| Basic Information | |
|---|---|
| Family ID | F062142 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 131 |
| Average Sequence Length | 46 residues |
| Representative Sequence | MARILAAITNALRVDSHTNEKVHFHAGPAGPYVCENPSCVSPGLDA |
| Number of Associated Samples | 93 |
| Number of Associated Scaffolds | 131 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 81.68 % |
| % of genes near scaffold ends (potentially truncated) | 25.19 % |
| % of genes from short scaffolds (< 2000 bps) | 89.31 % |
| Associated GOLD sequencing projects | 89 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.31 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (86.260 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (31.298 % of family members) |
| Environment Ontology (ENVO) | Unclassified (30.534 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (51.145 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 20.27% β-sheet: 13.51% Coil/Unstructured: 66.22% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.31 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 131 Family Scaffolds |
|---|---|---|
| PF00106 | adh_short | 49.62 |
| PF13561 | adh_short_C2 | 9.92 |
| PF02894 | GFO_IDH_MocA_C | 3.82 |
| PF01925 | TauE | 2.29 |
| PF01408 | GFO_IDH_MocA | 2.29 |
| PF02811 | PHP | 2.29 |
| PF02775 | TPP_enzyme_C | 2.29 |
| PF00342 | PGI | 0.76 |
| PF00528 | BPD_transp_1 | 0.76 |
| PF00440 | TetR_N | 0.76 |
| PF00107 | ADH_zinc_N | 0.76 |
| PF00171 | Aldedh | 0.76 |
| PF07553 | Lipoprotein_Ltp | 0.76 |
| PF01609 | DDE_Tnp_1 | 0.76 |
| PF08501 | Shikimate_dh_N | 0.76 |
| PF05988 | DUF899 | 0.76 |
| PF00933 | Glyco_hydro_3 | 0.76 |
| COG ID | Name | Functional Category | % Frequency in 131 Family Scaffolds |
|---|---|---|---|
| COG0673 | Predicted dehydrogenase | General function prediction only [R] | 3.82 |
| COG0730 | Sulfite exporter TauE/SafE/YfcA and related permeases, UPF0721 family | Inorganic ion transport and metabolism [P] | 2.29 |
| COG0014 | Gamma-glutamyl phosphate reductase | Amino acid transport and metabolism [E] | 0.76 |
| COG0166 | Glucose-6-phosphate isomerase | Carbohydrate transport and metabolism [G] | 0.76 |
| COG0169 | Shikimate 5-dehydrogenase | Amino acid transport and metabolism [E] | 0.76 |
| COG1012 | Acyl-CoA reductase or other NAD-dependent aldehyde dehydrogenase | Lipid transport and metabolism [I] | 0.76 |
| COG1472 | Periplasmic beta-glucosidase and related glycosidases | Carbohydrate transport and metabolism [G] | 0.76 |
| COG3039 | Transposase and inactivated derivatives, IS5 family | Mobilome: prophages, transposons [X] | 0.76 |
| COG3293 | Transposase | Mobilome: prophages, transposons [X] | 0.76 |
| COG3385 | IS4 transposase InsG | Mobilome: prophages, transposons [X] | 0.76 |
| COG4230 | Delta 1-pyrroline-5-carboxylate dehydrogenase | Amino acid transport and metabolism [E] | 0.76 |
| COG4312 | Predicted dithiol-disulfide oxidoreductase, DUF899 family | General function prediction only [R] | 0.76 |
| COG5421 | Transposase | Mobilome: prophages, transposons [X] | 0.76 |
| COG5433 | Predicted transposase YbfD/YdcC associated with H repeats | Mobilome: prophages, transposons [X] | 0.76 |
| COG5659 | SRSO17 transposase | Mobilome: prophages, transposons [X] | 0.76 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 86.26 % |
| Unclassified | root | N/A | 13.74 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000033|ICChiseqgaiiDRAFT_c2274403 | All Organisms → cellular organisms → Bacteria | 751 | Open in IMG/M |
| 3300000956|JGI10216J12902_105493004 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 556 | Open in IMG/M |
| 3300001686|C688J18823_10477427 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 801 | Open in IMG/M |
| 3300002568|C688J35102_117949231 | Not Available | 518 | Open in IMG/M |
| 3300002568|C688J35102_118008396 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 522 | Open in IMG/M |
| 3300002568|C688J35102_118263402 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium → unclassified Mesorhizobium → Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 | 543 | Open in IMG/M |
| 3300004081|Ga0063454_100231558 | All Organisms → cellular organisms → Bacteria | 1086 | Open in IMG/M |
| 3300004081|Ga0063454_100907592 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 697 | Open in IMG/M |
| 3300004081|Ga0063454_101180682 | All Organisms → cellular organisms → Bacteria | 632 | Open in IMG/M |
| 3300004081|Ga0063454_101241263 | Not Available | 620 | Open in IMG/M |
| 3300004153|Ga0063455_100291567 | All Organisms → cellular organisms → Bacteria | 888 | Open in IMG/M |
| 3300004156|Ga0062589_102859562 | Not Available | 504 | Open in IMG/M |
| 3300005093|Ga0062594_101265845 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 737 | Open in IMG/M |
| 3300005343|Ga0070687_100717432 | All Organisms → cellular organisms → Bacteria | 700 | Open in IMG/M |
| 3300005455|Ga0070663_101651782 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 572 | Open in IMG/M |
