| Basic Information | |
|---|---|
| Family ID | F062069 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 131 |
| Average Sequence Length | 48 residues |
| Representative Sequence | MTEDGTSIRVRIDDEGYTYITVTQWDENGREIVYREDENFQCSEPQF |
| Number of Associated Samples | 105 |
| Number of Associated Scaffolds | 131 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 74.05 % |
| % of genes near scaffold ends (potentially truncated) | 31.30 % |
| % of genes from short scaffolds (< 2000 bps) | 71.76 % |
| Associated GOLD sequencing projects | 94 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.51 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (93.130 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds (14.504 % of family members) |
| Environment Ontology (ENVO) | Unclassified (27.481 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (32.824 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 37.33% Coil/Unstructured: 62.67% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.51 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 131 Family Scaffolds |
|---|---|---|
| PF00158 | Sigma54_activat | 18.32 |
| PF00196 | GerE | 9.92 |
| PF02954 | HTH_8 | 4.58 |
| PF07730 | HisKA_3 | 4.58 |
| PF03649 | UPF0014 | 3.05 |
| PF02922 | CBM_48 | 1.53 |
| PF00005 | ABC_tran | 1.53 |
| PF00004 | AAA | 1.53 |
| PF02518 | HATPase_c | 1.53 |
| PF01791 | DeoC | 0.76 |
| PF00350 | Dynamin_N | 0.76 |
| PF13590 | DUF4136 | 0.76 |
| PF13492 | GAF_3 | 0.76 |
| PF13441 | Gly-zipper_YMGG | 0.76 |
| PF02321 | OEP | 0.76 |
| PF13650 | Asp_protease_2 | 0.76 |
| PF06897 | DUF1269 | 0.76 |
| PF00342 | PGI | 0.76 |
| PF09335 | SNARE_assoc | 0.76 |
| PF11154 | DUF2934 | 0.76 |
| PF00535 | Glycos_transf_2 | 0.76 |
| PF08032 | SpoU_sub_bind | 0.76 |
| COG ID | Name | Functional Category | % Frequency in 131 Family Scaffolds |
|---|---|---|---|
| COG3850 | Signal transduction histidine kinase NarQ, nitrate/nitrite-specific | Signal transduction mechanisms [T] | 4.58 |
| COG3851 | Signal transduction histidine kinase UhpB, glucose-6-phosphate specific | Signal transduction mechanisms [T] | 4.58 |
| COG4564 | Signal transduction histidine kinase | Signal transduction mechanisms [T] | 4.58 |
| COG4585 | Signal transduction histidine kinase ComP | Signal transduction mechanisms [T] | 4.58 |
| COG0390 | ABC-type iron transport system FetAB, permease component | Inorganic ion transport and metabolism [P] | 3.05 |
| COG1538 | Outer membrane protein TolC | Cell wall/membrane/envelope biogenesis [M] | 1.53 |
| COG0166 | Glucose-6-phosphate isomerase | Carbohydrate transport and metabolism [G] | 0.76 |
| COG0398 | Uncharacterized membrane protein YdjX, related to fungal oxalate transporter, TVP38/TMEM64 family | Function unknown [S] | 0.76 |
| COG0566 | tRNA G18 (ribose-2'-O)-methylase SpoU | Translation, ribosomal structure and biogenesis [J] | 0.76 |
| COG0586 | Membrane integrity protein DedA, putative transporter, DedA/Tvp38 family | Cell wall/membrane/envelope biogenesis [M] | 0.76 |
| COG1238 | Uncharacterized membrane protein YqaA, VTT domain | Function unknown [S] | 0.76 |
| COG4803 | Uncharacterized membrane protein | Function unknown [S] | 0.76 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 93.13 % |
| Unclassified | root | N/A | 6.87 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2040502001|FACENC_GAMC6GA01CEV3N | All Organisms → cellular organisms → Bacteria | 537 | Open in IMG/M |
| 3300000550|F24TB_14052657 | All Organisms → cellular organisms → Bacteria | 784 | Open in IMG/M |
| 3300000567|JGI12270J11330_10111798 | All Organisms → cellular organisms → Bacteria | 1146 | Open in IMG/M |
| 3300001431|F14TB_101673075 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1060 | Open in IMG/M |
| 3300001593|JGI12635J15846_10231785 | All Organisms → cellular organisms → Bacteria | 1198 | Open in IMG/M |
| 3300001867|JGI12627J18819_10436937 | All Organisms → cellular organisms → Bacteria | 535 | Open in IMG/M |
| 3300004080|Ga0062385_11028303 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 555 | Open in IMG/M |
| 3300004091|Ga0062387_100288074 | All Organisms → cellular organisms → Bacteria | 1050 | Open in IMG/M |
| 3300004092|Ga0062389_103985725 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 555 | Open in IMG/M |
| 3300004152|Ga0062386_100183383 | All Organisms → cellular organisms → Bacteria | 1642 | Open in IMG/M |
| 3300004152|Ga0062386_100932877 | All Organisms → cellular organisms → Bacteria | 718 | Open in IMG/M |
