDIVHAHRVARRLQSRDHAPAGPARGRR* |
| Ga0066699_105754212 | 3300005561 | Soil | MSKRRHGSARRQPAPLPDDARDPDIVHAHRVARRPQSRDHGPARPARGR* |
| Ga0066705_102026433 | 3300005569 | Soil | MRQIHKTRRRHGPGRGQPGPLPADARDPDIVRAHRVARRQQSRDHAPAGPARGRR* |
| Ga0066706_111848301 | 3300005598 | Soil | MRQSYKSKRRHGSGRGQPMPLPADARDPDIVHAHRVARRQQSRDHAPAGPARGRR* |
| Ga0068852_1003811153 | 3300005616 | Corn Rhizosphere | MRQIRKRRHGSGRPQPELLPADARDPDIVHAHRVARRGQSRDHAPAGLARGRR* |
| Ga0068859_1001089032 | 3300005617 | Switchgrass Rhizosphere | MRQIRKRRHGSGRQQPAPLPADARDPDIVHAHRVARRQSRDHAAAGPARGRR* |
| Ga0066903_1017363622 | 3300005764 | Tropical Forest Soil | MRQIYKSKRRPGSGRRQPTLLPADARDPDIVHAHRVARRRQSRDHAPARPARGRR* |
| Ga0068851_100325874 | 3300005834 | Corn Rhizosphere | MRQIRKRRHGSGRPQPAPLPADARDPDIVHAHRVARRGQSRDHAPAGLARGRR* |
| Ga0068860_1009484812 | 3300005843 | Switchgrass Rhizosphere | MRQIRKRRHGSGRPQPAPLPADARDPDIVHAHRVARRFQSRDHAPAGPARGRR* |
| Ga0070717_112259971 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MRQIHKNKSRHGSGRRDPSPLPADARDPDIVHAHRVARRRQSRDHTSARPARGRR* |
| Ga0070715_102098992 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | MRQIQKGKRRHGPGRGQPGPLPADARDPDIVHAHQVARRQQSRDHAPAGPGRGRR* |
| Ga0070712_1001300041 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | MRQIQKSKRRHGPGRGQPGPLPADARDPDIVHAHRVARRQQSRDHAPAGPARGRR* |
| Ga0097621_1001996933 | 3300006237 | Miscanthus Rhizosphere | MRQIRKRRHGSGRPQPELLPADARDPDIVHAHLVARRGQSRDHAPAGPARGRR* |
| Ga0074064_117981833 | 3300006603 | Soil | MRQIRKRRHGSGRPQPAPLPADARDPDIVHAHRVARRQQSRDHAPAGPARGRR* |
| Ga0079222_109582691 | 3300006755 | Agricultural Soil | MRQIYKSKRRPGSGWRQPTPLPADARDPDIVHAHRVARRRRSRDHAPARPARGRW* |
| Ga0079221_102954873 | 3300006804 | Agricultural Soil | MRQVRKRRHGSGRRQPVPLPADARDPDIVHAHRVARRQSRDHAPAGPARGRR* |
| Ga0079221_103154723 | 3300006804 | Agricultural Soil | MRQIRKRRHGSGRPQPEPLPADARDPDIVHAHRVARRHQSRDHAPAAPARGRR* |
| Ga0079220_105883671 | 3300006806 | Agricultural Soil | MRQIRKRRHGSGRPQPAPLPADARDPDIVHARRVARRLQSRDHAPAGPARGRR* |
| Ga0075433_115177942 | 3300006852 | Populus Rhizosphere | MRQIRKRRHGSGRPQPAPLPADARDPDIVHAHRVARRLQARDHAPAGPARGRR* |
| Ga0075426_111987581 | 3300006903 | Populus Rhizosphere | KRRHGSGRPQPAPLPADARDPDIVHAHRVARRGQSRDHAPAGPARGRR* |
| Ga0075436_1002335673 | 3300006914 | Populus Rhizosphere | MRQIYKSKRRPGSGRRQPTPLPADARDPDIVHAHRVARRQRSRDHAPARPARGRR* |
| Ga0075436_1005861061 | 3300006914 | Populus Rhizosphere | MRQIRKRRHGSGRPQPELLPTDARDPDIVHAHRVARRGQSRDHAPAGPARGRR* |
| Ga0079219_100814461 | 3300006954 | Agricultural Soil | MRQIRKRRHGSGRPQPEPLPADARDPDIVHAHRVARRHQSRDHAPAGPARGRR* |
| Ga0079219_110475302 | 3300006954 | Agricultural Soil | MRQIRKRRHGSGRQQPAPLPADARDPDIVHAHRLARRQSRDHAPAGPARGRR* |
