| Basic Information | |
|---|---|
| Family ID | F062208 |
| Family Type | Metagenome |
| Number of Sequences | 131 |
| Average Sequence Length | 43 residues |
| Representative Sequence | VTQVGWDGEKHTLWPWDLAAKANFKPIFPSPSWQERDSKPKPAS |
| Number of Associated Samples | 116 |
| Number of Associated Scaffolds | 131 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.76 % |
| % of genes near scaffold ends (potentially truncated) | 99.24 % |
| % of genes from short scaffolds (< 2000 bps) | 93.13 % |
| Associated GOLD sequencing projects | 112 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.33 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (99.237 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil (12.214 % of family members) |
| Environment Ontology (ENVO) | Unclassified (27.481 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (38.931 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 18.06% β-sheet: 2.78% Coil/Unstructured: 79.17% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.33 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 131 Family Scaffolds |
|---|---|---|
| PF02653 | BPD_transp_2 | 93.89 |
| PF00005 | ABC_tran | 2.29 |
| PF12826 | HHH_2 | 0.76 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 99.24 % |
| Unclassified | root | N/A | 0.76 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300004156|Ga0062589_100492467 | All Organisms → cellular organisms → Bacteria | 1030 | Open in IMG/M |
| 3300004633|Ga0066395_10333798 | All Organisms → cellular organisms → Bacteria | 838 | Open in IMG/M |
| 3300005175|Ga0066673_10545447 | All Organisms → cellular organisms → Bacteria | 680 | Open in IMG/M |
| 3300005177|Ga0066690_10148365 | All Organisms → cellular organisms → Bacteria | 1540 | Open in IMG/M |
| 3300005180|Ga0066685_10836037 | All Organisms → cellular organisms → Bacteria | 621 | Open in IMG/M |
| 3300005295|Ga0065707_10545196 | All Organisms → cellular organisms → Bacteria | 725 | Open in IMG/M |
| 3300005331|Ga0070670_101073383 | All Organisms → cellular organisms → Bacteria | 734 | Open in IMG/M |
| 3300005332|Ga0066388_103507526 | All Organisms → cellular organisms → Bacteria | 801 | Open in IMG/M |
| 3300005332|Ga0066388_106080114 | All Organisms → cellular organisms → Bacteria | 610 | Open in IMG/M |
| 3300005356|Ga0070674_101258388 | All Organisms → cellular organisms → Bacteria | 659 | Open in IMG/M |
| 3300005438|Ga0070701_10806400 | All Organisms → cellular organisms → Bacteria | 641 | Open in IMG/M |
| 3300005451|Ga0066681_10203379 | All Organisms → cellular organisms → Bacteria | 1186 | Open in IMG/M |
| 3300005454|Ga0066687_10523977 | All Organisms → cellular organisms → Bacteria | 702 | Open in IMG/M |
| 3300005457|Ga0070662_100016790 | All Organisms → cellular organisms → Bacteria | 4921 | Open in IMG/M |
| 3300005457|Ga0070662_101642510 | All Organisms → cellular organisms → Bacteria | 555 | Open in IMG/M |
| 3300005471|Ga0070698_101378285 | All Organisms → cellular organisms → Bacteria | 656 | Open in IMG/M |
| 3300005526|Ga0073909_10707537 | All Organisms → cellular organisms → Bacteria | 506 | Open in IMG/M |
| 3300005546|Ga0070696_101832386 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 525 | Open in IMG/M |
| 3300005558|Ga0066698_10968186 | All Organisms → cellular organisms → Bacteria | 542 | Open in IMG/M |
| 3300005559|Ga0066700_11129883 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 512 | Open in IMG/M |
| 3300005560|Ga0066670_10140455 | All Organisms → cellular organisms → Bacteria | 1401 | Open in IMG/M |
| 3300005566|Ga0066693_10128263 | All Organisms → cellular organisms → Bacteria | 938 | Open in IMG/M |
| 3300005617|Ga0068859_100610986 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1183 | Open in IMG/M |
| 3300005713|Ga0066905_100917768 | All Organisms → cellular organisms → Bacteria | 767 | Open in IMG/M |
| 3300005713|Ga0066905_100973453 | All Organisms → cellular organisms → Bacteria | 747 | Open in IMG/M |
| 3300005719|Ga0068861_101611617 | All Organisms → cellular organisms → Bacteria | 640 | Open in IMG/M |
| 3300005764|Ga0066903_105049498 | All Organisms → cellular organisms → Bacteria | 700 | Open in IMG/M |
| 3300005841|Ga0068863_100624184 | All Organisms → cellular organisms → Bacteria | 1068 | Open in IMG/M |
| 3300005937|Ga0081455_10771627 | All Organisms → cellular organisms → Bacteria | 606 | Open in IMG/M |
| 3300006032|Ga0066696_10410089 | All Organisms → cellular organisms → Bacteria | 885 | Open in IMG/M |
| 3300006034|Ga0066656_10359836 | All Organisms → cellular organisms → Bacteria | 940 | Open in IMG/M |
| 3300006049|Ga0075417_10179353 | All Organisms → cellular organisms → Bacteria | 996 | Open in IMG/M |