| 3300004156|Ga0062589_101121942 | All Organisms → cellular organisms → Bacteria | 746 | Open in IMG/M |
| 3300005335|Ga0070666_10556638 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 834 | Open in IMG/M |
| 3300005367|Ga0070667_102263622 | All Organisms → cellular organisms → Bacteria | 512 | Open in IMG/M |
| 3300005435|Ga0070714_101919729 | All Organisms → cellular organisms → Bacteria | 578 | Open in IMG/M |
| 3300005436|Ga0070713_100013607 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 6015 | Open in IMG/M |
| 3300005436|Ga0070713_100655719 | All Organisms → cellular organisms → Bacteria | 1000 | Open in IMG/M |
| 3300005456|Ga0070678_100200140 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 1648 | Open in IMG/M |
| 3300005542|Ga0070732_10059960 | All Organisms → cellular organisms → Bacteria | 2209 | Open in IMG/M |
| 3300005548|Ga0070665_100308038 | All Organisms → cellular organisms → Bacteria | 1587 | Open in IMG/M |
| 3300005843|Ga0068860_102490261 | Not Available | 537 | Open in IMG/M |
| 3300006052|Ga0075029_100029639 | All Organisms → cellular organisms → Bacteria | 3101 | Open in IMG/M |
| 3300006052|Ga0075029_100221323 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1188 | Open in IMG/M |
| 3300006052|Ga0075029_100824020 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 632 | Open in IMG/M |
| 3300006057|Ga0075026_101086376 | All Organisms → cellular organisms → Bacteria | 502 | Open in IMG/M |
| 3300006059|Ga0075017_100289626 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1207 | Open in IMG/M |
| 3300006059|Ga0075017_101655248 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 506 | Open in IMG/M |
| 3300006086|Ga0075019_10026790 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3226 | Open in IMG/M |
| 3300006086|Ga0075019_10260645 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1037 | Open in IMG/M |
| 3300006102|Ga0075015_100105229 | All Organisms → cellular organisms → Bacteria | 1422 | Open in IMG/M |
| 3300006102|Ga0075015_100107463 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii | 1409 | Open in IMG/M |
| 3300006162|Ga0075030_100061451 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii | 3113 | Open in IMG/M |
| 3300006162|Ga0075030_100084256 | All Organisms → cellular organisms → Bacteria | 2606 | Open in IMG/M |
| 3300006174|Ga0075014_100397328 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 751 | Open in IMG/M |
| 3300006174|Ga0075014_100450017 | All Organisms → cellular organisms → Bacteria | 712 | Open in IMG/M |
| 3300006174|Ga0075014_101019043 | All Organisms → cellular organisms → Bacteria | 502 | Open in IMG/M |
| 3300009518|Ga0116128_1138570 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → candidate division WWE3 → candidate division WWE3 bacterium RIFOXYD1_FULL_39_9 | 700 | Open in IMG/M |
| 3300009519|Ga0116108_1044560 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1422 | Open in IMG/M |
| 3300009520|Ga0116214_1019472 | All Organisms → cellular organisms → Bacteria | 2418 | Open in IMG/M |
| 3300009623|Ga0116133_1005110 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3332 | Open in IMG/M |
| 3300009630|Ga0116114_1033338 | All Organisms → cellular organisms → Bacteria | 1500 | Open in IMG/M |
| 3300009632|Ga0116102_1044199 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1425 | Open in IMG/M |
| 3300009644|Ga0116121_1108828 | All Organisms → cellular organisms → Bacteria | 870 | Open in IMG/M |
| 3300009700|Ga0116217_10060005 | All Organisms → cellular organisms → Bacteria | 2711 | Open in IMG/M |
| 3300010339|Ga0074046_10161552 | All Organisms → cellular organisms → Bacteria | 1425 | Open in IMG/M |
| 3300010339|Ga0074046_10456429 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 766 | Open in IMG/M |
| 3300010339|Ga0074046_10598580 | Not Available | 652 | Open in IMG/M |
| 3300010341|Ga0074045_10107725 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1922 | Open in IMG/M |
| 3300010341|Ga0074045_10569303 | All Organisms → cellular organisms → Bacteria | 724 | Open in IMG/M |
| 3300010343|Ga0074044_10013261 | Not Available | 6149 | Open in IMG/M |
| 3300010343|Ga0074044_10640801 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 693 | Open in IMG/M |
| 3300010343|Ga0074044_10992777 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 550 | Open in IMG/M |
| 3300010379|Ga0136449_101312544 | All Organisms → cellular organisms → Bacteria | 1127 | Open in IMG/M |
| 3300011090|Ga0138579_1327602 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 546 | Open in IMG/M |
