| Basic Information | |
|---|---|
| Family ID | F062219 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 131 |
| Average Sequence Length | 43 residues |
| Representative Sequence | GDAEMKIEMDESSLPDSSVLVQASYSGRTATRKFQLRKVEA |
| Number of Associated Samples | 118 |
| Number of Associated Scaffolds | 131 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 98.47 % |
| % of genes from short scaffolds (< 2000 bps) | 94.66 % |
| Associated GOLD sequencing projects | 114 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.52 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (95.420 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (11.450 % of family members) |
| Environment Ontology (ENVO) | Unclassified (29.771 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (45.038 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 8.70% β-sheet: 23.19% Coil/Unstructured: 68.12% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.52 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 131 Family Scaffolds |
|---|---|---|
| PF02597 | ThiS | 49.62 |
| PF13411 | MerR_1 | 29.01 |
| PF12543 | DUF3738 | 3.05 |
| PF01435 | Peptidase_M48 | 2.29 |
| PF00248 | Aldo_ket_red | 1.53 |
| PF00926 | DHBP_synthase | 1.53 |
| PF00106 | adh_short | 0.76 |
| PF01769 | MgtE | 0.76 |
| PF12773 | DZR | 0.76 |
| PF13231 | PMT_2 | 0.76 |
| PF01384 | PHO4 | 0.76 |
| PF00925 | GTP_cyclohydro2 | 0.76 |
| PF00069 | Pkinase | 0.76 |
| COG ID | Name | Functional Category | % Frequency in 131 Family Scaffolds |
|---|---|---|---|
| COG1977 | Molybdopterin synthase sulfur carrier subunit MoaD | Coenzyme transport and metabolism [H] | 49.62 |
| COG2104 | Sulfur carrier protein ThiS (thiamine biosynthesis) | Coenzyme transport and metabolism [H] | 49.62 |
| COG0515 | Serine/threonine protein kinase | Signal transduction mechanisms [T] | 3.05 |
| COG0108 | 3,4-dihydroxy-2-butanone 4-phosphate synthase | Coenzyme transport and metabolism [H] | 1.53 |
| COG0306 | Phosphate/sulfate permease | Inorganic ion transport and metabolism [P] | 0.76 |
| COG0807 | GTP cyclohydrolase II | Coenzyme transport and metabolism [H] | 0.76 |
| COG1824 | Permease, similar to cation transporters | Inorganic ion transport and metabolism [P] | 0.76 |
| COG2239 | Mg/Co/Ni transporter MgtE (contains CBS domain) | Inorganic ion transport and metabolism [P] | 0.76 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 95.42 % |
| Unclassified | root | N/A | 4.58 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2228664022|INPgaii200_c0775610 | All Organisms → cellular organisms → Bacteria | 739 | Open in IMG/M |
| 3300001471|JGI12712J15308_10042904 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 1156 | Open in IMG/M |
| 3300004480|Ga0062592_100068310 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2039 | Open in IMG/M |
| 3300005167|Ga0066672_10724408 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 634 | Open in IMG/M |
| 3300005174|Ga0066680_10179326 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1334 | Open in IMG/M |
| 3300005175|Ga0066673_10367199 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 840 | Open in IMG/M |
| 3300005176|Ga0066679_10109095 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1692 | Open in IMG/M |
| 3300005179|Ga0066684_10531271 | All Organisms → cellular organisms → Bacteria | 789 | Open in IMG/M |
| 3300005336|Ga0070680_101650678 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 555 | Open in IMG/M |
| 3300005337|Ga0070682_101273254 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 624 | Open in IMG/M |
| 3300005364|Ga0070673_101266287 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 692 | Open in IMG/M |
| 3300005468|Ga0070707_100961715 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 819 | Open in IMG/M |
| 3300005471|Ga0070698_100966477 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 798 | Open in IMG/M |
| 3300005518|Ga0070699_100003819 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 13308 | Open in IMG/M |
| 3300005526|Ga0073909_10404976 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 643 | Open in IMG/M |
| 3300005559|Ga0066700_10993569 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 552 | Open in IMG/M |
| 3300005563|Ga0068855_100837458 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 976 | Open in IMG/M |
| 3300005574|Ga0066694_10188126 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 980 | Open in IMG/M |
| 3300005602|Ga0070762_10740726 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 662 | Open in IMG/M |
| 3300005610|Ga0070763_10868885 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 535 | Open in IMG/M |
| 3300005614|Ga0068856_101897388 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 607 | Open in IMG/M |