| 3300006163|Ga0070715_10622190 | All Organisms → cellular organisms → Bacteria | 636 | Open in IMG/M |
| 3300006175|Ga0070712_100414130 | All Organisms → cellular organisms → Bacteria | 1115 | Open in IMG/M |
| 3300006844|Ga0075428_102135490 | All Organisms → cellular organisms → Bacteria | 579 | Open in IMG/M |
| 3300006853|Ga0075420_100253422 | All Organisms → cellular organisms → Bacteria | 1530 | Open in IMG/M |
| 3300006853|Ga0075420_100725207 | All Organisms → cellular organisms → Bacteria | 857 | Open in IMG/M |
| 3300006871|Ga0075434_101970936 | All Organisms → cellular organisms → Bacteria | 589 | Open in IMG/M |
| 3300006914|Ga0075436_101042749 | All Organisms → cellular organisms → Bacteria | 614 | Open in IMG/M |
| 3300006918|Ga0079216_11514853 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 562 | Open in IMG/M |
| 3300006954|Ga0079219_11979329 | All Organisms → cellular organisms → Bacteria | 553 | Open in IMG/M |
| 3300007788|Ga0099795_10262874 | All Organisms → cellular organisms → Bacteria | 748 | Open in IMG/M |
| 3300009100|Ga0075418_10572970 | All Organisms → cellular organisms → Bacteria | 1214 | Open in IMG/M |
| 3300009137|Ga0066709_104471061 | All Organisms → cellular organisms → Bacteria | 511 | Open in IMG/M |
| 3300009156|Ga0111538_12323687 | All Organisms → cellular organisms → Bacteria | 673 | Open in IMG/M |
| 3300009162|Ga0075423_10885486 | All Organisms → cellular organisms → Bacteria | 946 | Open in IMG/M |
| 3300009176|Ga0105242_11075602 | All Organisms → cellular organisms → Bacteria | 817 | Open in IMG/M |
| 3300009792|Ga0126374_11412414 | All Organisms → cellular organisms → Bacteria | 567 | Open in IMG/M |
| 3300009800|Ga0105069_1022244 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 648 | Open in IMG/M |
| 3300010047|Ga0126382_10209535 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1394 | Open in IMG/M |
| 3300010323|Ga0134086_10013456 | All Organisms → cellular organisms → Bacteria | 2549 | Open in IMG/M |
| 3300010360|Ga0126372_10147112 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1875 | Open in IMG/M |
| 3300010360|Ga0126372_12690005 | All Organisms → cellular organisms → Bacteria | 549 | Open in IMG/M |
| 3300010362|Ga0126377_11634156 | All Organisms → cellular organisms → Bacteria | 719 | Open in IMG/M |
| 3300010362|Ga0126377_11821904 | All Organisms → cellular organisms → Bacteria | 684 | Open in IMG/M |
| 3300010362|Ga0126377_13238443 | All Organisms → cellular organisms → Bacteria | 526 | Open in IMG/M |
| 3300010366|Ga0126379_10408513 | All Organisms → cellular organisms → Bacteria | 1407 | Open in IMG/M |
| 3300010398|Ga0126383_10852426 | All Organisms → cellular organisms → Bacteria | 996 | Open in IMG/M |
| 3300010400|Ga0134122_11796282 | All Organisms → cellular organisms → Bacteria | 645 | Open in IMG/M |
| 3300011419|Ga0137446_1014863 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1533 | Open in IMG/M |
| 3300012200|Ga0137382_10500023 | All Organisms → cellular organisms → Bacteria | 863 | Open in IMG/M |
| 3300012203|Ga0137399_10971500 | All Organisms → cellular organisms → Bacteria | 715 | Open in IMG/M |
| 3300012228|Ga0137459_1072094 | All Organisms → cellular organisms → Bacteria | 991 | Open in IMG/M |
| 3300012582|Ga0137358_10276893 | All Organisms → cellular organisms → Bacteria | 1140 | Open in IMG/M |
| 3300012922|Ga0137394_11489130 | All Organisms → cellular organisms → Bacteria | 536 | Open in IMG/M |
| 3300012961|Ga0164302_10305792 | All Organisms → cellular organisms → Bacteria | 1041 | Open in IMG/M |
| 3300013100|Ga0157373_10945689 | All Organisms → cellular organisms → Bacteria | 641 | Open in IMG/M |
| 3300013306|Ga0163162_10176432 | All Organisms → cellular organisms → Bacteria | 2262 | Open in IMG/M |
| 3300013306|Ga0163162_12722425 | All Organisms → cellular organisms → Bacteria | 569 | Open in IMG/M |
| 3300013307|Ga0157372_12346461 | All Organisms → cellular organisms → Bacteria | 613 | Open in IMG/M |
| 3300015262|Ga0182007_10042896 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1505 | Open in IMG/M |
| 3300015372|Ga0132256_100502845 | All Organisms → cellular organisms → Bacteria | 1323 | Open in IMG/M |
| 3300015373|Ga0132257_101213974 | All Organisms → cellular organisms → Bacteria | 955 | Open in IMG/M |
| 3300017659|Ga0134083_10042753 | All Organisms → cellular organisms → Bacteria | 1688 | Open in IMG/M |
| 3300017997|Ga0184610_1163719 | All Organisms → cellular organisms → Bacteria | 734 | Open in IMG/M |
| 3300018084|Ga0184629_10117004 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1322 | Open in IMG/M |
| 3300018482|Ga0066669_11597794 | All Organisms → cellular organisms → Bacteria | 595 | Open in IMG/M |