| 3300013102|Ga0157371_11595068 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 511 | Open in IMG/M |
| 3300014155|Ga0181524_10496393 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 519 | Open in IMG/M |
| 3300014156|Ga0181518_10384889 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 681 | Open in IMG/M |
| 3300014162|Ga0181538_10282476 | Not Available | 906 | Open in IMG/M |
| 3300014164|Ga0181532_10000013 | All Organisms → cellular organisms → Bacteria | 214381 | Open in IMG/M |
| 3300014491|Ga0182014_10006979 | All Organisms → cellular organisms → Bacteria | 11969 | Open in IMG/M |
| 3300017823|Ga0187818_10058017 | All Organisms → cellular organisms → Bacteria | 1665 | Open in IMG/M |
| 3300017823|Ga0187818_10431661 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 587 | Open in IMG/M |
| 3300017924|Ga0187820_1222319 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 597 | Open in IMG/M |
| 3300017929|Ga0187849_1063930 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii | 1660 | Open in IMG/M |
| 3300017933|Ga0187801_10054916 | All Organisms → cellular organisms → Bacteria | 1454 | Open in IMG/M |
| 3300017933|Ga0187801_10099001 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1106 | Open in IMG/M |
| 3300017938|Ga0187854_10286174 | Not Available | 707 | Open in IMG/M |
| 3300017940|Ga0187853_10402804 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 605 | Open in IMG/M |
| 3300017942|Ga0187808_10142502 | All Organisms → cellular organisms → Bacteria | 1054 | Open in IMG/M |
| 3300017943|Ga0187819_10107823 | All Organisms → cellular organisms → Bacteria | 1663 | Open in IMG/M |
| 3300017943|Ga0187819_10213048 | All Organisms → cellular organisms → Bacteria | 1137 | Open in IMG/M |
| 3300017943|Ga0187819_10392735 | All Organisms → cellular organisms → Bacteria | 798 | Open in IMG/M |
| 3300017946|Ga0187879_10001194 | All Organisms → cellular organisms → Bacteria | 17782 | Open in IMG/M |
| 3300017955|Ga0187817_10238935 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1158 | Open in IMG/M |
| 3300017955|Ga0187817_10547071 | All Organisms → cellular organisms → Bacteria | 738 | Open in IMG/M |
| 3300017995|Ga0187816_10254898 | All Organisms → cellular organisms → Bacteria | 766 | Open in IMG/M |
| 3300018007|Ga0187805_10022077 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii | 2781 | Open in IMG/M |
| 3300018013|Ga0187873_1162517 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 849 | Open in IMG/M |
| 3300018018|Ga0187886_1178344 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 829 | Open in IMG/M |
| 3300018026|Ga0187857_10075280 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1676 | Open in IMG/M |
| 3300018035|Ga0187875_10608934 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 576 | Open in IMG/M |
| 3300018038|Ga0187855_10530757 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 685 | Open in IMG/M |
| 3300018040|Ga0187862_10477798 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 753 | Open in IMG/M |
| 3300018043|Ga0187887_10014332 | All Organisms → cellular organisms → Bacteria | 5231 | Open in IMG/M |
| 3300021180|Ga0210396_10004374 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 13852 | Open in IMG/M |
| 3300022734|Ga0224571_109411 | Not Available | 671 | Open in IMG/M |
| 3300023090|Ga0224558_1003922 | All Organisms → cellular organisms → Bacteria | 11977 | Open in IMG/M |
| 3300025453|Ga0208455_1009179 | All Organisms → cellular organisms → Bacteria | 2518 | Open in IMG/M |
| 3300025459|Ga0208689_1010105 | All Organisms → cellular organisms → Bacteria | 3133 | Open in IMG/M |
| 3300025473|Ga0208190_1048690 | All Organisms → cellular organisms → Bacteria | 895 | Open in IMG/M |
| 3300025907|Ga0207645_10007624 | All Organisms → cellular organisms → Bacteria | 7626 | Open in IMG/M |
| 3300025928|Ga0207700_10343002 | All Organisms → cellular organisms → Bacteria | 1299 | Open in IMG/M |
| 3300025929|Ga0207664_10093643 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 2468 | Open in IMG/M |
| 3300025940|Ga0207691_11198519 | All Organisms → cellular organisms → Bacteria | 630 | Open in IMG/M |
| 3300025944|Ga0207661_10969094 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 783 | Open in IMG/M |
| 3300026095|Ga0207676_11863230 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 600 | Open in IMG/M |
| 3300027570|Ga0208043_1006354 | All Organisms → cellular organisms → Bacteria | 4074 | Open in IMG/M |
| 3300027570|Ga0208043_1018463 | All Organisms → cellular organisms → Bacteria | 2235 | Open in IMG/M |