| 3300005456|Ga0070678_100458348 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1118 | Open in IMG/M |
| 3300005614|Ga0068856_100950817 | All Organisms → cellular organisms → Bacteria | 878 | Open in IMG/M |
| 3300005614|Ga0068856_102648778 | Not Available | 507 | Open in IMG/M |
| 3300005615|Ga0070702_100152968 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1483 | Open in IMG/M |
| 3300005616|Ga0068852_102335687 | All Organisms → cellular organisms → Bacteria | 556 | Open in IMG/M |
| 3300005718|Ga0068866_11383607 | All Organisms → cellular organisms → Bacteria | 514 | Open in IMG/M |
| 3300005719|Ga0068861_102388294 | Not Available | 531 | Open in IMG/M |
| 3300005841|Ga0068863_100921006 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 875 | Open in IMG/M |
| 3300006038|Ga0075365_10302107 | All Organisms → cellular organisms → Bacteria | 1126 | Open in IMG/M |
| 3300006038|Ga0075365_10799366 | All Organisms → cellular organisms → Bacteria | 666 | Open in IMG/M |
| 3300006046|Ga0066652_101455668 | All Organisms → cellular organisms → Bacteria | 638 | Open in IMG/M |
| 3300006169|Ga0082029_1291681 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 574 | Open in IMG/M |
| 3300006844|Ga0075428_101058248 | All Organisms → cellular organisms → Bacteria | 858 | Open in IMG/M |
| 3300006853|Ga0075420_100840117 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 791 | Open in IMG/M |
| 3300006854|Ga0075425_102883367 | Not Available | 528 | Open in IMG/M |
| 3300006914|Ga0075436_100984107 | All Organisms → cellular organisms → Bacteria | 633 | Open in IMG/M |
| 3300009094|Ga0111539_11638149 | All Organisms → cellular organisms → Bacteria | 746 | Open in IMG/M |
| 3300009098|Ga0105245_11881545 | All Organisms → cellular organisms → Bacteria | 651 | Open in IMG/M |
| 3300009156|Ga0111538_13683219 | Not Available | 531 | Open in IMG/M |
| 3300009176|Ga0105242_10836736 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 914 | Open in IMG/M |
| 3300009177|Ga0105248_11609847 | All Organisms → cellular organisms → Bacteria | 736 | Open in IMG/M |
| 3300009789|Ga0126307_10259706 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1396 | Open in IMG/M |
| 3300009789|Ga0126307_10436472 | All Organisms → cellular organisms → Bacteria | 1057 | Open in IMG/M |
| 3300009789|Ga0126307_10589112 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 898 | Open in IMG/M |
| 3300009789|Ga0126307_10779778 | All Organisms → cellular organisms → Bacteria | 771 | Open in IMG/M |
| 3300009840|Ga0126313_10062557 | All Organisms → cellular organisms → Bacteria | 2657 | Open in IMG/M |
| 3300009840|Ga0126313_10153870 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1739 | Open in IMG/M |
| 3300009840|Ga0126313_10566855 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 913 | Open in IMG/M |
| 3300009840|Ga0126313_10742820 | All Organisms → cellular organisms → Bacteria | 796 | Open in IMG/M |
| 3300010036|Ga0126305_10459158 | All Organisms → cellular organisms → Bacteria | 846 | Open in IMG/M |
| 3300010037|Ga0126304_10041853 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2750 | Open in IMG/M |
| 3300010037|Ga0126304_10321032 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1027 | Open in IMG/M |
| 3300010038|Ga0126315_10870342 | All Organisms → cellular organisms → Bacteria | 597 | Open in IMG/M |
| 3300010039|Ga0126309_10000695 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 11201 | Open in IMG/M |
| 3300010039|Ga0126309_10188458 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1134 | Open in IMG/M |
| 3300010039|Ga0126309_10210153 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1082 | Open in IMG/M |
| 3300010039|Ga0126309_10331505 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 890 | Open in IMG/M |
| 3300010039|Ga0126309_11016456 | All Organisms → cellular organisms → Bacteria | 558 | Open in IMG/M |
| 3300010040|Ga0126308_10896120 | All Organisms → cellular organisms → Bacteria | 618 | Open in IMG/M |
| 3300010040|Ga0126308_11341887 | All Organisms → cellular organisms → Bacteria | 508 | Open in IMG/M |
| 3300010041|Ga0126312_10408025 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 966 | Open in IMG/M |
| 3300010041|Ga0126312_10719133 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Burkholderia → pseudomallei group → Burkholderia pseudomallei → Burkholderia pseudomallei 1710b | 722 | Open in IMG/M |
| 3300010042|Ga0126314_10022009 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3884 | Open in IMG/M |
| 3300010044|Ga0126310_10576587 | All Organisms → cellular organisms → Bacteria | 835 | Open in IMG/M |
| 3300010045|Ga0126311_10092106 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2062 | Open in IMG/M |
| 3300010045|Ga0126311_10214709 | All Organisms → cellular organisms → Bacteria | 1410 | Open in IMG/M |
| 3300010166|Ga0126306_10043661 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3081 | Open in IMG/M |
| 3300010166|Ga0126306_10282126 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1275 | Open in IMG/M |