| 3300019356|Ga0173481_10755194 | All Organisms → cellular organisms → Bacteria | 532 | Open in IMG/M |
| 3300021344|Ga0193719_10027175 | All Organisms → cellular organisms → Bacteria | 2460 | Open in IMG/M |
| 3300024279|Ga0247692_1052711 | All Organisms → cellular organisms → Bacteria | 631 | Open in IMG/M |
| 3300025923|Ga0207681_11119403 | All Organisms → cellular organisms → Bacteria | 661 | Open in IMG/M |
| 3300025937|Ga0207669_11024011 | All Organisms → cellular organisms → Bacteria | 695 | Open in IMG/M |
| 3300025937|Ga0207669_11490156 | All Organisms → cellular organisms → Bacteria | 577 | Open in IMG/M |
| 3300025981|Ga0207640_10658027 | All Organisms → cellular organisms → Bacteria | 893 | Open in IMG/M |
| 3300026089|Ga0207648_10460268 | All Organisms → cellular organisms → Bacteria | 1159 | Open in IMG/M |
| 3300026095|Ga0207676_10942053 | All Organisms → cellular organisms → Bacteria | 849 | Open in IMG/M |
| 3300026102|Ga0208914_1007632 | All Organisms → cellular organisms → Bacteria | 1138 | Open in IMG/M |
| 3300026297|Ga0209237_1027085 | All Organisms → cellular organisms → Bacteria | 3178 | Open in IMG/M |
| 3300026306|Ga0209468_1036267 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1706 | Open in IMG/M |
| 3300026323|Ga0209472_1319022 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 500 | Open in IMG/M |
| 3300026331|Ga0209267_1132879 | All Organisms → cellular organisms → Bacteria | 1040 | Open in IMG/M |
| 3300026332|Ga0209803_1006137 | All Organisms → cellular organisms → Bacteria | 6754 | Open in IMG/M |
| 3300026369|Ga0257152_1031224 | All Organisms → cellular organisms → Bacteria | 574 | Open in IMG/M |
| 3300026527|Ga0209059_1248455 | All Organisms → cellular organisms → Bacteria | 597 | Open in IMG/M |
| 3300026547|Ga0209156_10036636 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2721 | Open in IMG/M |
| 3300027614|Ga0209970_1118023 | All Organisms → cellular organisms → Bacteria | 512 | Open in IMG/M |
| 3300027654|Ga0209799_1049322 | All Organisms → cellular organisms → Bacteria | 941 | Open in IMG/M |
| 3300027654|Ga0209799_1130914 | All Organisms → cellular organisms → Bacteria | 571 | Open in IMG/M |
| 3300027682|Ga0209971_1122150 | All Organisms → cellular organisms → Bacteria | 640 | Open in IMG/M |
| 3300027775|Ga0209177_10394382 | All Organisms → cellular organisms → Bacteria | 553 | Open in IMG/M |
| 3300027873|Ga0209814_10115084 | All Organisms → cellular organisms → Bacteria | 1145 | Open in IMG/M |
| 3300027907|Ga0207428_10377075 | All Organisms → cellular organisms → Bacteria | 1041 | Open in IMG/M |
| 3300027909|Ga0209382_10380389 | All Organisms → cellular organisms → Bacteria | 1575 | Open in IMG/M |
| 3300027909|Ga0209382_11271367 | All Organisms → cellular organisms → Bacteria | 748 | Open in IMG/M |
| 3300028536|Ga0137415_10022554 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 6223 | Open in IMG/M |
| 3300028536|Ga0137415_10540987 | All Organisms → cellular organisms → Bacteria | 974 | Open in IMG/M |
| 3300028811|Ga0307292_10502251 | All Organisms → cellular organisms → Bacteria | 520 | Open in IMG/M |
| 3300031184|Ga0307499_10198852 | All Organisms → cellular organisms → Bacteria | 616 | Open in IMG/M |
| 3300031544|Ga0318534_10618224 | All Organisms → cellular organisms → Bacteria | 615 | Open in IMG/M |
| 3300031548|Ga0307408_101208141 | All Organisms → cellular organisms → Bacteria | 705 | Open in IMG/M |
| 3300031548|Ga0307408_101931549 | All Organisms → cellular organisms → Bacteria | 566 | Open in IMG/M |
| 3300031713|Ga0318496_10295891 | All Organisms → cellular organisms → Bacteria | 893 | Open in IMG/M |
| 3300031740|Ga0307468_100503242 | All Organisms → cellular organisms → Bacteria | 961 | Open in IMG/M |
| 3300031740|Ga0307468_100714105 | All Organisms → cellular organisms → Bacteria | 840 | Open in IMG/M |
| 3300031819|Ga0318568_10797561 | All Organisms → cellular organisms → Bacteria | 586 | Open in IMG/M |
| 3300031820|Ga0307473_11474343 | All Organisms → cellular organisms → Bacteria | 515 | Open in IMG/M |
| 3300031821|Ga0318567_10901046 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 501 | Open in IMG/M |
| 3300031824|Ga0307413_11429728 | All Organisms → cellular organisms → Bacteria | 609 | Open in IMG/M |
| 3300031892|Ga0310893_10141966 | All Organisms → cellular organisms → Bacteria | 925 | Open in IMG/M |
| 3300031901|Ga0307406_11618625 | Not Available | 572 | Open in IMG/M |
| 3300032010|Ga0318569_10209168 | All Organisms → cellular organisms → Bacteria | 904 | Open in IMG/M |
| 3300032059|Ga0318533_10631348 | All Organisms → cellular organisms → Bacteria | 786 | Open in IMG/M |
| 3300032075|Ga0310890_11209984 | All Organisms → cellular organisms → Bacteria | 615 | Open in IMG/M |