| 3300027645|Ga0209117_1002104 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 6932 | Open in IMG/M |
| 3300027698|Ga0209446_1044724 | All Organisms → cellular organisms → Bacteria | 1117 | Open in IMG/M |
| 3300027783|Ga0209448_10079665 | All Organisms → cellular organisms → Bacteria | 1098 | Open in IMG/M |
| 3300027812|Ga0209656_10040917 | All Organisms → cellular organisms → Bacteria | 2681 | Open in IMG/M |
| 3300027825|Ga0209039_10134114 | All Organisms → cellular organisms → Bacteria | 1040 | Open in IMG/M |
| 3300027842|Ga0209580_10042374 | All Organisms → cellular organisms → Bacteria | 2101 | Open in IMG/M |
| 3300027854|Ga0209517_10252363 | All Organisms → cellular organisms → Bacteria | 1055 | Open in IMG/M |
| 3300027898|Ga0209067_10014273 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 4135 | Open in IMG/M |
| 3300027911|Ga0209698_10047199 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3799 | Open in IMG/M |
| 3300027911|Ga0209698_10062977 | All Organisms → cellular organisms → Bacteria | 3197 | Open in IMG/M |
| 3300027911|Ga0209698_10180941 | All Organisms → cellular organisms → Bacteria | 1714 | Open in IMG/M |
| 3300029903|Ga0247271_110377 | All Organisms → cellular organisms → Bacteria | 1368 | Open in IMG/M |
| 3300031128|Ga0170823_10554565 | All Organisms → cellular organisms → Bacteria | 942 | Open in IMG/M |
| 3300031231|Ga0170824_100039294 | All Organisms → cellular organisms → Bacteria | 640 | Open in IMG/M |
| 3300031820|Ga0307473_10363573 | All Organisms → cellular organisms → Bacteria | 935 | Open in IMG/M |
| 3300032174|Ga0307470_10883470 | All Organisms → cellular organisms → Bacteria | 700 | Open in IMG/M |
| 3300032180|Ga0307471_100708791 | All Organisms → cellular organisms → Bacteria | 1171 | Open in IMG/M |
| 3300032205|Ga0307472_100145685 | All Organisms → cellular organisms → Bacteria | 1720 | Open in IMG/M |
| 3300032205|Ga0307472_102126353 | All Organisms → cellular organisms → Bacteria | 565 | Open in IMG/M |
| 3300032782|Ga0335082_10122212 | All Organisms → cellular organisms → Bacteria | 2553 | Open in IMG/M |
| 3300032805|Ga0335078_11347604 | Not Available | 810 | Open in IMG/M |
| 3300032828|Ga0335080_11490851 | Not Available | 669 | Open in IMG/M |
| 3300032829|Ga0335070_10031823 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 5981 | Open in IMG/M |
| 3300032829|Ga0335070_10956499 | Not Available | 791 | Open in IMG/M |
| 3300032892|Ga0335081_10098264 | All Organisms → cellular organisms → Bacteria | 4361 | Open in IMG/M |
| 3300032893|Ga0335069_10013674 | All Organisms → cellular organisms → Bacteria | 11389 | Open in IMG/M |
| 3300032895|Ga0335074_10018653 | All Organisms → cellular organisms → Bacteria | 9792 | Open in IMG/M |
| 3300032895|Ga0335074_10864622 | All Organisms → cellular organisms → Bacteria | 828 | Open in IMG/M |
| 3300032898|Ga0335072_10046590 | All Organisms → cellular organisms → Bacteria | 5871 | Open in IMG/M |
| 3300032955|Ga0335076_10470915 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1139 | Open in IMG/M |
| 3300033402|Ga0326728_10009116 | All Organisms → cellular organisms → Bacteria | 24085 | Open in IMG/M |
| 3300033405|Ga0326727_10004696 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 40462 | Open in IMG/M |
| 3300034091|Ga0326724_0184694 | All Organisms → cellular organisms → Bacteria | 1254 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 14.50% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 9.92% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 8.40% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 8.40% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 6.87% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 6.87% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 6.11% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 6.11% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 3.82% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 3.05% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 2.29% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.29% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 2.29% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 2.29% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.53% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.53% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.53% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 1.53% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 1.53% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.53% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 1.53% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.76% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.76% |