| 3300010166|Ga0126306_11040932 | All Organisms → cellular organisms → Bacteria | 668 | Open in IMG/M |
| 3300010399|Ga0134127_12828444 | All Organisms → cellular organisms → Bacteria | 565 | Open in IMG/M |
| 3300012045|Ga0136623_10161905 | All Organisms → cellular organisms → Bacteria | 968 | Open in IMG/M |
| 3300012186|Ga0136620_10197258 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 894 | Open in IMG/M |
| 3300012212|Ga0150985_113290477 | Not Available | 525 | Open in IMG/M |
| 3300012380|Ga0134047_1267476 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Frankiales → Frankiaceae → Frankia → Frankia canadensis | 518 | Open in IMG/M |
| 3300012680|Ga0136612_10009975 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 4683 | Open in IMG/M |
| 3300012684|Ga0136614_10526416 | All Organisms → cellular organisms → Bacteria | 849 | Open in IMG/M |
| 3300012908|Ga0157286_10358200 | Not Available | 553 | Open in IMG/M |
| 3300012911|Ga0157301_10301042 | Not Available | 585 | Open in IMG/M |
| 3300012958|Ga0164299_10332248 | Not Available | 948 | Open in IMG/M |
| 3300013307|Ga0157372_12508279 | All Organisms → cellular organisms → Bacteria | 592 | Open in IMG/M |
| 3300013308|Ga0157375_11608525 | All Organisms → cellular organisms → Bacteria | 768 | Open in IMG/M |
| 3300015372|Ga0132256_102285840 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 644 | Open in IMG/M |
| 3300017695|Ga0180121_10029883 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1921 | Open in IMG/M |
| 3300017789|Ga0136617_10000021 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 99590 | Open in IMG/M |
| 3300018051|Ga0184620_10221345 | Not Available | 632 | Open in IMG/M |
| 3300018422|Ga0190265_10033301 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 4315 | Open in IMG/M |
| 3300018422|Ga0190265_10141481 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2337 | Open in IMG/M |
| 3300018422|Ga0190265_10359163 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1545 | Open in IMG/M |
| 3300018422|Ga0190265_10594901 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1225 | Open in IMG/M |
| 3300018422|Ga0190265_10616284 | All Organisms → cellular organisms → Bacteria | 1205 | Open in IMG/M |
| 3300018422|Ga0190265_11862691 | All Organisms → cellular organisms → Bacteria | 709 | Open in IMG/M |
| 3300018429|Ga0190272_12839163 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 535 | Open in IMG/M |
| 3300018432|Ga0190275_10026834 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 4563 | Open in IMG/M |
| 3300018432|Ga0190275_10324736 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1519 | Open in IMG/M |
| 3300018432|Ga0190275_11202277 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 833 | Open in IMG/M |
| 3300018465|Ga0190269_10261284 | All Organisms → cellular organisms → Bacteria | 983 | Open in IMG/M |
| 3300018469|Ga0190270_10015236 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 4547 | Open in IMG/M |
| 3300018469|Ga0190270_10256008 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1527 | Open in IMG/M |
| 3300018469|Ga0190270_13345493 | All Organisms → cellular organisms → Bacteria | 508 | Open in IMG/M |
| 3300018476|Ga0190274_12185482 | All Organisms → cellular organisms → Bacteria | 650 | Open in IMG/M |
| 3300018476|Ga0190274_13660720 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium → unclassified Mesorhizobium → Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 | 519 | Open in IMG/M |
| 3300018481|Ga0190271_12332736 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 640 | Open in IMG/M |
| 3300018920|Ga0190273_10829065 | All Organisms → cellular organisms → Bacteria | 738 | Open in IMG/M |
| 3300018920|Ga0190273_11586884 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 584 | Open in IMG/M |
| 3300019377|Ga0190264_10177414 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1141 | Open in IMG/M |
| 3300019377|Ga0190264_11658495 | All Organisms → cellular organisms → Bacteria | 566 | Open in IMG/M |
| 3300019377|Ga0190264_12104198 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 522 | Open in IMG/M |
| 3300019767|Ga0190267_10930243 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 599 | Open in IMG/M |
| 3300020016|Ga0193696_1074608 | All Organisms → cellular organisms → Bacteria | 883 | Open in IMG/M |
| 3300025321|Ga0207656_10496456 | Not Available | 619 | Open in IMG/M |
| 3300025901|Ga0207688_10137694 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1435 | Open in IMG/M |
| 3300025931|Ga0207644_11572792 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 552 | Open in IMG/M |
| 3300026067|Ga0207678_10076497 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2867 | Open in IMG/M |
| 3300026089|Ga0207648_11154240 | All Organisms → cellular organisms → Bacteria | 727 | Open in IMG/M |
| 3300026142|Ga0207698_10617092 | All Organisms → cellular organisms → Bacteria | 1071 | Open in IMG/M |
| 3300027761|Ga0209462_10028262 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1012 | Open in IMG/M |