| 3300032089|Ga0318525_10046603 | All Organisms → cellular organisms → Bacteria | 2143 | Open in IMG/M |
| 3300032180|Ga0307471_100776640 | All Organisms → cellular organisms → Bacteria | 1124 | Open in IMG/M |
| 3300032261|Ga0306920_100755594 | All Organisms → cellular organisms → Bacteria | 1430 | Open in IMG/M |
| 3300032421|Ga0310812_10208154 | All Organisms → cellular organisms → Bacteria | 850 | Open in IMG/M |
| 3300033289|Ga0310914_11083721 | All Organisms → cellular organisms → Bacteria | 702 | Open in IMG/M |
| 3300033485|Ga0316626_10286388 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 1336 | Open in IMG/M |
| 3300033550|Ga0247829_10824313 | All Organisms → cellular organisms → Bacteria | 772 | Open in IMG/M |
| 3300033550|Ga0247829_11488330 | All Organisms → cellular organisms → Bacteria | 559 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 12.21% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 9.92% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 7.63% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 6.87% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 6.11% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 5.34% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 4.58% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.82% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 3.05% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 3.05% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 3.05% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 3.05% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 2.29% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.29% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 2.29% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 1.53% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.53% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.53% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 1.53% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.53% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.53% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.53% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 1.53% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.76% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.76% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.76% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.76% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.76% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.76% |
| Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 0.76% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.76% |
| Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 0.76% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.76% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.76% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.76% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.76% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.76% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.76% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.76% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300004156 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1 | Environmental | Open in IMG/M |
| 3300004633 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio | Environmental | Open in IMG/M |
| 3300005175 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 | Environmental | Open in IMG/M |
| 3300005177 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 | Environmental | Open in IMG/M |
| 3300005180 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 | Environmental | Open in IMG/M |
| 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 | Environmental | Open in IMG/M |
| 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Host-Associated | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Environmental | Open in IMG/M |
| 3300005451 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 | Environmental | Open in IMG/M |
| 3300005454 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 | Environmental | Open in IMG/M |
| 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
| 3300005526 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 | Environmental | Open in IMG/M |
| 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Environmental | Open in IMG/M |
| 3300005558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 | Environmental | Open in IMG/M |
| 3300005559 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 | Environmental | Open in IMG/M |
| 3300005560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119 | Environmental | Open in IMG/M |
| 3300005566 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_142 | Environmental | Open in IMG/M |