| Bog | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Bog | 0.76% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.76% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 0.76% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 0.76% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.76% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.76% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2040502001 | Soil microbial communities from sample at FACE Site 2 North Carolina CO2+ | Environmental | Open in IMG/M |
| 3300000550 | Amended soil microbial communities from Kansas Great Prairies, USA - BrdU amended with acetate total DNA F2.4 TB clc assemly | Environmental | Open in IMG/M |
| 3300000567 | Peat soil microbial communities from Weissenstadt, Germany - SII-2010 | Environmental | Open in IMG/M |
| 3300001431 | Amended soil microbial communities from Kansas Great Prairies, USA - BrdU F1.4TB clc assemly | Environmental | Open in IMG/M |
| 3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
| 3300001867 | Texas A ecozone_OM1H0_M2 (Combined assembly for Texas A ecozone Site metagenome samples, ASSEMBLY_DATE=20130705) | Environmental | Open in IMG/M |
| 3300004080 | Coassembly of ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300004091 | Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004152 | Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3 | Environmental | Open in IMG/M |
| 3300004156 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1 | Environmental | Open in IMG/M |
| 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
| 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
| 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
| 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
| 3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
| 3300006057 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2012 | Environmental | Open in IMG/M |
| 3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
| 3300006086 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 | Environmental | Open in IMG/M |
| 3300006102 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013 | Environmental | Open in IMG/M |
| 3300006162 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 | Environmental | Open in IMG/M |
| 3300006174 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014 | Environmental | Open in IMG/M |
| 3300009518 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_150 | Environmental | Open in IMG/M |
| 3300009519 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_150 | Environmental | Open in IMG/M |
| 3300009520 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaG | Environmental | Open in IMG/M |
| 3300009623 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_10 | Environmental | Open in IMG/M |
| 3300009630 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_40 | Environmental | Open in IMG/M |
| 3300009632 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_4_40 | Environmental | Open in IMG/M |
| 3300009644 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_10 | Environmental | Open in IMG/M |
| 3300009700 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG | Environmental | Open in IMG/M |
| 3300010339 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM3 | Environmental | Open in IMG/M |
| 3300010341 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM2 | Environmental | Open in IMG/M |
| 3300010343 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300011090 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 69 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Host-Associated | Open in IMG/M |
| 3300014155 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_60_metaG | Environmental | Open in IMG/M |
| 3300014156 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_60_metaG | Environmental | Open in IMG/M |
| 3300014162 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_30_metaG | Environmental | Open in IMG/M |
| 3300014164 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_30_metaG | Environmental | Open in IMG/M |
| 3300014491 | Permafrost microbial communities from Stordalen Mire, Sweden - 612S2D metaG | Environmental | Open in IMG/M |
| 3300017823 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_3 | Environmental | Open in IMG/M |
| 3300017924 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_5 | Environmental | Open in IMG/M |