| Ga0079219_117752732 | 3300006954 | Agricultural Soil | MRQVRKRRHGSGRPQPAPLPADARDPDIVHAHRVARRLQSRDHAPAGSARGRR* |
| Ga0079219_118689091 | 3300006954 | Agricultural Soil | MRQIRKRRHGSGRPQPAPLPADARDPDIVHAHRVARRDQSRDHAPAGPARGRR* |
| Ga0105242_100380961 | 3300009176 | Miscanthus Rhizosphere | MRQIRKRRHGSGRPQPELLPADARDPDIVHAHRVARRGQSRDQAPAGPVRGRR* |
| Ga0105242_101043054 | 3300009176 | Miscanthus Rhizosphere | MRQIRKRRHGSGRPQPAPLPADARDPDIVHAHRVARRHQYRDHAPARPARGRR* |
| Ga0105237_118426731 | 3300009545 | Corn Rhizosphere | MRQIRKRRHGSVRRQPDPLPADARDPDIVHAHRVARRQSRDHAP |
| Ga0126374_100594872 | 3300009792 | Tropical Forest Soil | MRQIRKRRHGSGPRQPEPLPADARDPDIVHAHRVARRGQSRDHAPAGLARGRR* |
| Ga0126380_101712723 | 3300010043 | Tropical Forest Soil | MRQIRKRRHGSGPRQPEPLAADARDPDIVHAHRVARRGQSRDHAPAGPARGRR* |
| Ga0126376_100753882 | 3300010359 | Tropical Forest Soil | MRQIRKRRHGSGRPQPELLPADARDPDIVRAHRVARRGQSRDHAPAGPARGRR* |
| Ga0126372_100452632 | 3300010360 | Tropical Forest Soil | MRQIRKRRHGSGPRQPEPLPADARDPDIVHAHRVARRGQSRDHAPTGPARGRR* |
| Ga0126377_114466402 | 3300010362 | Tropical Forest Soil | MRQIRKRRHGSGPRQPEPLPADARDPDIVHAHRVARRGQSRDHAPAGPARGRR* |
| Ga0134126_110853072 | 3300010396 | Terrestrial Soil | MRQIRKRRHGSGLRQPAPLPADARDPDIVHAHRVARRQPRDHAPAGP |
| Ga0137364_109947362 | 3300012198 | Vadose Zone Soil | MRQIRKRRHGSGRPQPAPLPADARDPDIVHAHQVARRHQSRDPAPAGPARGRR* |
| Ga0137383_100840962 | 3300012199 | Vadose Zone Soil | MRQVRKSKRRHGSGRQPAPLPADARDPDIVHAHQVTRRRQSRDRAPARPARSGR* |
| Ga0137378_107496722 | 3300012210 | Vadose Zone Soil | MRQVRKSKRRHGSGRQPAPLPADARDPDIVHAHQVTRRRQSRDRAPA |
| Ga0157347_10576371 | 3300012502 | Arabidopsis Rhizosphere | MRQIRKRRHGSGRPQPAPLPADARDPDIVHAHRVARRLQSRDHAPTGPARGRR* |
| Ga0137398_105328982 | 3300012683 | Vadose Zone Soil | MRQTRKRRHGSGRRQPAPLPADARDPDIVHAHRVARQPQSRDHAPAGPARGRR* |
| Ga0157302_100175393 | 3300012915 | Soil | VHKSKRRHGSGVQPAPLPADARDPDIVHAHQVARRGQSRDHAPAGPARGRR* |
| Ga0137410_108122081 | 3300012944 | Vadose Zone Soil | MRQIQKSKRRHGPARGQPGPLPADARDPDIVHAHRVARRQSRDHSTAGPARGRR* |
| Ga0157373_100884902 | 3300013100 | Corn Rhizosphere | MRQIRKRRHGSGRPQPELLSADARDPDIVHAHRVARRGQSRDHAPAGPVRGRR* |
| Ga0157373_112097272 | 3300013100 | Corn Rhizosphere | MRQIQKSKRRHGPGRGQPGPLPADARDPDIVHAHQVARRQQSRDHAPAGPGR |
| Ga0157379_105898351 | 3300014968 | Switchgrass Rhizosphere | MRQVRKRRHGSVRRQPDPLPADARDPDIVHAHWVARRQSRDHAPAGPARGRR* |
| Ga0132258_112704452 | 3300015371 | Arabidopsis Rhizosphere | MRQIRKRRHGSGRPQPAPLPADARDPDIVHAHRVARRLQSRDHAPAGPARGRG* |
| Ga0132257_1006945792 | 3300015373 | Arabidopsis Rhizosphere | MRQIRKRRHGSGRPQPAPLPADARDPDIVHAHRVARRRQSRDHAPTGPSRGRG* |
| Ga0132255_1001150742 | 3300015374 | Arabidopsis Rhizosphere | MRQIRKRRHGSGRPQPAPLPADARDPDIVHAHRVARRQSRDHAPAGSARGRR* |