| 3300028597|Ga0247820_10590954 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 765 | Open in IMG/M |
| 3300028704|Ga0307321_1082777 | Not Available | 638 | Open in IMG/M |
| 3300028704|Ga0307321_1137207 | Not Available | 514 | Open in IMG/M |
| 3300028707|Ga0307291_1006278 | All Organisms → cellular organisms → Bacteria | 2539 | Open in IMG/M |
| 3300028717|Ga0307298_10081295 | All Organisms → cellular organisms → Bacteria | 909 | Open in IMG/M |
| 3300028718|Ga0307307_10118133 | All Organisms → cellular organisms → Bacteria | 817 | Open in IMG/M |
| 3300028771|Ga0307320_10413917 | All Organisms → cellular organisms → Bacteria | 542 | Open in IMG/M |
| 3300028824|Ga0307310_10168060 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1021 | Open in IMG/M |
| 3300028875|Ga0307289_10065886 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1459 | Open in IMG/M |
| 3300028880|Ga0307300_10090958 | All Organisms → cellular organisms → Bacteria | 912 | Open in IMG/M |
| 3300028889|Ga0247827_10556493 | Not Available | 727 | Open in IMG/M |
| 3300030006|Ga0299907_10306131 | Not Available | 1295 | Open in IMG/M |
| 3300031092|Ga0308204_10222988 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium → unclassified Mesorhizobium → Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 | 598 | Open in IMG/M |
| 3300031152|Ga0307501_10230420 | All Organisms → cellular organisms → Bacteria | 543 | Open in IMG/M |
| 3300031229|Ga0299913_10678015 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1009 | Open in IMG/M |
| 3300031473|Ga0272434_1118926 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1738 | Open in IMG/M |
| 3300031740|Ga0307468_100226265 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1292 | Open in IMG/M |
| 3300032080|Ga0326721_10361220 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium | 830 | Open in IMG/M |
| 3300032080|Ga0326721_10840587 | Not Available | 578 | Open in IMG/M |
| 3300032126|Ga0307415_101915709 | All Organisms → cellular organisms → Bacteria | 576 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 31.30% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 21.37% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 6.87% |
| Polar Desert Sand | Environmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand | 4.58% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 4.58% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 3.82% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 2.29% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.53% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 1.53% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.53% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.53% |
| Populus Endosphere | Host-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere | 1.53% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.53% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 1.53% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.76% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.76% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.76% |
| Termite Nest | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Termite Nest | 0.76% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.76% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil | 0.76% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 0.76% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.76% |
| Rock | Environmental → Terrestrial → Rock-Dwelling (Endoliths) → Unclassified → Unclassified → Rock | 0.76% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.76% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.76% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 0.76% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.76% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.76% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.76% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.76% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.76% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.76% |
| Agave | Host-Associated → Plants → Phyllosphere → Phylloplane/Leaf Surface → Unclassified → Agave | 0.76% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000033 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001686 | Grasslands soil microbial communities from Hopland, California, USA | Environmental | Open in IMG/M |
| 3300002568 | Grasslands soil microbial communities from Hopland, California, USA - 2 | Environmental | Open in IMG/M |
| 3300004081 | Grasslands soil microbial communities from Hopland, California, USA - 2 (version 2) | Environmental | Open in IMG/M |
| 3300004153 | Grasslands soil microbial communities from Hopland, California, USA (version 2) | Environmental | Open in IMG/M |
| 3300004156 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1 | Environmental | Open in IMG/M |
| 3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
| 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Environmental | Open in IMG/M |
| 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Host-Associated | Open in IMG/M |