| 3300017929 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_100 | Environmental | Open in IMG/M |
| 3300017933 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_1 | Environmental | Open in IMG/M |
| 3300017938 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_150 | Environmental | Open in IMG/M |
| 3300017940 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_100 | Environmental | Open in IMG/M |
| 3300017942 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_3 | Environmental | Open in IMG/M |
| 3300017943 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4 | Environmental | Open in IMG/M |
| 3300017946 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_10 | Environmental | Open in IMG/M |
| 3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
| 3300017995 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_1 | Environmental | Open in IMG/M |
| 3300018007 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_5 | Environmental | Open in IMG/M |
| 3300018013 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_100 | Environmental | Open in IMG/M |
| 3300018018 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_150 | Environmental | Open in IMG/M |
| 3300018026 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_100 | Environmental | Open in IMG/M |
| 3300018035 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_10 | Environmental | Open in IMG/M |
| 3300018038 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_10 | Environmental | Open in IMG/M |
| 3300018040 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_150 | Environmental | Open in IMG/M |
| 3300018043 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_10 | Environmental | Open in IMG/M |
| 3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
| 3300022734 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic ? CZU3 | Host-Associated | Open in IMG/M |
| 3300023090 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 S3 20-24 | Environmental | Open in IMG/M |
| 3300025453 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_4_40 (SPAdes) | Environmental | Open in IMG/M |
| 3300025459 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_150 (SPAdes) | Environmental | Open in IMG/M |
| 3300025473 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_10 (SPAdes) | Environmental | Open in IMG/M |
| 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027570 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_9_AC metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027645 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027698 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027783 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027812 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027825 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027842 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027854 | Peat soil microbial communities from Weissenstadt, Germany - SII-2010 (SPAdes) | Environmental | Open in IMG/M |
| 3300027898 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 (SPAdes) | Environmental | Open in IMG/M |
| 3300027911 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300029903 | Soil microbial communities from Marcell Experimental Forest, Minnesota, USA - Fen703 | Environmental | Open in IMG/M |
| 3300031128 | Oak Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032782 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1 | Environmental | Open in IMG/M |
| 3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
| 3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
| 3300032829 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3 | Environmental | Open in IMG/M |
| 3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
| 3300032893 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1 | Environmental | Open in IMG/M |
| 3300032895 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.3 | Environmental | Open in IMG/M |
| 3300032898 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.1 | Environmental | Open in IMG/M |
| 3300032955 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5 | Environmental | Open in IMG/M |
| 3300033402 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB31MN | Environmental | Open in IMG/M |
| 3300033405 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB29MY | Environmental | Open in IMG/M |
| 3300034091 | Peat soil microbial communities from McLean, Ithaca, NY, United States - MB00N | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| FACENCE_918750 | 2040502001 | Soil | MTEDCTQIRVRIDNEGYTCITVTQWDENGREIVYREDENFRCSEPQF |