| 3300005712|Ga0070764_10295281 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 934 | Open in IMG/M |
| 3300005764|Ga0066903_107900149 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 546 | Open in IMG/M |
| 3300005842|Ga0068858_100486607 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1191 | Open in IMG/M |
| 3300005921|Ga0070766_10541318 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 777 | Open in IMG/M |
| 3300005944|Ga0066788_10030060 | All Organisms → cellular organisms → Bacteria | 1234 | Open in IMG/M |
| 3300005995|Ga0066790_10487505 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 527 | Open in IMG/M |
| 3300006050|Ga0075028_100279193 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 925 | Open in IMG/M |
| 3300006163|Ga0070715_10312427 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 845 | Open in IMG/M |
| 3300006176|Ga0070765_100130503 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2217 | Open in IMG/M |
| 3300006806|Ga0079220_11217824 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 623 | Open in IMG/M |
| 3300009088|Ga0099830_10687418 | Not Available | 842 | Open in IMG/M |
| 3300009101|Ga0105247_10777318 | All Organisms → cellular organisms → Bacteria | 728 | Open in IMG/M |
| 3300009177|Ga0105248_10685329 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1156 | Open in IMG/M |
| 3300009525|Ga0116220_10613308 | Not Available | 501 | Open in IMG/M |
| 3300009545|Ga0105237_10616263 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1092 | Open in IMG/M |
| 3300009545|Ga0105237_11133694 | All Organisms → cellular organisms → Bacteria | 789 | Open in IMG/M |
| 3300009839|Ga0116223_10250055 | All Organisms → cellular organisms → Bacteria | 1069 | Open in IMG/M |
| 3300010047|Ga0126382_11706214 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → Methylovorus → Methylovorus menthalis | 588 | Open in IMG/M |
| 3300010329|Ga0134111_10344831 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 628 | Open in IMG/M |
| 3300010336|Ga0134071_10580593 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 585 | Open in IMG/M |
| 3300011119|Ga0105246_10341213 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1224 | Open in IMG/M |
| 3300011270|Ga0137391_10673095 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 862 | Open in IMG/M |
| 3300012200|Ga0137382_10519042 | All Organisms → cellular organisms → Bacteria | 847 | Open in IMG/M |
| 3300012202|Ga0137363_11413555 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 586 | Open in IMG/M |
| 3300012205|Ga0137362_10571532 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 976 | Open in IMG/M |
| 3300012205|Ga0137362_11313798 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 608 | Open in IMG/M |
| 3300012208|Ga0137376_10269681 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1476 | Open in IMG/M |
| 3300012917|Ga0137395_10315649 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1109 | Open in IMG/M |
| 3300012958|Ga0164299_10888262 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 645 | Open in IMG/M |
| 3300012976|Ga0134076_10271606 | All Organisms → cellular organisms → Bacteria | 728 | Open in IMG/M |
| 3300012987|Ga0164307_11733128 | Not Available | 529 | Open in IMG/M |
| 3300014493|Ga0182016_10587461 | Not Available | 635 | Open in IMG/M |
| 3300015242|Ga0137412_10504172 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 926 | Open in IMG/M |
| 3300015245|Ga0137409_10540025 | All Organisms → cellular organisms → Bacteria | 992 | Open in IMG/M |
| 3300015371|Ga0132258_11808630 | All Organisms → cellular organisms → Bacteria | 1539 | Open in IMG/M |
| 3300017656|Ga0134112_10435492 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 547 | Open in IMG/M |
| 3300017822|Ga0187802_10187610 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 794 | Open in IMG/M |
| 3300017933|Ga0187801_10284710 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 670 | Open in IMG/M |
| 3300017934|Ga0187803_10205306 | All Organisms → cellular organisms → Bacteria | 777 | Open in IMG/M |
| 3300017943|Ga0187819_10101615 | All Organisms → cellular organisms → Bacteria | 1718 | Open in IMG/M |
| 3300017943|Ga0187819_10793972 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 532 | Open in IMG/M |
| 3300017955|Ga0187817_10069110 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2196 | Open in IMG/M |
| 3300017994|Ga0187822_10062295 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1072 | Open in IMG/M |
| 3300018006|Ga0187804_10155091 | All Organisms → cellular organisms → Bacteria | 966 | Open in IMG/M |
| 3300018006|Ga0187804_10421268 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 593 | Open in IMG/M |
| 3300018012|Ga0187810_10494678 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 522 | Open in IMG/M |