| 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
| 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Host-Associated | Open in IMG/M |
| 3300006032 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 | Environmental | Open in IMG/M |
| 3300006034 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105 | Environmental | Open in IMG/M |
| 3300006049 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 | Host-Associated | Open in IMG/M |
| 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
| 3300006853 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4 | Host-Associated | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
| 3300006918 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS100 | Environmental | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Environmental | Open in IMG/M |
| 3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300009800 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N2_30_40 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010323 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
| 3300011419 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT357_2 | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012228 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT700_2 | Environmental | Open in IMG/M |
| 3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
| 3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
| 3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
| 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Host-Associated | Open in IMG/M |
| 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
| 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
| 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Host-Associated | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300017659 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300017997 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_coex | Environmental | Open in IMG/M |
| 3300018084 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_b1 | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300019356 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2 (version 2) | Environmental | Open in IMG/M |
| 3300021344 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2a2 | Environmental | Open in IMG/M |
| 3300024279 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK33 | Environmental | Open in IMG/M |
| 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026102 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_TuleA_D1 (SPAdes) | Environmental | Open in IMG/M |
| 3300026297 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026306 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 (SPAdes) | Environmental | Open in IMG/M |
| 3300026323 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 (SPAdes) | Environmental | Open in IMG/M |
| 3300026331 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 (SPAdes) | Environmental | Open in IMG/M |
| 3300026332 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 (SPAdes) | Environmental | Open in IMG/M |
| 3300026369 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-05-A | Environmental | Open in IMG/M |
| 3300026527 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 (SPAdes) | Environmental | Open in IMG/M |
| 3300026547 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 (SPAdes) | Environmental | Open in IMG/M |
| 3300027614 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027654 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027775 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control (SPAdes) | Environmental | Open in IMG/M |
| 3300027873 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027907 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300028811 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_149 | Environmental | Open in IMG/M |
| 3300031184 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 13_S | Environmental | Open in IMG/M |
| 3300031544 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26 | Environmental | Open in IMG/M |
| 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Host-Associated | Open in IMG/M |
| 3300031713 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22 | Environmental | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031819 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21 | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300031821 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f20 | Environmental | Open in IMG/M |
| 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Host-Associated | Open in IMG/M |
| 3300031892 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D2 | Environmental | Open in IMG/M |