| F24TB_140526572 | 3300000550 | Soil | MTEDGTSIRVRIDDEGYTXITVTQWDENGREIVYREDENFRCSEPQF* |
| JGI12270J11330_101117984 | 3300000567 | Peatlands Soil | MEDGTSIRVHIDDEGYTHITVIQWNEDEREIVYREDEDFQCSEPQF* |
| F14TB_1016730752 | 3300001431 | Soil | DVGLPANETALDNVGMSGQRNGGSVMEDGTSIRVRIDDEGYTYITVTQWDENGREIVYREDENFQCSLSQF* |
| JGI12635J15846_102317852 | 3300001593 | Forest Soil | MTEDGTSIRVRIDDEGYTYITVTQWDENGREMVYREDENFRCSEPQF* |
| JGI12627J18819_104369371 | 3300001867 | Forest Soil | MTEDGTSIRVRINDEGYTCITVTQWDENGREIVYREDEN |
| Ga0062385_110283031 | 3300004080 | Bog Forest Soil | MSGQRNGGRVMTEDGTSIRVRIDDEGYTYITVTQWDENGREIVYRESENFRCSEPQF* |
| Ga0062387_1002880742 | 3300004091 | Bog Forest Soil | MTEDGTSIHVRIDDEGYTHITVIQWDENGREIVFREDEIFQCSEPQF* |
| Ga0062389_1039857252 | 3300004092 | Bog Forest Soil | MTEDGTSIRVRIDDEGYTYITVTQWDENGREIVYRESENFRCSEPQF* |
| Ga0062386_1001833832 | 3300004152 | Bog Forest Soil | MLEDSTSIRVRIDDQGYTHVTVIQWDEDGREVVYREDENFQCSEAQS* |
| Ga0062386_1009328772 | 3300004152 | Bog Forest Soil | MTEDGTSIRVRIDDQGYTHITVIQWDEDRREIVYREDEDFQCSEPQF* |
| Ga0062589_1011219421 | 3300004156 | Soil | VGLPANEPALDNVGISGQGNGGSVMEDGTSIRVRIDEEGSTYITVTQWDEDGREIVYREDEHFQSSAPQF* |
| Ga0070666_105566381 | 3300005335 | Switchgrass Rhizosphere | VMEDGTSMRVRIDEEGYTYITVTQWDEDGREIVYREDEHSQFSAPQF* |
| Ga0070667_1022636221 | 3300005367 | Switchgrass Rhizosphere | MSGQRNGGSVMEDGTSIRVRIDEEGSTYITVTQWDEDGREIVYREDEH |
| Ga0070714_1019197292 | 3300005435 | Agricultural Soil | MTEDGTSIRVRIDDEGHTYITVTQWDENGREIVYREDENFQCSEPQF* |
| Ga0070713_1000136072 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | MTEDGTSIRVRIDDEGYTCITVTQWDENGREIVYREDENFRCSEPQF* |
| Ga0070713_1006557191 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | MEDGTSIRVRIDDQGHTYITVVQWDENGREIVYREDENFQCSGPQF* |
| Ga0070678_1002001402 | 3300005456 | Miscanthus Rhizosphere | MEDGTSMRVRIDEEGYTYITVTQWDEDGREIVYREDEHSQFSAPQF* |
| Ga0070732_100599604 | 3300005542 | Surface Soil | MTQDGTSIRVRIDHEGYTYITVTQWDENGREIVYREDENFQCSEPQF* |
| Ga0070665_1003080381 | 3300005548 | Switchgrass Rhizosphere | MEDGTSIRVRIDEEGSTYITVTQWDEDGREIVYREDEHFQSSAPQF* |
| Ga0068860_1024902611 | 3300005843 | Switchgrass Rhizosphere | MEDGTSMRVRIDEEGYTYITVTQWDEDGREIVYREDEHSQFSAP |
| Ga0075029_1000296394 | 3300006052 | Watersheds | MTEDGTSIHVRIDDEGYTHITVMQWDENGREIVYREDEIFQCSEPQF* |
| Ga0075029_1002213232 | 3300006052 | Watersheds | MIGERNKGSVMTEDGTSIHVRIDDEGYTHITVIQRDENGREIVYREDENFQCSEPQF* |
| Ga0075029_1008240202 | 3300006052 | Watersheds | VDNVRMSGQRNGGSVMTEDGTSIRVRIDDKGYTYITVTQWDEDGRKIVYREDEHFQCSEPQY* |
| Ga0075026_1010863762 | 3300006057 | Watersheds | MTEDGTSIRVRIDDEGYTYITVTQWDENGREIVYREDENFQCSEPQF* |
| Ga0075017_1002896261 | 3300006059 | Watersheds | MTEDGTSIHVRIDDEGYTHITVIQRDENGREIVYREDENFQCSEPQF* |
| Ga0075017_1016552481 | 3300006059 | Watersheds | GSVMTEDGTSIRVRINDEGYTYITVTQWDEDGREIVYREDEHFQCSEPQF* |
| Ga0075019_100267903 | 3300006086 | Watersheds | MTEDGTSIRVRIDDKGYTYITVTQWDEDGRKIVYREDEHFQCSEPQY* |
| Ga0075019_102606453 | 3300006086 | Watersheds | MSGQRNGGRVMTEDGTSIRVRIDDEGYTYITVTQWDENGREIVYRENENFRCSEPQF* |
| Ga0075015_1001052292 | 3300006102 | Watersheds | MTEDGTSIRVRIDDEGYTYITVTQWDENGREIVYREDENFRCSEPQF* |
| Ga0075015_1001074633 | 3300006102 | Watersheds | MEDGTSIRVRIDDQGHTYMTVVQWDENGRDMYREDE |
| Ga0075030_1000614511 | 3300006162 | Watersheds | MEDGTSIRVRIDDQGHTYMTVVQWDENGRDMYREDENLQCSGPQF* |
| Ga0075030_1000842562 | 3300006162 | Watersheds | MTEEGTSIRVRIDDEGYTYITVTQWDENGREIVYREDENFRCSEPQF* |
| Ga0075014_1003973282 | 3300006174 | Watersheds | MTEDGTSIRVRIDDEGYTYITVTQWDENGREIVYRENENFRCSEPQF* |
| Ga0075014_1004500172 | 3300006174 | Watersheds | MTEDGTSIRVRIDDQGYTYITVTQWDENGREIVYREDEHFQCSEPQF* |
| Ga0075014_1010190431 | 3300006174 | Watersheds | MEDGTSIRVRIDDQGHTYMTVVKWDENGRDMYREDEN |
| Ga0116128_11385701 | 3300009518 | Peatland | MEDGTSIRVRIDDEGYTHVTVIQWDEDGREIVYTEDENFRVAVEA* |
| Ga0116108_10445603 | 3300009519 | Peatland | MTEDGTSIRVRIDEEGYTYITVMQWDEDGREIVYREDEHLQCSEPQF* |
| Ga0116214_10194722 | 3300009520 | Peatlands Soil | MTQDGTSIRVRIDHEGYTYITVTQWDENGREIVYRENENFRCSEPQF* |
| Ga0116133_10051104 | 3300009623 | Peatland | MEDGTSIRVRIDDEGYTHITVTQWNEDGREIVYREDEDFQCSEPQF* |
| Ga0116114_10333381 | 3300009630 | Peatland | TSIRVHIDDEGYTHITVIQWNEDGREIVYREDEDFQCSEPQF* |
| Ga0116102_10441992 | 3300009632 | Peatland | MEDGTSIRVRIDDEGYTHITVIQWNEDGREIVYREDEDFQCSEPQF* |
| Ga0116121_11088282 | 3300009644 | Peatland | GSVMEDGTSIRVRIDDEGYTHITVTQWNEDGREIVYREDEDFQCSEPQF* |