| 3300018047|Ga0187859_10192134 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1088 | Open in IMG/M |
| 3300018054|Ga0184621_10204513 | All Organisms → cellular organisms → Bacteria | 707 | Open in IMG/M |
| 3300018058|Ga0187766_10028518 | All Organisms → cellular organisms → Bacteria | 3228 | Open in IMG/M |
| 3300018058|Ga0187766_10514932 | All Organisms → cellular organisms → Bacteria | 807 | Open in IMG/M |
| 3300018085|Ga0187772_11460503 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae | 509 | Open in IMG/M |
| 3300018086|Ga0187769_10185843 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1534 | Open in IMG/M |
| 3300018431|Ga0066655_10620685 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 730 | Open in IMG/M |
| 3300018468|Ga0066662_10845300 | All Organisms → cellular organisms → Bacteria | 893 | Open in IMG/M |
| 3300018482|Ga0066669_10472713 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1081 | Open in IMG/M |
| 3300018482|Ga0066669_12179937 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 525 | Open in IMG/M |
| 3300020002|Ga0193730_1160641 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 585 | Open in IMG/M |
| 3300020015|Ga0193734_1023519 | All Organisms → cellular organisms → Bacteria | 1163 | Open in IMG/M |
| 3300020579|Ga0210407_11011573 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA6 | 633 | Open in IMG/M |
| 3300020581|Ga0210399_10071277 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 2814 | Open in IMG/M |
| 3300020582|Ga0210395_10550130 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 868 | Open in IMG/M |
| 3300021171|Ga0210405_10216102 | All Organisms → cellular organisms → Bacteria | 1519 | Open in IMG/M |
| 3300021178|Ga0210408_10810515 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 733 | Open in IMG/M |
| 3300021420|Ga0210394_11006135 | All Organisms → cellular organisms → Bacteria | 722 | Open in IMG/M |
| 3300021432|Ga0210384_10748280 | All Organisms → cellular organisms → Bacteria | 873 | Open in IMG/M |
| 3300021478|Ga0210402_10244863 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1655 | Open in IMG/M |
| 3300021861|Ga0213853_10150562 | Not Available | 742 | Open in IMG/M |
| 3300022756|Ga0222622_10673400 | All Organisms → cellular organisms → Bacteria | 751 | Open in IMG/M |
| 3300025893|Ga0207682_10235115 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 850 | Open in IMG/M |
| 3300025910|Ga0207684_10160975 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1933 | Open in IMG/M |
| 3300025911|Ga0207654_10861719 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae | 656 | Open in IMG/M |
| 3300025911|Ga0207654_11254389 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 540 | Open in IMG/M |
| 3300025915|Ga0207693_10487136 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 963 | Open in IMG/M |
| 3300025917|Ga0207660_11288353 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 594 | Open in IMG/M |
| 3300025928|Ga0207700_10227492 | All Organisms → cellular organisms → Bacteria | 1584 | Open in IMG/M |
| 3300025931|Ga0207644_11234118 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 628 | Open in IMG/M |
| 3300026035|Ga0207703_11571349 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 633 | Open in IMG/M |
| 3300026078|Ga0207702_11273141 | All Organisms → cellular organisms → Bacteria | 729 | Open in IMG/M |
| 3300026078|Ga0207702_12251637 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 533 | Open in IMG/M |
| 3300026118|Ga0207675_100221872 | All Organisms → cellular organisms → Bacteria | 1821 | Open in IMG/M |
| 3300026300|Ga0209027_1036996 | All Organisms → cellular organisms → Bacteria | 1841 | Open in IMG/M |
| 3300026335|Ga0209804_1330993 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 513 | Open in IMG/M |
| 3300026530|Ga0209807_1071650 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1552 | Open in IMG/M |
| 3300026540|Ga0209376_1386130 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 524 | Open in IMG/M |
| 3300026557|Ga0179587_10980863 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 557 | Open in IMG/M |
| 3300027604|Ga0208324_1125253 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 709 | Open in IMG/M |
| 3300027671|Ga0209588_1100569 | All Organisms → cellular organisms → Bacteria | 930 | Open in IMG/M |
| 3300027737|Ga0209038_10257075 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 523 | Open in IMG/M |
| 3300027846|Ga0209180_10023275 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 3293 | Open in IMG/M |
| 3300027846|Ga0209180_10117892 | All Organisms → cellular organisms → Bacteria | 1522 | Open in IMG/M |
| 3300027882|Ga0209590_10328731 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 984 | Open in IMG/M |
| 3300028047|Ga0209526_10410514 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 897 | Open in IMG/M |