| 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Host-Associated | Open in IMG/M |
| 3300032010 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f22 | Environmental | Open in IMG/M |
| 3300032059 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27 | Environmental | Open in IMG/M |
| 3300032075 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D3 | Environmental | Open in IMG/M |
| 3300032089 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f23 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300032421 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NN3 | Environmental | Open in IMG/M |
| 3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
| 3300033485 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_T1_C1_D5_A | Environmental | Open in IMG/M |
| 3300033550 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day4 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| Ga0062589_1004924672 | 3300004156 | Soil | ATGVVTQIGWDGEKHTLWPWDLASKAKFKAVYPSPSWQERDSKPKPAS* |
| Ga0066395_103337981 | 3300004633 | Tropical Forest Soil | VVTQIGWDDEKHTIWPWDLAAKADFKPIFPSPGWQERESRPKSTK* |
| Ga0066673_105454471 | 3300005175 | Soil | GWDGEKHTLWPWDLAARANFKPIFPSPSWQERESKPKPAN* |
| Ga0066690_101483651 | 3300005177 | Soil | GWDGEKHTLWPWDLATKANFKPIFPSPSWQERESKPKPAG* |
| Ga0066685_108360371 | 3300005180 | Soil | VVTQIGWDGEKHTLWPWDLAAKSGFKAVYPNPSWQERDSKPKPN* |
| Ga0065707_105451961 | 3300005295 | Switchgrass Rhizosphere | QIGWDGEKHTLWPWDLASKAGFKPMFPNPSWQERDARPKPAS* |
| Ga0070670_1010733831 | 3300005331 | Switchgrass Rhizosphere | VTQVGWDDEKHTIWPWNLAAQSGFKPIFPSPGWQERESRSKK* |
| Ga0066388_1035075261 | 3300005332 | Tropical Forest Soil | TQIGWDDEKHTIWPWDLAKKADFKMIFPSPSWAERESKSKAK* |
| Ga0066388_1060801141 | 3300005332 | Tropical Forest Soil | GWDGEKHTVWPWDMAAKAGFKPVFPNPNWQERESKPKPN* |
| Ga0070674_1012583882 | 3300005356 | Miscanthus Rhizosphere | ASGVVTQVGWDDDKHTIWPWNLAAQSGFKPIFPSPTWQERESRSKK* |
| Ga0070701_108064002 | 3300005438 | Corn, Switchgrass And Miscanthus Rhizosphere | ATGVVTQIGWDNDKHTIWPWDLAAQAGFKTMYPAPSWPERESHKK* |
| Ga0066681_102033791 | 3300005451 | Soil | TQIGWDGEKHTVWPWELAKRAGFKVLHPNPGWQERESKPKPAS* |
| Ga0066687_105239771 | 3300005454 | Soil | VTQVGWDGEKHTLWPWDLATKANFKPIFPSPSWQERESKPKPAG* |
| Ga0070662_1000167907 | 3300005457 | Corn Rhizosphere | VTQIGWDGEKHTIWPWDLAKQAGYTPVYPSPNWQERDAKPKPAK* |
| Ga0070662_1016425101 | 3300005457 | Corn Rhizosphere | VTQIGWDGEKHTIWPWDVAIKAEFKPLFPNPSWQEREAKPKPAK* |
| Ga0070698_1013782852 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | VVTQIGWDGEKHTIWPWDLATKAKFQMLFPNPTWQERDTKPKPS* |
| Ga0073909_107075372 | 3300005526 | Surface Soil | GWDDEKHTIWPWDLAAQAGFKPIFPSPTWQERESHIKK* |
| Ga0070696_1018323862 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | WDGEKHTIWPWDLATKANFKVIHPSPNWQERDSKPKPAN* |
| Ga0066698_109681862 | 3300005558 | Soil | VTQIGWDDEKHTIWPWDLAAQAGFKPIFPSPSWQERESRTKK* |
| Ga0066700_111298832 | 3300005559 | Soil | GEKHTIWPWDLAKRANFKVLYPSPGWQERDTKPKPAN* |
| Ga0066670_101404553 | 3300005560 | Soil | QIGWDGEKHTLWPWDLASKAGFKPIFPNPGWQERDSTPKPAS* |
| Ga0066693_101282631 | 3300005566 | Soil | GWDGEKHTIWPSDLAKRANFKMLYPNPSWPERDAKPKPAK* |
| Ga0068859_1006109863 | 3300005617 | Switchgrass Rhizosphere | TQVGWDGEKHTLWPWDLAARANFKPLFPSPSWQERESKPKPAS* |
| Ga0066905_1009177681 | 3300005713 | Tropical Forest Soil | GWDGEKHTIWPWELAKRANFKIIYPMPSWQERDSKPKPAS* |
| Ga0066905_1009734532 | 3300005713 | Tropical Forest Soil | VVTQIGWDGEKHTVWPWDLAAKSGFKPVYPNPSWQERESKPKPNN* |
| Ga0068861_1016116171 | 3300005719 | Switchgrass Rhizosphere | TQVGWDGEKHTLWPWDLATRANFKPIFPNPSWQERDSKPKPAN* |
| Ga0066903_1050494982 | 3300005764 | Tropical Forest Soil | VTQIGWDGEKHTIWPWDLAKRANFQILYPNPGWPERESKPKPAQ* |
| Ga0068863_1006241842 | 3300005841 | Switchgrass Rhizosphere | QNELASGVVTQVGWDDDKHTIWPWNLAAQSGFKAIFPSPSWQERESRSKK* |
| Ga0081455_107716271 | 3300005937 | Tabebuia Heterophylla Rhizosphere | GEKHTIWPWDLAKRANFKIIYSMPSWQERDSKPKPAS* |
| Ga0066696_104100892 | 3300006032 | Soil | TGVVTQIGWDGEKHTLWPWDLAAKSGFKPVYPNPSWQERDSKPKAN* |
| Ga0066656_103598362 | 3300006034 | Soil | ATGVVTQIGWDGEKHTLWPWDLAAKSGFKPIYPNPSWQERDSKPKPS* |
| Ga0075417_101793532 | 3300006049 | Populus Rhizosphere | ATGVVTQIGWDGEKHTLWPWDLASKSGFKALYPNPGWQERDSKPKPN* |
| Ga0070715_106221901 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | VVTQIGWDDEKHTIWPWDLAAQAGFKPIYPSPSWQERETRSKK* |
| Ga0070712_1004141301 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | NELATGVVTQIGWDDEKHTIWPWDLAAQAGFKPIYPSPSWQERETRSKK* |
| Ga0075428_1021354901 | 3300006844 | Populus Rhizosphere | IGWDGEKHTIWPWDLAKQAGYTPVYPSPTWQERDAKPKPAK* |
| Ga0075420_1002534221 | 3300006853 | Populus Rhizosphere | EKHTLWPWDLAAKANFKPIVPSPSWQERESKPKPAN* |