| 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Host-Associated | Open in IMG/M |
| 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Environmental | Open in IMG/M |
| 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Host-Associated | Open in IMG/M |
| 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Host-Associated | Open in IMG/M |
| 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
| 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
| 3300006038 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Host-Associated | Open in IMG/M |
| 3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
| 3300006169 | Termite nest microbial communities from Madurai, India | Environmental | Open in IMG/M |
| 3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
| 3300006853 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4 | Host-Associated | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
| 3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009789 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot28 | Environmental | Open in IMG/M |
| 3300009840 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105A | Environmental | Open in IMG/M |
| 3300010036 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot26 | Environmental | Open in IMG/M |
| 3300010037 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot25 | Environmental | Open in IMG/M |
| 3300010038 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot106 | Environmental | Open in IMG/M |
| 3300010039 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot56 | Environmental | Open in IMG/M |
| 3300010040 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot55 | Environmental | Open in IMG/M |
| 3300010041 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot104A | Environmental | Open in IMG/M |
| 3300010042 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105B | Environmental | Open in IMG/M |
| 3300010044 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot60 | Environmental | Open in IMG/M |
| 3300010045 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot61 | Environmental | Open in IMG/M |
| 3300010166 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot27 | Environmental | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300012045 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ449 (21.06) | Environmental | Open in IMG/M |
| 3300012186 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ416 (21.06) | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012380 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_0_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012680 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ224A (23.06) | Environmental | Open in IMG/M |
| 3300012684 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ279 (21.06) | Environmental | Open in IMG/M |
| 3300012908 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S089-202R-1 | Environmental | Open in IMG/M |
| 3300012911 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S088-202R-2 | Environmental | Open in IMG/M |
| 3300012958 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG | Environmental | Open in IMG/M |
| 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
| 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300017695 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ540 (21.06) (version 2) | Environmental | Open in IMG/M |
| 3300017789 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ322 (21.06) | Environmental | Open in IMG/M |
| 3300018051 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5_b1 | Environmental | Open in IMG/M |
| 3300018422 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 T | Environmental | Open in IMG/M |
| 3300018429 | Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 T | Environmental | Open in IMG/M |
| 3300018432 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 550 T | Environmental | Open in IMG/M |
| 3300018465 | Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 IS | Environmental | Open in IMG/M |
| 3300018469 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T | Environmental | Open in IMG/M |
| 3300018476 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T | Environmental | Open in IMG/M |
| 3300018481 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 T | Environmental | Open in IMG/M |
| 3300018920 | Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 IS | Environmental | Open in IMG/M |
| 3300019377 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 112 T | Environmental | Open in IMG/M |
| 3300019767 | Populus adjacent soil microbial communities from riparian zone of Oak Creek, Arizona, USA - 239 T | Environmental | Open in IMG/M |
| 3300020016 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3m1 | Environmental | Open in IMG/M |
| 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027761 | Agave microbial communities from Guanajuato, Mexico - As.Sf.rz (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028597 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Glucose_Day14 | Environmental | Open in IMG/M |