| 3300028381|Ga0268264_10620232 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1068 | Open in IMG/M |
| 3300028679|Ga0302169_10033019 | All Organisms → cellular organisms → Bacteria | 1195 | Open in IMG/M |
| 3300028828|Ga0307312_10292067 | All Organisms → cellular organisms → Bacteria | 1061 | Open in IMG/M |
| 3300028906|Ga0308309_10518345 | All Organisms → cellular organisms → Bacteria | 1031 | Open in IMG/M |
| 3300028906|Ga0308309_11220715 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 648 | Open in IMG/M |
| 3300028906|Ga0308309_11800786 | Not Available | 518 | Open in IMG/M |
| 3300030020|Ga0311344_10853236 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 732 | Open in IMG/M |
| 3300030045|Ga0302282_1180291 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 810 | Open in IMG/M |
| 3300030339|Ga0311360_10280391 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1350 | Open in IMG/M |
| 3300031720|Ga0307469_11946197 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 570 | Open in IMG/M |
| 3300031902|Ga0302322_101731490 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 765 | Open in IMG/M |
| 3300031902|Ga0302322_102854254 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 595 | Open in IMG/M |
| 3300031918|Ga0311367_10478606 | All Organisms → cellular organisms → Bacteria | 1279 | Open in IMG/M |
| 3300031938|Ga0308175_100945281 | All Organisms → cellular organisms → Bacteria | 950 | Open in IMG/M |
| 3300032828|Ga0335080_10468358 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1342 | Open in IMG/M |
| 3300032828|Ga0335080_12278738 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 519 | Open in IMG/M |
| 3300033004|Ga0335084_11255240 | All Organisms → cellular organisms → Bacteria | 739 | Open in IMG/M |
| 3300033158|Ga0335077_10560771 | All Organisms → cellular organisms → Bacteria | 1198 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 11.45% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 7.63% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 7.63% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 6.11% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 6.11% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 5.34% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.82% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 3.82% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 3.82% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 3.05% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 3.05% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 3.05% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 3.05% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 3.05% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 3.05% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 2.29% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 2.29% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 1.53% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 1.53% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 1.53% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.53% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.53% |
| Watersheds | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Watersheds | 0.76% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 0.76% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.76% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.76% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.76% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.76% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.76% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.76% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.76% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.76% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.76% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.76% |
| Bog | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Bog | 0.76% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.76% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.76% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.76% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.76% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.76% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2228664022 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001471 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 | Environmental | Open in IMG/M |
| 3300004480 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4 | Environmental | Open in IMG/M |
| 3300005167 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 | Environmental | Open in IMG/M |
| 3300005174 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 | Environmental | Open in IMG/M |