| Ga0075420_1007252072 | 3300006853 | Populus Rhizosphere | ATGVVTQIGWDGEKHTVWPWDMGRRANFKMVYPNPGWQERDAKPKPAS* |
| Ga0075434_1019709361 | 3300006871 | Populus Rhizosphere | QVGWDGEKHTLWPWDLAAKANFKPIFPSPSWQERESKPKPAN* |
| Ga0075436_1010427492 | 3300006914 | Populus Rhizosphere | WDGEKHTLWPWDLATKANFKPIFPSPSWQERESKPKPAS* |
| Ga0079216_115148531 | 3300006918 | Agricultural Soil | TGVVTQIGWDGEKHTIWPWELATKAKYQTLFPNPNWQERDAKPKPAN* |
| Ga0079219_119793292 | 3300006954 | Agricultural Soil | VTQVGWDGEKHTLWPWDLAAKANFKPIFPSPSWQERDSKPKPAS* |
| Ga0099795_102628742 | 3300007788 | Vadose Zone Soil | VTQIGWDDEKHTIWPWDLAAQAGFKPIYPSPSWQERETRSKK* |
| Ga0075418_105729703 | 3300009100 | Populus Rhizosphere | GVVTQIGWDGEKHTIWPWDLAKQAGYTPVYPSPNWQERDAKPKPAK* |
| Ga0066709_1044710611 | 3300009137 | Grasslands Soil | TGVVTQIGWDGEKHTLWPWDLASKAAFKAVYPNPSWQERDSKPKPN* |
| Ga0111538_123236872 | 3300009156 | Populus Rhizosphere | DGEKHSVWPWDMGRRANFKMVYPNPGWQERDAKPKPAS* |
| Ga0075423_108854861 | 3300009162 | Populus Rhizosphere | GWDGEKHTLWPWDIAAKANFKPIFPSPSWQERESKPKPAS* |
| Ga0105242_110756021 | 3300009176 | Miscanthus Rhizosphere | VVTQVGWDGEKHTLWPWDLAARANFKPIFPSPSWQERESKPKPAS* |
| Ga0126374_114124141 | 3300009792 | Tropical Forest Soil | HTIWPWDLAKQAGYTPVYPSPTWQERDAKPKPAK* |
| Ga0105069_10222441 | 3300009800 | Groundwater Sand | HTLWPWDLATKANFKPIFPSPSWQERDSKPKPGA* |
| Ga0126382_102095351 | 3300010047 | Tropical Forest Soil | DDEKHTIWPWDLAAQAGFKPLFPSPSWQERESRSKK* |
| Ga0134086_100134564 | 3300010323 | Grasslands Soil | VVTQIGWDGEKHTVWPWDLAAKSGFKAVYPSPSWQERESKPKPAN* |
| Ga0126372_101471121 | 3300010360 | Tropical Forest Soil | QVGWDGEKHTLWPWDLATRANFKPIFPSPSWQERESKPKPAS* |
| Ga0126372_126900052 | 3300010360 | Tropical Forest Soil | GEKHTIWPWDLAKRANFKIIYPMPSWQERDSKPKPAS* |
| Ga0126377_116341561 | 3300010362 | Tropical Forest Soil | TQIGWDDEKHTIWPWDLAAQANFKPIFPSPTWQERESRKK* |
| Ga0126377_118219041 | 3300010362 | Tropical Forest Soil | ATGVVTQVGWDGEKHTLWPWDLAAKANFKPIFPSPSWQERDSKPKPGS* |
| Ga0126377_132384432 | 3300010362 | Tropical Forest Soil | WDDEKHTIWPWDLAAQAGFKAIFPSPSWQERESKTKK* |
| Ga0126379_104085133 | 3300010366 | Tropical Forest Soil | ATGVVTQVGWDGEKHTIWPWDLAKRANFKIIYPMPSWQERDSKPKPAS* |
| Ga0126383_108524261 | 3300010398 | Tropical Forest Soil | NQKHTIWPWDLAAQAGFTPIFPFPTWAERESHKN* |
| Ga0134122_117962822 | 3300010400 | Terrestrial Soil | VVTQVGWDGEKHTLWPWDLATRANFKPIFPSPSWQERDSKPKPGAN* |
| Ga0137446_10148631 | 3300011419 | Soil | TQVGWDNQKHTIWPWDLATLAGFKPIFPAPGWQERETKK* |
| Ga0137382_105000231 | 3300012200 | Vadose Zone Soil | QVGWDGEKHTIWPWDLAKRANFKVLYPSPGWQERDTKPKPAN* |
| Ga0137399_109715002 | 3300012203 | Vadose Zone Soil | VVTQIGWDGEKHTVWPWDLAKRADFKPLYPTPAWLERDSKPKPGA* |
| Ga0137459_10720942 | 3300012228 | Soil | ASGVVTQVGWDDDKHTIWPWNLAAQSGFKAIFPSPSWQERESRSKK* |
| Ga0137358_102768931 | 3300012582 | Vadose Zone Soil | LATGVVTQIGWDGEKHTIWPWELAKRANFKIIFPSPSWQERDSKPKPAS* |
| Ga0137394_114891302 | 3300012922 | Vadose Zone Soil | GWDGEKHTLWPWDLAAKSGFKAVYPNPSWQERDSKPKPN* |
| Ga0164302_103057921 | 3300012961 | Soil | ATGVVTQIGWDNDKHTIWPWDLAAQAGFKTMYPAPSWQERESHKK* |
| Ga0157373_109456891 | 3300013100 | Corn Rhizosphere | TGAVTQVGWDGEKHTLWPWDLAAKANFKPIFPSPSWQERDSKPKPGS* |
| Ga0163162_101764321 | 3300013306 | Switchgrass Rhizosphere | QVGWDGEKHTLWPWDLATRANFKPIFPSPSWQERDSKPKPGAN* |
| Ga0163162_127224251 | 3300013306 | Switchgrass Rhizosphere | IGWDGEKHTIWPWEMAKRANFKILFPSPSWQERDSKPKPAS* |
| Ga0157372_123464612 | 3300013307 | Corn Rhizosphere | WDGEKHTLWPWDLATRANFKPIFPSPSWQERDSKPKPGAN* |
| Ga0182007_100428963 | 3300015262 | Rhizosphere | IGWDNDKHTIWPWDLAAQAGFKTMYPAPSWPERESHKK* |
| Ga0132256_1005028451 | 3300015372 | Arabidopsis Rhizosphere | LATGVVTQIGWNGAKHTIWPWDLAKQAEYKVVHPSPSWQERDARPKP* |
| Ga0132257_1012139742 | 3300015373 | Arabidopsis Rhizosphere | LASGVVTQVGWDDEKHTIWPWDLAAQANFKPIFPSPSWQERDSRKK* |
| Ga0134083_100427531 | 3300017659 | Grasslands Soil | TQIGWDGEKHTVWPWDLAAKSGFKAVYPSPSWQERESKPKPN |
| Ga0184610_11637192 | 3300017997 | Groundwater Sediment | VVTQIGWDDEKHTIWPWDLAAQAGFKPIFPSPSWQEREARSKK |
| Ga0184629_101170043 | 3300018084 | Groundwater Sediment | DGEKHTLWPWDLAAKSGFKAVYPNPSWQERDSKPKPN |
| Ga0066669_115977941 | 3300018482 | Grasslands Soil | QIGWDGEKHTVWPWDLATKSGFKPLYPNPGWQERDSKPKPN |
| Ga0173481_107551941 | 3300019356 | Soil | WDDEKHTIWPWDLATQAGFKTIFPSPSWQERESKTKK |
| Ga0193719_100271751 | 3300021344 | Soil | DEKHTIWPWDLAAQAGFKPIFPSPSWQEREARSKK |
| Ga0247692_10527111 | 3300024279 | Soil | LATGVVTQVGWDGEKHTLWPWDLATKANFKPIFPSPSWQERESKPKPAS |
| Ga0207681_111194032 | 3300025923 | Switchgrass Rhizosphere | LASGVVTQVGWDDEKHTIWPWNLAAQSGFKPIFPSPGWQERESRSKK |
| Ga0207669_110240111 | 3300025937 | Miscanthus Rhizosphere | ATGVVTQIGWDNDKHTIWPWDLAAQAGFKTMYPAPSWPERESHKK |