| 3300028704 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_379 | Environmental | Open in IMG/M |
| 3300028707 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_148 | Environmental | Open in IMG/M |
| 3300028717 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_158 | Environmental | Open in IMG/M |
| 3300028718 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_194 | Environmental | Open in IMG/M |
| 3300028771 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_369 | Environmental | Open in IMG/M |
| 3300028824 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_197 | Environmental | Open in IMG/M |
| 3300028875 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_143 | Environmental | Open in IMG/M |
| 3300028880 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_181 | Environmental | Open in IMG/M |
| 3300028889 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day2 | Environmental | Open in IMG/M |
| 3300030006 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT152D67 | Environmental | Open in IMG/M |
| 3300031092 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_367 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031152 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 15_S | Environmental | Open in IMG/M |
| 3300031229 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT155D38 | Environmental | Open in IMG/M |
| 3300031473 | Rock endolithic microbial communities from Victoria Land, Antarctica - Trio Nunatak nord | Environmental | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300032080 | Soil microbial communities from Southern Great Plains, Lamont, Oklahoma, United States - SGP_1_2016 | Environmental | Open in IMG/M |
| 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Host-Associated | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| ICChiseqgaiiDRAFT_22744031 | 3300000033 | Soil | MARIFAAITNALRVDSHTNEKVHFHAGPAGPYVCENPSCVSPGLEA* |
| JGI10216J12902_1054930042 | 3300000956 | Soil | MARILAAITNALRVDSHTDEKVHFHAGPAGPYVCENPSCVSPGLEA* |
| C688J18823_104774272 | 3300001686 | Soil | MARILAAITNALRVDSHTNEKVHFHAGPSGPYVCENPSCVSPGLEA* |
| C688J35102_1179492311 | 3300002568 | Soil | MARILAAISRALRDDMTMTEKVHFHAGPAGPYVCEHPGCTSPGLDPQAS* |
| C688J35102_1180083961 | 3300002568 | Soil | MARLFAAIARALREDATTENVHFHGGPDGPYVCENPRCTSPGL* |
| C688J35102_1182634021 | 3300002568 | Soil | MARILAAISNALRDNITPTDGVHFHAGPQGPYVCENPRCVSPGLDA* |
| Ga0063454_1002315582 | 3300004081 | Soil | MARLFAAISRALRDDTTEKVHFHPGPDGPYVCENPRCTSPGLDVQSR* |
| Ga0063454_1009075922 | 3300004081 | Soil | MARMLAAITNALRENITPTDGVHFHAGPQGPYVCENPRCVSPGLDP* |
| Ga0063454_1011806822 | 3300004081 | Soil | MARLFAAITRALREDVTNEKVHFHGGPDGPYVCENPRCTSPGL* |
| Ga0063454_1012412631 | 3300004081 | Soil | MARILAAITRALREDMTMNEKVHFHAGPAGPYVCENPRCTSPGLDA* |
| Ga0063455_1002915671 | 3300004153 | Soil | MARILAAITNALRVDSHTNEKVHFHAGPAGPYVCENPSCVSPALEV* |
| Ga0062589_1028595622 | 3300004156 | Soil | MARIFAAITSALRDNMNPTRDGVHFHAGPQGPYVCENPRCVSPGLDPERF* |
| Ga0062594_1012658452 | 3300005093 | Soil | MARIFAAISNALRVDSHTNEKVHFHAGPAGPYVCENPGCVSPGLDA* |
| Ga0070687_1007174321 | 3300005343 | Switchgrass Rhizosphere | MARIIAAISNALRVDTHSNEKVHFHAGPAGPYVCENPGCVSPGLDA* |
| Ga0070663_1016517821 | 3300005455 | Corn Rhizosphere | MARIFAAISRALREDSNEQVHFHGGPHGPYVCENPRCTSPGL* |
| Ga0070678_1004583482 | 3300005456 | Miscanthus Rhizosphere | MARIFAAISNALRVDSHTNEKVHFHAGPAGPYVCENPSCVSPGLEA* |
| Ga0068856_1009508172 | 3300005614 | Corn Rhizosphere | PQEGSTMARIFAAISNALRVDSHSNEKVHFHAGPAGPYVCENPSCVSPGLEA* |
| Ga0068856_1026487782 | 3300005614 | Corn Rhizosphere | MARILAAITRALRDDMTTNEKVHFHAGPAGPYVCEHPGCTSPGLDPQAS* |
| Ga0070702_1001529682 | 3300005615 | Corn, Switchgrass And Miscanthus Rhizosphere | MARIFAAISNALRVDTHSNEKVHFHAGPAGPYVCENPSCVSPGLDA* |
| Ga0068852_1023356872 | 3300005616 | Corn Rhizosphere | MARIIAAISNALRVDTHSNEKVHFHAGPAGPYVCENP |
| Ga0068866_113836072 | 3300005718 | Miscanthus Rhizosphere | MARIIAAITNALRVDTHSNEKVHFHAGPAGPYVCENP |
| Ga0068861_1023882941 | 3300005719 | Switchgrass Rhizosphere | MARIFAAISNALRVDTHSNEKVHFHAGPAGPYVCENPGCVSPGLDA* |
| Ga0068863_1009210062 | 3300005841 | Switchgrass Rhizosphere | MARIFAAISNALRVDSHSNEKVHFHAGPAGPYVCENPGCVSPGLDA* |
| Ga0075365_103021071 | 3300006038 | Populus Endosphere | FAAISNALRVDSHTDEKVHFHAGPAGPYVCENPSCVSPGLEA* |
| Ga0075365_107993662 | 3300006038 | Populus Endosphere | MARIFAAISNALRVDSHTNEKVHFHAGPAGPYVCENPSC |
| Ga0066652_1014556682 | 3300006046 | Soil | MTHRITTTLKAIAGTMTSNLNPAESGVHFHPGPAGPYVCENPRCVSPGLDPERF* |
| Ga0082029_12916811 | 3300006169 | Termite Nest | MARILAAITNALRDNLTPANDGVHFHAGPAGPYVCENPRCVSPGLDA* |
| Ga0075428_1010582482 | 3300006844 | Populus Rhizosphere | MARIFAAITNALRVDSHSNEKVHFHAGPAGPYVCENPSCVSPGLEA* |
| Ga0075420_1008401172 | 3300006853 | Populus Rhizosphere | MARIFAAITRALRDNMTPTDGVHFHAGPAGPYVCENPRCVSPGLDA* |
| Ga0075425_1028833672 | 3300006854 | Populus Rhizosphere | MARIIAAISNALRVDTHSNEKVHFHPGPAGPYVCENPSCVSPGLDA* |