| 3300005175 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 | Environmental | Open in IMG/M |
| 3300005176 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 | Environmental | Open in IMG/M |
| 3300005179 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 | Environmental | Open in IMG/M |
| 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Environmental | Open in IMG/M |
| 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Environmental | Open in IMG/M |
| 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
| 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
| 3300005526 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 | Environmental | Open in IMG/M |
| 3300005559 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 | Environmental | Open in IMG/M |
| 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Host-Associated | Open in IMG/M |
| 3300005574 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143 | Environmental | Open in IMG/M |
| 3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
| 3300005610 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 | Environmental | Open in IMG/M |
| 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Host-Associated | Open in IMG/M |
| 3300005712 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Host-Associated | Open in IMG/M |
| 3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
| 3300005944 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 2 DNA2013-048 | Environmental | Open in IMG/M |
| 3300005995 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-050 | Environmental | Open in IMG/M |
| 3300006050 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014 | Environmental | Open in IMG/M |
| 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009525 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_7_NC metaG | Environmental | Open in IMG/M |
| 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009839 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010329 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_11112015 | Environmental | Open in IMG/M |
| 3300010336 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09082015 | Environmental | Open in IMG/M |
| 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Host-Associated | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300012958 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG | Environmental | Open in IMG/M |
| 3300012976 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_0_1 metaG | Environmental | Open in IMG/M |
| 3300012987 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MG | Environmental | Open in IMG/M |
| 3300014493 | Permafrost microbial communities from Stordalen Mire, Sweden - 712S2M metaG | Environmental | Open in IMG/M |
| 3300015242 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015245 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300017656 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_11112015 | Environmental | Open in IMG/M |
| 3300017822 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_2 | Environmental | Open in IMG/M |
| 3300017933 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_1 | Environmental | Open in IMG/M |
| 3300017934 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_3 | Environmental | Open in IMG/M |
| 3300017943 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4 | Environmental | Open in IMG/M |
| 3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
| 3300017994 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_2 | Environmental | Open in IMG/M |
| 3300018006 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_4 | Environmental | Open in IMG/M |
| 3300018012 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_5 | Environmental | Open in IMG/M |
| 3300018047 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_10 | Environmental | Open in IMG/M |
| 3300018054 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_b1 | Environmental | Open in IMG/M |
| 3300018058 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MG | Environmental | Open in IMG/M |
| 3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018086 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MG | Environmental | Open in IMG/M |
| 3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300020002 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1a1 | Environmental | Open in IMG/M |
| 3300020015 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1m1 | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021861 | Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - ABR_2016 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300022756 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1 | Environmental | Open in IMG/M |
| 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026300 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 (SPAdes) | Environmental | Open in IMG/M |