| Ga0207669_114901561 | 3300025937 | Miscanthus Rhizosphere | GVVTQVGWDGEKHTLWPWDLATRANFKPIFPSPSWQERDSKPKPGAN |
| Ga0207640_106580271 | 3300025981 | Corn Rhizosphere | VGWDGEKHTLWPWDLAARANFKPLFPSPSWQERESKPKPAS |
| Ga0207648_104602683 | 3300026089 | Miscanthus Rhizosphere | WDGEKHTLWPWDIAAKANFKPIFPSPSWQERESKPKPAS |
| Ga0207676_109420532 | 3300026095 | Switchgrass Rhizosphere | TQVGWDDDKHTIWPWNLAAQSGFKAIFPSPSWQERESRSKK |
| Ga0208914_10076321 | 3300026102 | Natural And Restored Wetlands | GWDNEKHTIWPWDLAKQAGFKTIFPAPGWQERDSKK |
| Ga0209237_10270851 | 3300026297 | Grasslands Soil | VVTQIGWDGEKHTVWPWDLAAKSGFKAVYPSPSWQERESKPKPN |
| Ga0209468_10362673 | 3300026306 | Soil | LATGVVTQVGWDGEKHTLWPWDLATKANFKPIFPSPSWQERESKPKPAG |
| Ga0209472_13190222 | 3300026323 | Soil | DGEKHTVWPWELAKRAGFKVLHPNPGWQERESKPKPAS |
| Ga0209267_11328793 | 3300026331 | Soil | VGWDDQKHTIWPWDLAKRAGYTMIHPNPSWAERDAKPKPR |
| Ga0209803_10061371 | 3300026332 | Soil | DGEKHTLWPWDLAAKSGFKPIHPNPGWQERDSKPKPN |
| Ga0257152_10312241 | 3300026369 | Soil | IGWDGEKHTIWPWELAKRANFKIIFPSPSWQERDSKPKPAS |
| Ga0209059_12484551 | 3300026527 | Soil | VGWDGEKHTLWPWDLATKANFKPIFPSPSWQERESKPKPAG |
| Ga0209156_100366361 | 3300026547 | Soil | TQVGWDGEKHTLWPWDLAARANFKPIFPSPSWQERDSKPKPGN |
| Ga0209970_11180232 | 3300027614 | Arabidopsis Thaliana Rhizosphere | ELASGVVTQIGWDGEKHTIWPWDLAKQAGYTPVYPSPNWQERDAKPKPAK |
| Ga0209799_10493221 | 3300027654 | Tropical Forest Soil | GEKHTIWPWELAKRANFKIIYPMPSWQERDSKPKPAS |
| Ga0209799_11309141 | 3300027654 | Tropical Forest Soil | TQVGWDGEKHTIWPWDLAKRANFKIIYPMPSWQERDSKPKPAS |
| Ga0209971_11221501 | 3300027682 | Arabidopsis Thaliana Rhizosphere | VTQIGWDGEKHTLWPWDLASKAKFKAVYPSPSWQERDSKPKPAS |
| Ga0209177_103943822 | 3300027775 | Agricultural Soil | VTQVGWDGEKHTLWPWDLAAKANFKPIFPSPSWQERDSKPKPAS |
| Ga0209814_101150841 | 3300027873 | Populus Rhizosphere | GWDGEKHTLWPWDLASKSGFKALYPNPGWQERDSKPKPN |
| Ga0207428_103770752 | 3300027907 | Populus Rhizosphere | ELATGVVTQIGWDGEKHTIWPWDLAKQAGYTPVYPSPTWQERDAKPKPAK |
| Ga0209382_103803891 | 3300027909 | Populus Rhizosphere | GWDGEKHTLWPWDLATKAGFKPVFPNPSWQERDSKPKPAS |
| Ga0209382_112713672 | 3300027909 | Populus Rhizosphere | GWDGEKHTIWPWDLAAKAKFPVLFPNPNWQERDTKPKPAS |
| Ga0137415_1002255410 | 3300028536 | Vadose Zone Soil | QIGWDGEKHTLWPWDLASKAGFKPIFPNPGWQERDSTPKPAS |
| Ga0137415_105409872 | 3300028536 | Vadose Zone Soil | VVTQIGWDGEKHTLWPWDLAAKSGFKPVYPNPSWQERDSKPKPN |
| Ga0307292_105022511 | 3300028811 | Soil | QIGWDDEKHTIWPWDLAAQAGFKPIFPSPSWQEREARSKK |
| Ga0307499_101988521 | 3300031184 | Soil | VVTQVGWDGEKHTLWPWDLATRANFKPIFPSPSWQERDSKPKPAN |
| Ga0318534_106182241 | 3300031544 | Soil | TQVGWDGEKHTIWPWDLAKRANFQIIYPNPAWPERESKPKPAQ |
| Ga0307408_1012081411 | 3300031548 | Rhizosphere | NVLATGVVTQIGWDGEKHTLWPWDLASKAKFKPIHPSPSWQERDSKPKPAS |
| Ga0307408_1019315491 | 3300031548 | Rhizosphere | GVVTQIGWDGEKHTLWPWDLASKANFKALYPNPSWQERDSKPKPGN |
| Ga0318496_102958914 | 3300031713 | Soil | KHTIWPWELAKRANFKIIYPMPSWQERDSKPKPAS |
| Ga0307468_1005032421 | 3300031740 | Hardwood Forest Soil | VVTQVGWDDDKHTIWPWNLAAQSGFKPIFPSPSWQERESRSKK |
| Ga0307468_1007141052 | 3300031740 | Hardwood Forest Soil | VVTQVGWDGEKHTLWPWDMATKANFKPIFPSPSWQERESKPKPAS |
| Ga0318568_107975611 | 3300031819 | Soil | SGVVTQVGWDGEKHTIWPWELAKRANFKIIYPMPSWQERDSKPKPAS |
| Ga0307473_114743431 | 3300031820 | Hardwood Forest Soil | KHTLWPWELATKANFKPIFPSPSWQERESKPKPSS |
| Ga0318567_109010461 | 3300031821 | Soil | QIGWDGEKHTIWPSELAKRANFTILYPNPGWRERESKPKPAQ |
| Ga0307413_114297281 | 3300031824 | Rhizosphere | GWDGEKHTLWPWDLATKSGFKAIHPSPSWPERDSKPKPAS |
| Ga0310893_101419661 | 3300031892 | Soil | NVLATGVVTQVGWDGEKHTLWPWDLAAKANFKPIFPSPSWQERDSKPKPGS |
| Ga0307406_116186251 | 3300031901 | Rhizosphere | GVVTQIGWDGEKHTLWPWDLASKVGFKAIHPNPSWQERDSKPKPAS |
| Ga0318569_102091682 | 3300032010 | Soil | GWDGEKHTIWPWELAKRANFKIIFPMPSWQERDSKPKPAS |
| Ga0318533_106313481 | 3300032059 | Soil | GWDGEKHTIWPSELAKRANFTILYPNPGWRERESKPKPAP |
| Ga0310890_112099841 | 3300032075 | Soil | LATGVVTQVGWDGEKHTLWPWDLATRANFKPIFPSPSWQERDSKPKPGA |
| Ga0318525_100466031 | 3300032089 | Soil | KHTIWPWELAKRANFKIIFPMPSWQERDSKPKPAS |
| Ga0307471_1007766403 | 3300032180 | Hardwood Forest Soil | GWDGEKHTIWPWELAKRANFKIIFPSPSWQERDSKPKPAS |
| Ga0306920_1007555943 | 3300032261 | Soil | QIGWDDEKHTVWPWDLAAQAGFKTIYPAPNWQERESRSKK |
| Ga0310812_102081542 | 3300032421 | Soil | VTQVGWDGEKHTLWPWDLAARANFKPIFPNPSWQERDSKPKPAN |
| Ga0310914_110837211 | 3300033289 | Soil | ATGVVTQVGWDGEKHTLWPWDLATRANFKPIFPSPSWQERESKPKPAS |
| Ga0316626_102863881 | 3300033485 | Soil | VTQIGWDGEKHTLWPWDLATKAGFKAIYPNPSWQERDSKPKPGA |
| Ga0247829_108243131 | 3300033550 | Soil | GVVTQVGWDDEKHTIWPWDLAAQAGFKPIFPSPSWQERETRSKK |
| Ga0247829_114883301 | 3300033550 | Soil | NVLATGVVTQIGWDGEKHTLWPWDLASKSGFKPLYPNPSWQERDSKPKPN |
| ⦗Top⦘ |