| Ga0075436_1009841071 | 3300006914 | Populus Rhizosphere | ITSALRVDSHTDEKVHFHAGPSGPYVCENPSCVSPGLEA* |
| Ga0111539_116381492 | 3300009094 | Populus Rhizosphere | MARIFAAISNALRVDSHTNEKVHFHAGPAGPYVCENPSCVSPGLDA* |
| Ga0105245_118815451 | 3300009098 | Miscanthus Rhizosphere | TPQEGSDMARIFAAISSALREDSNEQVHFHGGPHGPYVCENPRCTSPGL* |
| Ga0111538_136832192 | 3300009156 | Populus Rhizosphere | KDPIMARIIAAISNALRVDSHTNEKVHFHAGPAGPYVCENPSCVSPGLEA* |
| Ga0105242_108367362 | 3300009176 | Miscanthus Rhizosphere | MARIIAAISNALRVDTHSNEKVHFHAGPAGPYVCENPGCVSPGLDL* |
| Ga0105248_116098472 | 3300009177 | Switchgrass Rhizosphere | MARIFAAISNALRVDSHTNEKVHFHAGPAGPYVCENPSCVSPGL |
| Ga0126307_102597061 | 3300009789 | Serpentine Soil | QEGSTMARILAAITSALRDNMNPTRDGVHFHAGPQGPYVCENPQCVSPGLDA* |
| Ga0126307_104364722 | 3300009789 | Serpentine Soil | MARLFAAITRALREQTITENVHFHGGPAGPYVCENARCTSPGLDPEAA* |
| Ga0126307_105891122 | 3300009789 | Serpentine Soil | MARILAAITNALRVDSTSTDKVHFHAGPAGPYVCENPRCVSPGLDA* |
| Ga0126307_107797782 | 3300009789 | Serpentine Soil | MARILAAFSRALREDTTEQVHFHGGPHGPYVCENPRCTSPGL* |
| Ga0126313_100625574 | 3300009840 | Serpentine Soil | LRDDTTDEVHFHAGPAGPFVCENPGCTSPGLDPQAS* |
| Ga0126313_101538702 | 3300009840 | Serpentine Soil | MARILAAITNALRVDSHTNEKVHFHAGTAGPYVCENPSCVSPGLEA* |
| Ga0126313_105668552 | 3300009840 | Serpentine Soil | MARILAAITRALRDDMTMTEKVHFHAGPAGPYVCEHPGCTSPGLDPQAS* |
| Ga0126313_107428202 | 3300009840 | Serpentine Soil | VARILAAISRALRDDITMTEKVHFHAGPAGPYVCEHPGCTSPGLDPQAS* |
| Ga0126305_104591581 | 3300010036 | Serpentine Soil | MARILAAITNALRVDSHTNEKVHFHAGPAGPYVCENASCVSPGLEA* |
| Ga0126304_100418531 | 3300010037 | Serpentine Soil | MARIFAAISNALRVDSTNDKVHFHAGPAGPYVCENPQCVSPGLDA* |
| Ga0126304_103210322 | 3300010037 | Serpentine Soil | MARILAAITNALRVDSHTNEKVHFHAGPAGPYVCENPSCVSPGLDA* |
| Ga0126315_108703421 | 3300010038 | Serpentine Soil | MARILAAITRALRDDMTMTEKVHFHAGPAGPFVCENPGCASPGLDPQAS* |
| Ga0126309_100006956 | 3300010039 | Serpentine Soil | MARIVAAISRALRVDTTEEVHFHGGPHGPYVCENPHCTSPGL* |
| Ga0126309_101884582 | 3300010039 | Serpentine Soil | MARLFAAISRALRDDATTEKVHFHGGPDGPYVCENPRCTSPGL* |
| Ga0126309_102101532 | 3300010039 | Serpentine Soil | MARILAAITRALRDDDATTERVHFHAGPAGPYVCENARCTSPGLDA* |
| Ga0126309_103315052 | 3300010039 | Serpentine Soil | MARLFAAITRVLREDPTTEKVHFHAGPAGPYVCENPGCTSPGLDA* |
| Ga0126309_110164562 | 3300010039 | Serpentine Soil | MARILAAITRALRDDMTMTEKVHFHAGPAGPYVCEHPGCTSPGLDPHAS* |
| Ga0126308_108961201 | 3300010040 | Serpentine Soil | VARILTAISRALRDDITKTEKVHFHAGPAGPYVCEHHGCTSPGLDPQAS* |
| Ga0126308_113418871 | 3300010040 | Serpentine Soil | MARIVAAISRALRVDTTEEVHFHGGPHGPYVCENPRCTSPGL* |
| Ga0126312_104080252 | 3300010041 | Serpentine Soil | MARILAAITRALRDDDATTERVHFHAGPARPYVCENPRCTSPGLDA* |
| Ga0126312_107191331 | 3300010041 | Serpentine Soil | ARIFAAITRALRDDATTEKVHFHGGPDGPYVCENPRCTSPGL* |
| Ga0126314_100220094 | 3300010042 | Serpentine Soil | MARILAAITRALRDDTTMTEKVHFHAGPAGPYVCEHPGCTSPGLDPQAS* |
| Ga0126310_105765872 | 3300010044 | Serpentine Soil | MARLLAAFSRALREDTTEQVHFHGGPHGPYVCENPRCTSPGL* |
| Ga0126311_100921063 | 3300010045 | Serpentine Soil | MARIFAAITRALRDDATTEKVHFHGGPDGPYVCENPRCTSPGL* |
| Ga0126311_102147093 | 3300010045 | Serpentine Soil | MARILAAITNALRVDSHTNEKVHFHAGPSGPYVCENPSCVSPGVEA* |
| Ga0126306_100436612 | 3300010166 | Serpentine Soil | MARIFAAISNALRVDSTNDKVHFHAGPAGPYVCENPACVSPGLDA* |
| Ga0126306_102821262 | 3300010166 | Serpentine Soil | MARILAAITSALRDNMNPTRDGVHFHAGPQGPYVCENPQCVSPGLDA* |
| Ga0126306_110409322 | 3300010166 | Serpentine Soil | MARILAAITNALRVDSHTNEKVHFHAGPAGPYVCENASCVSPGLE |
| Ga0134127_128284442 | 3300010399 | Terrestrial Soil | AAISNALRVDTHSNEKVHFHAGPAGPYVCENPGCVSPGLDA* |
| Ga0136623_101619052 | 3300012045 | Polar Desert Sand | MFAVRNQEGTVMARIVAAIARALREDTTTEQVHFHAGSDGPYVCENPRCSSPGLDPHAI* |
| Ga0136620_101972582 | 3300012186 | Polar Desert Sand | MARIVAAIARALREDNNQENVHFHGGSEGPYVCENPRCTSPGLDPHALVSSGASL* |
| Ga0150985_1132904771 | 3300012212 | Avena Fatua Rhizosphere | MARILAAITNALRVDDNKTDKVHFHAGPAGPYVCENPGCVSPGLDA* |
| Ga0134047_12674761 | 3300012380 | Grasslands Soil | MARILAAITRALRDDMTMNEKVHFHAGPAGPYVCENPRCTSPGLDV* |
| Ga0136612_100099754 | 3300012680 | Polar Desert Sand | MARVVAAIARALREDTTTENVHFHGGSDGPYVCENPRCTSPALDPQGA* |
| Ga0136614_105264162 | 3300012684 | Polar Desert Sand | MARIVAAISRALREDTSENVHFHAGSTGPYVCENPGCTSPGLDPQAV* |
| Ga0157286_103582001 | 3300012908 | Soil | RNLPTPQEGSTMARIIAAITNALRVDTHTNEKVHFHAGPAGPYVCENPSCVSPGLEA* |
| Ga0157301_103010422 | 3300012911 | Soil | MARIFAAITNALRVDSHSNEKVHFHAGPAGPYVCENPGCVSPGLDA* |
| Ga0164299_103322483 | 3300012958 | Soil | MARILAAITSALRENITPTDGVHFHAGPQGPYVCENPACVSP |
| Ga0157372_125082792 | 3300013307 | Corn Rhizosphere | MARIIAAISNALRVDTHSNEKVHFHAGPAGPYVCENPGCVSPGLD |
| Ga0157375_116085251 | 3300013308 | Miscanthus Rhizosphere | NALRVDSHSNEKVHFHAGPAGPYVCENPSCVSPGLDA* |
| Ga0132256_1022858402 | 3300015372 | Arabidopsis Rhizosphere | MARIFAAISNALRVDSTSTDKVHFHAGPAGPYVCENPACVSPGLEA* |
| Ga0180121_100298832 | 3300017695 | Polar Desert Sand | MARVVAAIARALREDTTTENVHFHGGSDGPYVCENPRCTSPALDPQGA |