| 3300026530 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 (SPAdes) | Environmental | Open in IMG/M |
| 3300026540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 (SPAdes) | Environmental | Open in IMG/M |
| 3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300027604 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027737 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028679 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_N1_3 | Environmental | Open in IMG/M |
| 3300028828 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202 | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300030020 | II_Bog_N1 coassembly | Environmental | Open in IMG/M |
| 3300030045 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Fen_E1_3 | Environmental | Open in IMG/M |
| 3300030339 | III_Bog_N1 coassembly | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031902 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_2 | Environmental | Open in IMG/M |
| 3300031918 | III_Fen_N3 coassembly | Environmental | Open in IMG/M |
| 3300031938 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1 | Environmental | Open in IMG/M |
| 3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
| 3300033004 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4 | Environmental | Open in IMG/M |
| 3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| INPgaii200_07756103 | 2228664022 | Soil | DSAGSAEMQIEADESSLPDSSILVQASYSGRTATRKFNLRKVEA |
| JGI12712J15308_100429043 | 3300001471 | Forest Soil | EIKVEVEESSLPDSSVLVQANYEGRTATRKFLLRKAE* |
| Ga0062592_1000683101 | 3300004480 | Soil | YTQVLTDASGNAEMRVDMDEASLPDSSVLVQATHAGRSATRKFRLRKVEA* |
| Ga0066672_107244081 | 3300005167 | Soil | GDVEMSMEMDEPSLQDSSVLVQANYSGRTATRKFQFRKIEA* |
| Ga0066680_101793263 | 3300005174 | Soil | TQVVTDPAGDAEMKIEVDESALPDSSVLVQANYLGRTATRKFQLRKIEA* |
| Ga0066673_103671993 | 3300005175 | Soil | YRQVMTDSSGDAEMKIDMEESSLPDSSLLVQASYSGRTTTRKFRLRKVES* |
| Ga0066679_101090955 | 3300005176 | Soil | GDVEMSMEMDEPSLQDSSVLVQANYSGRTATRKFQLRKIEA* |
| Ga0066684_105312711 | 3300005179 | Soil | TQVLTDNAGTAEMNLEVEEAALSDASVLIQASYSGRTATRKFQLRRVEA* |
| Ga0070680_1016506781 | 3300005336 | Corn Rhizosphere | DASGNAEMRVDMDEASLPDSSVLVQATHAGRSATRKFRLRKVEA* |
| Ga0070682_1012732542 | 3300005337 | Corn Rhizosphere | DPAGDTEMKIEVDESSLPDSSVLVQASYSGRTATRKFQLRKVEA* |
| Ga0070673_1012662873 | 3300005364 | Switchgrass Rhizosphere | SGDAEMTIEADESALPDSSVLVQASYSGRTATRKFNLRKVEA* |
| Ga0070707_1009617151 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | AGDAEMKIDMEESALPDSSLLVQASYSGKTTTRKFRLRKIES* |
| Ga0070698_1009664772 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | TDEAGDAEMKIDVDESSLSDSSILVQASYSGRTATRKFQLKKVEA* |
| Ga0070699_10000381915 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | GDAEMKIEVDESALPDSSVLVQANYLGRTATRKFQLRKIEA* |
| Ga0073909_104049762 | 3300005526 | Surface Soil | IEVDESSLPDSSVLVQASYSGRTATRKFQLRKVEA* |
| Ga0066700_109935693 | 3300005559 | Soil | YTQVVTDASGDVEMSMEMDEPSLQDSSVLVQANYSGRTATRKFQLRKIEA* |
| Ga0068855_1008374581 | 3300005563 | Corn Rhizosphere | AQVVTDPAGDTEMKIEVDESSLPDSSVLVQASYSGRTATRKFQLRKVEA* |
| Ga0066694_101881261 | 3300005574 | Soil | EMKIEVDESSLGDSSVLVQANYSGRTATRKFQLRKVEA* |
| Ga0070762_107407262 | 3300005602 | Soil | DAEMKIDVDESSLPDSAVLVQASYSGRTATRKFQLRKVEA* |
| Ga0070763_108688853 | 3300005610 | Soil | DGDAEMKIDVDESSLPDSAVLVQASYSGRTATRKFQLRKVEA* |
| Ga0068856_1018973881 | 3300005614 | Corn Rhizosphere | DAEMTIEADESALPDSSVLVQASYSGRTATRKFNLRKVEA* |
| Ga0070764_102952811 | 3300005712 | Soil | KIDVDESSLPDSAVLVQANYSGRTATRKFQLRKVEA* |
| Ga0066903_1079001491 | 3300005764 | Tropical Forest Soil | AEMKLGMEEAALSDSSVLIQVSYSGRTATRKFQLRRVEA* |
| Ga0068858_1004866074 | 3300005842 | Switchgrass Rhizosphere | YTQVTTDSAGSAEMQIEADESSLPDSSILVQASYSGRTATRKFNLRKVEA* |
| Ga0070766_105413181 | 3300005921 | Soil | MKIDVDESSLPDSAILVQASYSGRTATRKFQLRKVEA* |
| Ga0066788_100300601 | 3300005944 | Soil | VTAESGDAEMKIDVDETSLPDSSVLVQANYAGRTATRKFQLKKVEA* |
| Ga0066790_104875051 | 3300005995 | Soil | QVITGPEGHAEMNIGVDESGLPDSSILVQARYEDRTATRKFQLRKVEA* |
| Ga0075028_1002791931 | 3300006050 | Watersheds | DAEMKIDVDEASLPDSAVLVQANYSGRTATRKFQLRKVEA* |
| Ga0070715_103124273 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | AQVLTDQSGDAEMKIEVDESSLADSSVLVQASYSGRTATRKFQLRKVEA* |
| Ga0070765_1001305036 | 3300006176 | Soil | AGEAEMKIDVDDSSLPDSSILVQASYSGRTATRKFELRKVEA* |
| Ga0079220_112178241 | 3300006806 | Agricultural Soil | GGNAEMSIAVDEAALPDSSVLVQASVSGRTATRKFHFRKID* |
| Ga0099830_106874181 | 3300009088 | Vadose Zone Soil | MKIEMDESALLDSSVLVQANYSGRTATRKFQLRKVEA* |
| Ga0105247_107773181 | 3300009101 | Switchgrass Rhizosphere | EMTIEADEAALPDSSVLVQASFSGRTATRKFNLRKVEA* |
| Ga0105248_106853293 | 3300009177 | Switchgrass Rhizosphere | TDPSGDTEMKIEVDDFALPDASVLVQANYSGRTATRKFQLRKVEA* |