| Ga0182041_108131642 | 3300016294 | Soil | MRQIYKSKRRPGSGRRQPTPLPADARDPDIVHAHRMARRRQSRDQVPAGP |
| Ga0163161_107284471 | 3300017792 | Switchgrass Rhizosphere | MRQIRKRRHGSGRPQPAPLPADARDPDIVHAHRVARRHQSRDHAPAR |
| Ga0066655_100785462 | 3300018431 | Grasslands Soil | MRQIRKRRHGSGRPQPAPLPADARDPDIVHAHRVARRGQSRDHAPAGPARGRR |
| Ga0066667_107952432 | 3300018433 | Grasslands Soil | MRQIRKRRHGSGRRQPAPLPADARDPDIVHAHRVARRQQTRDHAPAGPARGHR |
| Ga0066669_110780922 | 3300018482 | Grasslands Soil | MRQIRKRRHGSGRPQPAPLPADARDPDIVHAHRVARRHQSRDHAPAGPARGGR |
| Ga0193730_10784212 | 3300020002 | Soil | MRQIRKRRHGSGLRQPAPLPADARDPDIVHAHRVARRQPRDHAPAGPARGRR |
| Ga0206356_107193672 | 3300020070 | Corn, Switchgrass And Miscanthus Rhizosphere | MRQIRKRRHGSGRPQPAPLPADARDPDIVHAHRVARRGQSRDHAPAGLARGRR |
| Ga0206354_107333453 | 3300020081 | Corn, Switchgrass And Miscanthus Rhizosphere | MRQIRKRRHGSGRPQPAPLPADARDPDIVHAHRVARRLQSRDHAPAGPARGRR |
| Ga0210407_100542252 | 3300020579 | Soil | MRQIHKNKGRHGSGRRDPSPLPADARDPDIVHAHRVARRRQSRDHTSARPARGRR |
| Ga0210404_101399592 | 3300021088 | Soil | MRQIHKTKRHHGPGRRQPTPLPADARDPDIVHAHRVARRRQFRDPAPARPARGGR |
| Ga0210408_100189292 | 3300021178 | Soil | MRQIHKTKRHHGPGRRQPTPLPADARDPDIVHAHRVARRRQFPDPAPARPARGGR |
| Ga0210397_100864342 | 3300021403 | Soil | MRQIYTSKRRRGSDRRQPVPLPADARDPDIVHAHRVARRQQARDHEPAGPARGRR |
| Ga0210389_113620321 | 3300021404 | Soil | MRQIYTSKRRRGSDRRQPVPLPADARDPDIVHAHRVARRQQARDHEPAGPARG |
| Ga0182009_102786262 | 3300021445 | Soil | MRQIRKRRHGSGRPQPAPLPADARDPDIVHAHQVARRGQSRDHAPAGPARGRR |
| Ga0210392_101133082 | 3300021475 | Soil | MRQIRKRRHGSGRSQPAPLPADARDPDIVHAHRVARRHQSRDHAPAGPARGRR |
| Ga0210410_110676832 | 3300021479 | Soil | MRQIHKTKRHHGTGRRQPTPLSADARDPDIVHAHRVARRRQFRDPAPARPARGGR |
| Ga0126371_116576652 | 3300021560 | Tropical Forest Soil | MRQIYKSKRRPGSGRRQPTLLPADARDPDIVHAHRLARRRQSRDHVPARPARGLR |
| Ga0179591_11350453 | 3300024347 | Vadose Zone Soil | MRQIGKRRHGSGRRQPAPLPADARDPDIVHAHRVARRRQSRDHAPAGPARGRR |
| Ga0179591_11578665 | 3300024347 | Vadose Zone Soil | MRQIRKRRHGSGRRQPAPLPADARDPDIVHAHRVARRRQSRDHAPAGPARGRR |
| Ga0207692_103963191 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | MRQIHKTRRRHGPGRGQPGPLPADARDPDIVHAHRVARRQQSRDHAPAGPA |
| Ga0207699_101103073 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | MRQIQKGKRRHGPGRGQPGPLPADARDPDIVHAHRVARRQQSRDHAPAGSARGRR |
| Ga0207705_103326081 | 3300025909 | Corn Rhizosphere | MRQIRKRRHGSGRPQPAPLPADARDPDIVHAHRVARRFQSRDHAPAGPARGRR |
| Ga0207684_102345032 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MRQIHKTRRRHGPGRGQPAPLPADARDPDIVHAHQVARRQQSRDHAPAGPGRGRR |
| Ga0207684_102647292 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MRQIHKTKRHHGPGRRQPMPLPADARDPDIVHAHRVARRRQFRDPAPARPTRGGR |