| Ga0136617_1000002123 | 3300017789 | Polar Desert Sand | MARIVAAISRALRVDTTTENVHFHGGSHGPYVCENPRCSSPGLDA |
| Ga0184620_102213452 | 3300018051 | Groundwater Sediment | MARIVAAIARALREDTTEKVHFHGGPYGPYVCENPRCVSPSLDA |
| Ga0190265_100333015 | 3300018422 | Soil | MARLIAAVTRALREDTTEQVHFHGGPDGPYVCENPRCTSPGL |
| Ga0190265_101414813 | 3300018422 | Soil | MPRIFAAFARALDTHAPNEKVHFHAGPAGPFVCENPHCVSPGLDTR |
| Ga0190265_103591633 | 3300018422 | Soil | MARIVAAITRALREDTTTENVHFHTGSHGPYVCENPGCTSPGLDPQAA |
| Ga0190265_105949012 | 3300018422 | Soil | MARIVAAITRALREDTTTDKVHFHAGSNGPYVCENPRCSSPGLDPQAD |
| Ga0190265_106162842 | 3300018422 | Soil | MARIVAAITRALREDTRTENVHFHAGSNGPYVCENPRCTSPGLDPQ |
| Ga0190265_118626912 | 3300018422 | Soil | PNMARIVAAISRALREDTTTEQVHFHAGSDGPYVCENPRCSSPGLDPEG |
| Ga0190272_128391631 | 3300018429 | Soil | HPPQEGSIMARIVAAISRALREDTTPTDHVHFHSGSHGPYVCENPRCSSPGLDPQAA |
| Ga0190275_100268343 | 3300018432 | Soil | MARIFAAFSRVLRDDTTEQVHFHGGPDGPYVCENPRCTSPGL |
| Ga0190275_103247362 | 3300018432 | Soil | MPRIFAAFARALNTHAPNEKVHFHAGPAGPFVCENPHCVSPGLDTR |
| Ga0190275_112022771 | 3300018432 | Soil | MPRIFAAFARALDTHAPNEKVHFHAGPAGPYVCENPHCVSPGLDTR |
| Ga0190269_102612842 | 3300018465 | Soil | MARILAAITNALRVDSHTNEKVHFHAGPAGPYVCENPSCVSPGLEA |
| Ga0190270_100152363 | 3300018469 | Soil | MARIFAAITRALRDNMTPTDGVHFHAGPAGPYVCENPRCTSPGLDA |
| Ga0190270_102560082 | 3300018469 | Soil | MARIVAAITRALREDTTTDKVHFHAGSNGPYVCENPRCSSPGLDPQAG |
| Ga0190270_133454932 | 3300018469 | Soil | RIIAAVSRALREDTTEQVHFHGGPDGPYVCENPRCTSPGL |
| Ga0190274_121854822 | 3300018476 | Soil | RIFAAITRALRDNMTPTDGVHFHAGPAGPYVCENPRCVSPGLDA |
| Ga0190274_136607202 | 3300018476 | Soil | MARIFAAISNALRVDSNRTEKVHFHAGPAGPYVCENPGCVSPGLDA |
| Ga0190271_123327362 | 3300018481 | Soil | MARIIAAFSRVLREDTTEQVHFHGGPDGPYVCENPRCTSPGL |
| Ga0190273_108290652 | 3300018920 | Soil | MARIVAAISRALREDTTTDHVHFHSGSHGPYVCENPRCSSPGLDPGD |
| Ga0190273_115868842 | 3300018920 | Soil | MARIIAAVTRALREDTTEKVHFHGGPDGPYVCENPRCTSPGL |
| Ga0190264_101774142 | 3300019377 | Soil | MARIIAAVARALREDTTEQVHFHGGPHGPYVCENPRCTSPGL |
| Ga0190264_116584951 | 3300019377 | Soil | MARIIAAVTRALREDTTEQVHFHGGPDGPYVCENPRCT |
| Ga0190264_121041982 | 3300019377 | Soil | MARIVSAIARALNPVESNEKVHFHAGPAGPYVCENPRCVSPGLDTR |
| Ga0190267_109302432 | 3300019767 | Soil | MARIIAAITRALREDTTEKVHFHGGPHGPYVCENPRCTSPGL |
| Ga0193696_10746081 | 3300020016 | Soil | MARIIAAITNALRVDSHTNEKVHFHAGPAGPYVCENPSCVSPGLEA |
| Ga0207656_104964562 | 3300025321 | Corn Rhizosphere | MARIFAAISNALRVDSHTNEKVHFHAGPAGPYVCENPSCVSPGLEA |
| Ga0207688_101376943 | 3300025901 | Corn, Switchgrass And Miscanthus Rhizosphere | EGSTMARIFAAISNALRVDSHTDEKVHFHAGPAGPYVCENPSCVSPGLEA |
| Ga0207644_115727922 | 3300025931 | Switchgrass Rhizosphere | MARIIAAISNALRVDTHSNEKVHFHAGPAGPYVCENPGCVSPGLDA |
| Ga0207678_100764973 | 3300026067 | Corn Rhizosphere | MARIFAAITNALRVDSHTNEKVHFHAGPAGPYVCENPSCVSPGLEA |
| Ga0207648_111542401 | 3300026089 | Miscanthus Rhizosphere | MARIFAAISNALRVDSHTNEKVHFHAGPAGPYVCENPGCVSPGLDA |
| Ga0207698_106170921 | 3300026142 | Corn Rhizosphere | SPTQEGSTMARILAAITNALRVDSHTNEKVHFHAGPAGPYVCENPGCVSPGLDA |
| Ga0209462_100282623 | 3300027761 | Agave | TRALRDNMTPTDGVHFHAGPAGPYVCENPRCVSPGLDA |
| Ga0247820_105909542 | 3300028597 | Soil | MARILAAISNALRVDTHSNEKVHFHAGPAGPYVCENPACVSPGLDA |
| Ga0307321_10827772 | 3300028704 | Soil | MARILAAITNALRVDSHTDEKVHFHAGPAGPYVCENPSCVSPGLEA |
| Ga0307321_11372071 | 3300028704 | Soil | MARIIAAITNALRVDSHRNEKVHFHAGSAGPYVCENPSCVSP |
| Ga0307291_10062783 | 3300028707 | Soil | MARIIAAITNALRVDSHRNEKVHFHAGSAGPYVCENPSCVSPGLDA |
| Ga0307298_100812951 | 3300028717 | Soil | RPSRTPSPPQEGSIMARIFAAITNALRVDSHTNEKVHFHAGPAGPYVCENPSCVSPGLEA |
| Ga0307307_101181332 | 3300028718 | Soil | MARIIAAITNALRVDSHTNEKVHFHAGPAGPYVCENPNCVSPGLEA |
| Ga0307320_104139171 | 3300028771 | Soil | ILAAITNALRVDSHTDEKVHFHAGPAGPYVCENPSCVSPGLDA |
| Ga0307310_101680602 | 3300028824 | Soil | MARILAAITNALRENMHPTTDGVHFHAGPAGPYVCENPRCVSPGLDA |
| Ga0307289_100658863 | 3300028875 | Soil | MARIFAAIRNALRENITPTDGVHFHAGPAGPYVCENPRCVSPSLDA |
| Ga0307300_100909582 | 3300028880 | Soil | MARIFAAITNALRVDSHTNEKVHFHAGPSGPYVCENPSCVSPGLDA |
| Ga0247827_105564931 | 3300028889 | Soil | MARILAAFSRVLREDTTEQVHFHGGPHGPYVCENPRC |
| Ga0299907_103061311 | 3300030006 | Soil | MARIVAAIARALNPVDSNEKVHFHAGPAGPYVCENPRCVSPGLDTR |
| Ga0308204_102229881 | 3300031092 | Soil | MARILAAITNALRVDSHTNEKVHFHAGPSGPYVCENPSCVSPGLDA |
| Ga0307501_102304202 | 3300031152 | Soil | DMARIVAAIARALREDTTEKVHFHGGPHGPYVCENARCTSPGL |
| Ga0299913_106780152 | 3300031229 | Soil | MARIVSAIARALNPVDGNEKVHFHAGPAGPYVCENPHCVSPGLDTR |
| Ga0272434_11189262 | 3300031473 | Rock | MARIVAAIARALREDTRDPVHFHGGSDGPYVCENPRCSSPGLDPQAS |
| Ga0307468_1002262652 | 3300031740 | Hardwood Forest Soil | MARIFAAISNALRVDSTNEKVHFHAGPAGPYVCENPSCVSPGLDA |
| Ga0326721_103612202 | 3300032080 | Soil | MARIFAAISNALRVDTPNDKVHFHAGPAGPYVCENPRCVSPGLDA |
| Ga0326721_108405871 | 3300032080 | Soil | MARIFAAISNALRVDSTNDKVHFHAGPAGPYVCENPSCVSPGLEA |
| Ga0307415_1019157091 | 3300032126 | Rhizosphere | ILAAISRALRDDITMTEKVHFHAGPAGPYVCEHPGCTSPGLNPQAS |
| ⦗Top⦘ |