| Ga0116220_106133081 | 3300009525 | Peatlands Soil | TDAVGAAEMKIDVDESALPDSSLLVQASYSGRTATRKFQLRKVEA* |
| Ga0105237_106162631 | 3300009545 | Corn Rhizosphere | AEMRIEIDESALTESSVLVQANYSGRTATRKFQLRRVVA* |
| Ga0105237_111336943 | 3300009545 | Corn Rhizosphere | GSAEMQIEADESSLPDSSILVQASYSGRTATRKFNLRKVEA* |
| Ga0116223_102500553 | 3300009839 | Peatlands Soil | AELKIDVDESSLPDSAVLVQANYSGRTATRKFHLRKVEA* |
| Ga0126382_117062141 | 3300010047 | Tropical Forest Soil | TQVLTDSTGDAEMKIDIDESSLPDSSVLVQASYSGRTATRKFHLRKIEA* |
| Ga0134111_103448312 | 3300010329 | Grasslands Soil | SGHAEMKIEVDESSLGDSSVLVQANYSGRTATRKFQLRKVEA* |
| Ga0134071_105805931 | 3300010336 | Grasslands Soil | MKVEVDESSLSDSSVLVQANYSGRTTTRKFQLRKVEA* |
| Ga0105246_103412131 | 3300011119 | Miscanthus Rhizosphere | SGDTEMKIEVDDFALPDASVLVQANYSGRTATRKFQLRKVEA* |
| Ga0137391_106730953 | 3300011270 | Vadose Zone Soil | DAEMKIEMEESSLPDSSVLVQASYSGRTATRKFQLKKVEA* |
| Ga0137382_105190421 | 3300012200 | Vadose Zone Soil | MKIDMEESSLPDSSLLVQASYSGRTTTRKFRLRKVES* |
| Ga0137363_114135553 | 3300012202 | Vadose Zone Soil | PFYTQVMTDSSGDAEMKIDMEESSLPDSSLLVQASYSGRTTTRKFRLRKVES* |
| Ga0137362_105715321 | 3300012205 | Vadose Zone Soil | IEVDEASLPDSSVLVQASYSGRTATRKFQLRKVEA* |
| Ga0137362_113137981 | 3300012205 | Vadose Zone Soil | DVEMSMEMDEPSLQDSSVLVQANYSGRTATRKFQLRKIEA* |
| Ga0137376_102696815 | 3300012208 | Vadose Zone Soil | SGDAEMKIDMEESSLPDSSLLVQASYSGRTTTRKFRLRKVES* |
| Ga0137395_103156491 | 3300012917 | Vadose Zone Soil | AGDAEMKIDVDESSLSDSSVLVQASYSGRTATRKFQLKKVEA* |
| Ga0164299_108882621 | 3300012958 | Soil | TDPAGDTEMQIAVDESSLPDSSVLVQASYSGRTATRKFQLRKVEA* |
| Ga0134076_102716061 | 3300012976 | Grasslands Soil | ASGDVEMNMEMDEPSLQDCSVLVQANYSGRTATRKFQLRKIEA* |
| Ga0164307_117331282 | 3300012987 | Soil | MKIEVDESSLPDSSVLVQASYSGRTATRKFHLKKVEA* |
| Ga0182016_105874611 | 3300014493 | Bog | NAAGEAEMKIDADEADLPDSSMLVQASFDGRTATRKFNLRKIET* |
| Ga0137412_105041723 | 3300015242 | Vadose Zone Soil | VTDPSGNTEMNIEVDESSLPDSSVLVQASYSGRTATRKFQLKKVEA* |
| Ga0137409_105400251 | 3300015245 | Vadose Zone Soil | SSGDAEMKIDMEESSLPDSSLLVQASYSGRTTTRKFRLRKVES* |
| Ga0132258_118086304 | 3300015371 | Arabidopsis Rhizosphere | DASGNAEMRVDMDEASLPDSSVLVQATHAGRSTTRKFRLRKVEA* |
| Ga0134112_104354922 | 3300017656 | Grasslands Soil | AEMKIEVDESSLGDSSVLVQANYSGRTATRKFQLRKVEA |
| Ga0187802_101876102 | 3300017822 | Freshwater Sediment | DEVGAAEMKIDVDESALPDSSLLVQASYSGRTATRKFQLRKVEA |
| Ga0187801_102847103 | 3300017933 | Freshwater Sediment | QAVTGSNGDAEMKIDMAESSLPDSSVLVQASYSGRTATRKFQLRKVEA |
| Ga0187803_102053063 | 3300017934 | Freshwater Sediment | FYTQVVTGSDGDAEMKIDVGESALPDSAILVQANYSGRTATRKFQLRKVEA |
| Ga0187819_101016151 | 3300017943 | Freshwater Sediment | ANGDAEMKFDAEEFSLPDAAILVQTSYTGRTATRKFQLRRVEA |
| Ga0187819_107939721 | 3300017943 | Freshwater Sediment | TQVMTGANGEAEMNIDVDESALPDASVLVQASYTGRTATRKFHLRKVEA |
| Ga0187817_100691103 | 3300017955 | Freshwater Sediment | EVGAAEMKIDVDESALPDSSLLVQASYSGRTATRKFQLRKVEA |
| Ga0187822_100622951 | 3300017994 | Freshwater Sediment | MKIEMDETSLPDSSVLVQASYSGRTATRKFQLKKIEA |
| Ga0187804_101550911 | 3300018006 | Freshwater Sediment | AEMKFDAEEFSLPDAAILVQTSYTGRTATRKFQLRRVEA |
| Ga0187804_104212682 | 3300018006 | Freshwater Sediment | FYTQVLTDEVGAAEMKIDVDESALPDSSLLVQASYSGRTATRKFQLRKVEA |
| Ga0187810_104946781 | 3300018012 | Freshwater Sediment | GDAEMKIDVDESSLPDSAVLVQASYSGRTATRKFQLRKVEA |
| Ga0187859_101921341 | 3300018047 | Peatland | MKIDVDESSLPDSAILVQASYSGRTATRKFQLRKVEA |
| Ga0184621_102045133 | 3300018054 | Groundwater Sediment | QVVTNSAGDAEMKIDMEESALPDSSLLVQASYSGRTTTRKFRLRKIES |
| Ga0187766_100285181 | 3300018058 | Tropical Peatland | EMRIDVEESALPDSMVLVQASYTDRRATRKFQLRKVES |
| Ga0187766_105149322 | 3300018058 | Tropical Peatland | ADGSAEMKIDVDESSLPDSAILVQASLSGRTATRKFQLRKVEA |
| Ga0187772_114605031 | 3300018085 | Tropical Peatland | TAAGGDAELKIDVNESSLPDSSVLVQASYQGRTATRKFELRQVES |
| Ga0187769_101858434 | 3300018086 | Tropical Peatland | TGANGEAEMHIDVDESALPDASVLVQASYTGRTATRKFHLRKVEA |
| Ga0066655_106206851 | 3300018431 | Grasslands Soil | NGDVEMSMEMDEPSLQDSSVLVQANYSGRTATRKFQLRKIEA |
| Ga0066662_108453001 | 3300018468 | Grasslands Soil | DVEMSMEMDEPSLQDSSVLVQANYSGRTATRKFQLRKIEA |
| Ga0066669_104727133 | 3300018482 | Grasslands Soil | TQVVTGTSGDAEMIIEADEAALPDSSVLVQASYSGRTATRKFNLRKVEA |
| Ga0066669_121799372 | 3300018482 | Grasslands Soil | EMKLEMDEASLPDSSVLVQASHSGRTATRKFQLKKVEA |
| Ga0193730_11606411 | 3300020002 | Soil | KIEMDEFSLPDSSVLVQASYSGRTATRKFQLRKVEA |
| Ga0193734_10235194 | 3300020015 | Soil | MKIEMDEFSLPDSSVLVQASYSGRTATRKFQLRKVEA |
| Ga0210407_110115732 | 3300020579 | Soil | AEMKVDVDESSLPDSAILVQASYSGRTATRKFQLRKVEA |
| Ga0210399_100712771 | 3300020581 | Soil | GDAEMKIEMEESSLPDSSVLVQASYSGRTATRKFQLRKVEA |
| Ga0210395_105501303 | 3300020582 | Soil | SDGDAEMKIDVDESSLPDSAVLVQANYSGRTATRKFQLRKVEA |