| Ga0207693_109492322 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | MRQIHKTRRRHGPGRGQPGPLPADARDPDIVHAHRVARRQQSRDHAPA |
| Ga0207646_100469343 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MRQVHKSKRHHGQGGRQPAPLPADARDPDIVHAHRVARRQRSRDHAPAGQARGRR |
| Ga0207700_120448601 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | MRQIHKTKRHHGPGRRQPMPLPADARDPDIVHAHRVARRRQFRDPAPARP |
| Ga0207664_112815501 | 3300025929 | Agricultural Soil | MRQIQKSKRRHGPGRGQPGPLPADARDPDIVHAHRVARRQQSRDHAPAGPAR |
| Ga0207691_100205824 | 3300025940 | Miscanthus Rhizosphere | MRQIRKRRHGSGRPQPALLPTDARDPDIVHAHRVARRGQSRDHAPAGPARGRR |
| Ga0207689_100163283 | 3300025942 | Miscanthus Rhizosphere | MRQIRKRRHGSGRPQPAPLPADARDPDIVHAHRVGRRLQSRDHAPAGPARGRR |
| Ga0207679_103735213 | 3300025945 | Corn Rhizosphere | MRQIRKRRHGSGRPQPELLPADARDPDIVHAHRVARRLQSRDHAPAGPARGRR |
| Ga0257156_10079722 | 3300026498 | Soil | MRQIHKSKRHHGPGRRQPAPLPADARDPDIVHAHRVARRQQSRDHAPAGQARGRR |
| Ga0179587_106935112 | 3300026557 | Vadose Zone Soil | MRQIQKSKRRHGPARGQPGPLPADARDPDIVHAHRVARRQQSRDHAPAGPARG |
| Ga0209326_10079552 | 3300026899 | Forest Soil | MRQIRKRRHGSGRPQPAPLPADARDPDIVHAHRVARRHQSRDHAPARPAR |
| Ga0209178_10858921 | 3300027725 | Agricultural Soil | MRQIRKRRHGSGRPQPEPLPADARDPDIVHAHRVARRHQSRDHAPAAPARGRR |
| Ga0307313_100350373 | 3300028715 | Soil | MRQIRKRRHGWGLRQPAPLPADARDPDIVHAHRVARRQPRDYASAGPARGRR |
| Ga0307280_102217043 | 3300028768 | Soil | DPLMRQIRKRRHGSGLRQPAPLPADARDPDIVHAHRVARRQPRDYASAEPARGRR |
| Ga0307282_100020415 | 3300028784 | Soil | MRQIRKRRHGSGRQQPAPLPADARDPDIVHAHRVARRQSRDHAPAGPARGRR |
| Ga0307277_100288112 | 3300028881 | Soil | MRQIRKRRHGSGLRQPAPLPADARDPDIVHAHRVARRQPRDYASAEPARGRR |
| Ga0318493_100302433 | 3300031723 | Soil | MRQIYKSKRRPGSGRRQPTPLPADARDPDIVHAHRVARRRQSRDHAPARPARGRR |
| Ga0318536_103541312 | 3300031893 | Soil | MRQIYKSKRRPGSGRRQPTPLPADARDPDIVHAHRVARRRQPRDHAPARS |
| Ga0335085_100443744 | 3300032770 | Soil | MRQIRKHRHRPGLRQPEPLPADARDPDIVHAHRVARRRQSRDHAAAGPARGRR |
| Ga0335085_101490183 | 3300032770 | Soil | MRQIHQDKRHHRTGRRQPAPLPADARDPDIVHAHRVARRRQSRDYAPAGPARGRG |
| Ga0335082_100520613 | 3300032782 | Soil | MRQIYKSKRRPGSGRRQPTPLPADARDPDIVHAHRVARRRQSRDDAQARPARGRR |
| Ga0335079_101373333 | 3300032783 | Soil | MRQIRKRRHRSGLRQPVTLPADARDPDIVHAHRVARRRQSRDHAPAGPARGRR |
| Ga0335078_106869473 | 3300032805 | Soil | MRQIRKRRHGSGRPQPEVLPADARDPDIVHAHRVARRGQSRDHAPAGPARGRR |
| Ga0335076_101603662 | 3300032955 | Soil | MRQIYTSKRRPGSGRRQPTPLPADARDPDIVHAHRVARRRQSRDHAQAKPARGRR |
| Ga0310811_113315841 | 3300033475 | Soil | MRQIRKRRHGSGRPQPAPLPADARDPDIVHAHQVARRGQSRDHA |
| Ga0373948_0208512_236_394 | 3300034817 | Rhizosphere Soil | MRQIRKRRHGSGRPQPELLPADARDPDIVHAHQVARRQSRDHASAGPARGRR |
| ⦗Top⦘ |