| Ga0210405_102161021 | 3300021171 | Soil | GDAEMKIEMDESSLPDSSVLVQASYSGRTATRKFQLRKVEA |
| Ga0210408_108105153 | 3300021178 | Soil | KIDVDESSLPDSAVLVQASYSGRTATRKFQLRKVEA |
| Ga0210394_110061351 | 3300021420 | Soil | GEAEMKIDVDESSLPDSAVLVQASYSGRTATRKFQLRKVEA |
| Ga0210384_107482801 | 3300021432 | Soil | TEMKIEVDESSLPDSSVLVQASYSGRTATRKFQLRKVEA |
| Ga0210402_102448631 | 3300021478 | Soil | AQVLTDQAGDAEMKIEMDESSLPDSSVLVQASYSGRTATRKFQLRKVEA |
| Ga0213853_101505621 | 3300021861 | Watersheds | DEAGDAEMKIDVDESSLSDSSVLVQASYSGRTATRKFQLKKVEA |
| Ga0222622_106734001 | 3300022756 | Groundwater Sediment | KIDMEESALPDSSLLVQASYSGRTTTRKFRLRKIES |
| Ga0207682_102351151 | 3300025893 | Miscanthus Rhizosphere | PAGDTEMKIEVDESSLPDSSVLVQASYSGRTATRKFQLRKVEA |
| Ga0207684_101609751 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | VVTDPAGDAEMKIELDESSLPDSSVLVQANYSGRTATRKFQLRKIEA |
| Ga0207654_108617191 | 3300025911 | Corn Rhizosphere | MTIEADESALPDSSVLVQASYSGRTATRKFNLRKV |
| Ga0207654_112543892 | 3300025911 | Corn Rhizosphere | SDGSGNAEMRIEIDESALTESSVLVQANYSGRTATRKFQLRRVVA |
| Ga0207693_104871363 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | GDTEMKIEVDESSLPDSSVLVQASYSGRTATRKFQLRKVEA |
| Ga0207660_112883531 | 3300025917 | Corn Rhizosphere | DASGNAEMRVDMDEASLPDSSVLVQATHAGRSATRKFRLRKVEA |
| Ga0207700_102274925 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | QAGDAEMKLEMDESSLPDSSVLVQASYSGRTATRKFQLRRVEA |
| Ga0207644_112341181 | 3300025931 | Switchgrass Rhizosphere | IEVDDFALPDASVLVQANYSGRTATRKFQLRKVEA |
| Ga0207703_115713492 | 3300026035 | Switchgrass Rhizosphere | AGDTEMKIEVDESSLPDSSVLVQASYSGRTATRKFQLRKVEA |
| Ga0207702_112731413 | 3300026078 | Corn Rhizosphere | DAEMTIEADESALPDSSVLVQASYSGRTATRKFNLRKVEA |
| Ga0207702_122516371 | 3300026078 | Corn Rhizosphere | PSGDTEMKIEVDDFALPDASVLVQANYSGRTATRKFQLRKVEA |
| Ga0207675_1002218721 | 3300026118 | Switchgrass Rhizosphere | EMKIEVDESSLPDSSVLVQASYSGRTATRKFQLRKVEA |
| Ga0209027_10369961 | 3300026300 | Grasslands Soil | TDSAGDAEMKIDMEESYLPDSSLLVQASYSGRTTTRKFRLRKVES |
| Ga0209804_13309931 | 3300026335 | Soil | VVSDANGDVEMSMEMDEPSLQDSSVLVQANYSGRTATRKFQFRKIEA |
| Ga0209807_10716501 | 3300026530 | Soil | YRQVMTDSSGDAEMKIDMEESSLPDSSLLVQASYSGRTTTRKFRLRKVES |
| Ga0209376_13861302 | 3300026540 | Soil | KVEVDESSLSDSSVLVQANYSGRTATRKFQLRKVEA |
| Ga0179587_109808632 | 3300026557 | Vadose Zone Soil | MKIEVDEASLPDSSVLVQASYSGRTATRKFQLRKVEA |
| Ga0208324_11252533 | 3300027604 | Peatlands Soil | AELKIDVDESSLPDSAVLVQANYSGRTATRKFHLRKVEA |
| Ga0209588_11005693 | 3300027671 | Vadose Zone Soil | QVMTDSSGDAEMKIDMEESSLPDSSLLVQASYSGRTTTRKFRLRKVES |
| Ga0209038_102570751 | 3300027737 | Bog Forest Soil | GSDGDAEMKIDVDESSLPDSAVLVQANYSGRTATRKFHLRKVEA |
| Ga0209180_100232751 | 3300027846 | Vadose Zone Soil | AEMRIEMDEFALPDSSVLVQASYSGRTATRKFQLKKVEA |
| Ga0209180_101178924 | 3300027846 | Vadose Zone Soil | VTDPAGDAEMKIEVDESALPDSSVLVQANYLGRTATRKFQLRKIEA |
| Ga0209590_103287311 | 3300027882 | Vadose Zone Soil | TQVVTDASGDVEMSMEMDEPSLQDSSVLVQANYSGRTATRKFQLRKIEA |
| Ga0209526_104105141 | 3300028047 | Forest Soil | QVVTDPSGDTEMKIEVDESSLPDSSVLVQASYSGRTATRKFQLRKVEA |
| Ga0268264_106202323 | 3300028381 | Switchgrass Rhizosphere | NAEMRIEIDESALTESSVLVQANYSGRTATRKFQLRRVVA |
| Ga0302169_100330191 | 3300028679 | Fen | EMSVQVEEASLPESSVLVQASYSGRTATRKFRLRAAG |
| Ga0307312_102920671 | 3300028828 | Soil | SGDAEMRIEVDESSLADSSVLVQASYSGRTATRKFQLRKVEA |
| Ga0308309_105183451 | 3300028906 | Soil | DAEMKIDVDESSLPDSAVLVQANYSGRTATRKFHLRRVEA |
| Ga0308309_112207152 | 3300028906 | Soil | TDSAGEAEMKIDVDDSSLPDSSILVQASYSGRTATRKFELRKVEA |
| Ga0308309_118007861 | 3300028906 | Soil | SDGDAEMKIDVDESSLPDSAILVQASYSGRTATRKFQLRRVET |
| Ga0311344_108532361 | 3300030020 | Bog | EAEMKIDADEADLPDSSMLVQASFDGRTATRKFNLRKIET |
| Ga0302282_11802913 | 3300030045 | Fen | QVVTNAAGEAEMKIDADEADLPDSSMLVQASFDGRTATRKFNLRKIET |
| Ga0311360_102803911 | 3300030339 | Bog | VVTDSAGNAEMKIEMDEASLPDSSVLIQANHSGRTATRKFRLRKLET |
| Ga0307469_119461971 | 3300031720 | Hardwood Forest Soil | IEVDESSLPDSSVLVQASYSGRTATRKFQLRKAEA |
| Ga0302322_1017314901 | 3300031902 | Fen | YAQVLTDASGNAEMSFQVDESSLPDSSVLVQANFSGRTATRKFRLRAGN |
| Ga0302322_1028542541 | 3300031902 | Fen | VTDSAGNAEMKIEMDEASLPDSSVLIQANHSGRTATRKFRLRKLET |
| Ga0311367_104786061 | 3300031918 | Fen | SGNAEMSFQVDESSLPDSSVLVQANFSGRTATRKFRLRAGN |
| Ga0308175_1009452811 | 3300031938 | Soil | QVLTDNAGTAEMNLEVEEAALSDASVLIQASYSGRTATRKFQLRRVEA |
| Ga0335080_104683581 | 3300032828 | Soil | YFQVLTDAAGNAELQIDVEESALPDSSILVQASYSGRAATRKFQLRKVEA |
| Ga0335080_122787383 | 3300032828 | Soil | GNAEMSVQVEESALPDSSVLVQASYSGRTATRKFRVRAAG |
| Ga0335084_112552401 | 3300033004 | Soil | QIVTDASGEAEMKLEMEESALPDSSVLVQASYSGRTATRKFRLRKVEA |
| Ga0335077_105607711 | 3300033158 | Soil | TGPNGEAEMRIDVEESALPDSMILVQASYTDRRATRKFQLRKVET |
| ⦗Top⦘ |