| Ga0116217_100600054 | 3300009700 | Peatlands Soil | MEDGTSIRVHIDDEGYTHITVIQWNEDGREIVYREDEDFQCSEPQF* |
| Ga0074046_101615522 | 3300010339 | Bog Forest Soil | MEDGTSIRICIDDEGYTHITVTQWNEDGQEIVYREDEDFQCSEPQF* |
| Ga0074046_104564291 | 3300010339 | Bog Forest Soil | MIGQRNKGSVMTEDGTSIHVRIDDEGYTHITVIQWDENGREIVYREDENFRCSEPQF* |
| Ga0074046_105985801 | 3300010339 | Bog Forest Soil | IRVRIDEQGYTHVTVIQWDEDGREVVYREDENFQCPEVQF* |
| Ga0074045_101077253 | 3300010341 | Bog Forest Soil | MTEDGTSIRVRIDDEGYTHITVIQWDENGREIVYREDENFQCSEPQF* |
| Ga0074045_105693031 | 3300010341 | Bog Forest Soil | TEDGTSIHARIDDEGYTHITVIQWDENGREIVYREDETFQCSEPQF* |
| Ga0074044_100132619 | 3300010343 | Bog Forest Soil | MEDGTSIRVRIDDEGYTHITVTQWSEDGQEIVYREDEDFQCSEPQF* |
| Ga0074044_106408012 | 3300010343 | Bog Forest Soil | MEDGTSIRVRIDDEGYTHITVIQWNEDGREIVSREDEDFQCSEPQF* |
| Ga0074044_109927772 | 3300010343 | Bog Forest Soil | VRIDDEGYTHITVIQWDENGREIVYREDENFQCSEPQF* |
| Ga0136449_1013125443 | 3300010379 | Peatlands Soil | VGLPAKRNWADNVRMIDQRNKGSVGTEDGTSIHVRIDDEGYTHITVIQWDENGREIVYREDETFQCSEPQF* |
| Ga0138579_13276022 | 3300011090 | Peatlands Soil | TEDGTSIRVRIDDEGYTYITVTQWDENGREIVYRENENFRCSEPQF* |
| Ga0157371_115950681 | 3300013102 | Corn Rhizosphere | NVGMSGQRNGGSVMEDGTSIRVRIDEEGSTYITVTQWDEDGREIVYREDEHFQSSAPQF* |
| Ga0181524_104963931 | 3300014155 | Bog | MEDGTSIRVRIDDEGYTHITVTQWNEDGREIVYREDE |
| Ga0181518_103848892 | 3300014156 | Bog | MEDGTQIRVRIDDEGYTHVTVIQWDEDGREITYTEDE |
| Ga0181538_102824762 | 3300014162 | Bog | MEDGTQIRVRIDDEGYTHVTVIQWDEDGREITYTEDENFRVALPA* |
| Ga0181532_10000013215 | 3300014164 | Bog | MLEDSTSIRVRIDDQGYTHVTVIQWDEDGQEIVYREDENFQCSEAQL* |
| Ga0182014_100069795 | 3300014491 | Bog | MIGQRNKGSVMTEDGTSIHVRIDDEGYTHITVIQWDENGREIVYREDETFQCSEPQF* |
| Ga0187818_100580172 | 3300017823 | Freshwater Sediment | MTKDRTSFRVRIDDKGYTYITVTQWDEDGRKIVYREDEHFQCSEPQY |
| Ga0187818_104316611 | 3300017823 | Freshwater Sediment | MEDGTSIRVRIDDEGYTHITVIQWNEDGREIVSREDEDFQCSEPQF |
| Ga0187820_12223191 | 3300017924 | Freshwater Sediment | MTEDGTSIRVRIDDKGYTYITVTQWDEDGLKIVYREDEHFQCSEPQY |
| Ga0187849_10639302 | 3300017929 | Peatland | MTEDGTSIRVRIDEEGYTYITVMQWDEDGREIVYREDEHLQCSEPQF |
| Ga0187801_100549162 | 3300017933 | Freshwater Sediment | MTEDGTSIRVRIDDKGYTYITVTQWDEDGRKIVYR |
| Ga0187801_100990012 | 3300017933 | Freshwater Sediment | MTEESTSIRVRIDEQGYTHVTVIQWDEDGREVVYREDENFQCPEVQF |
| Ga0187854_102861741 | 3300017938 | Peatland | MEDGTSIRVRIDDEGYTHVTVIQWDEDGREIVYTEDENFRVAVEA |
| Ga0187853_104028041 | 3300017940 | Peatland | MEDGTSIRVRIDDEGYTHITVTQWSEDEQEIVYREDEDFQCSEPHF |
| Ga0187808_101425021 | 3300017942 | Freshwater Sediment | MCGMSGQRNGGSVITEDGTSIRVRIDDQGYTHITVIQWDEDGREIVYREDEDFQCSEPQL |
| Ga0187819_101078231 | 3300017943 | Freshwater Sediment | MTEDGTSIRVRIDDKGYTYITVTQWDEDGRKIVYREDEHFQ |
| Ga0187819_102130481 | 3300017943 | Freshwater Sediment | IRVRIDDEGYTHITVIQWNEDGREIVSREDEDFQCSEPQF |
| Ga0187819_103927352 | 3300017943 | Freshwater Sediment | MTEDGTSIRVRIDDEGYTHITVIQWDENGREIVYREDENFHCSEPQF |
| Ga0187879_1000119415 | 3300017946 | Peatland | MEDGTSIRVRIDDEGYTHITVTQWNEDGREIVYREDEDFQCSEPQF |
| Ga0187817_102389352 | 3300017955 | Freshwater Sediment | MTEDGTSIRVRIDDEGYTYITVTQWDENGREIVYREDENFRCSEPQF |
| Ga0187817_105470712 | 3300017955 | Freshwater Sediment | MTEDGTSIRVRIDDKGYTYITVTQWDEDGRKIVYREDEHFQCSEPQY |
| Ga0187816_102548981 | 3300017995 | Freshwater Sediment | VRIDDEGHTHITVTQWDENGQEIVYREDETFQCSEPQL |
| Ga0187805_100220774 | 3300018007 | Freshwater Sediment | MTEDGTSIRVRIDDQGYTHITVIQWDENGREIVYREDENFQCSEPQF |
| Ga0187873_11625171 | 3300018013 | Peatland | MEDGTSIRVRIDDEGYTHITVTQWNEDGREIVYREDEDFQCSEPQ |
| Ga0187886_11783441 | 3300018018 | Peatland | MEDGTSIRVRIDDEGYTHITVTQWNEDGREIVYREDEDFQCSEPHF |
| Ga0187857_100752801 | 3300018026 | Peatland | MEDVTQIRVRIDDEGYTHVTVIQWDEDGREITYTEDENFRVALPA |
| Ga0187875_106089342 | 3300018035 | Peatland | MIGQRNKGSVMTEDGTSIHVRIDDEGYTHITVIQWDENGREIVYREDETFQCSEPQF |
| Ga0187855_105307572 | 3300018038 | Peatland | IDDEGYTHITVTQWSEDEQEIVYREDEDFQCSEPHF |
| Ga0187862_104777982 | 3300018040 | Peatland | MEDGTSIRVHIDDEGYTHITVIQWNEDGREIVYREDEDFQCSEPQF |
| Ga0187887_100143321 | 3300018043 | Peatland | GTSIRVRIDDEGYTHITVTQWNEDGREIVYREDEDFQCSEPQF |
| Ga0210396_100043749 | 3300021180 | Soil | MTQDGTSIRVRIDHEGYTYITVTQRDENGREIVYREDEKFQCSEPQF |
| Ga0224571_1094112 | 3300022734 | Rhizosphere | MEDGTSVRVRIDDEGYTHITVIVWNENGSEIVYTEHENFKSNLAS |
| Ga0224558_10039225 | 3300023090 | Soil | MTEDGTSIHVRIDDEGYTHITVIQWDENGREIVYREDETFQCSEPQF |
| Ga0208455_10091794 | 3300025453 | Peatland | MEDGTSIRVRIDDEGYTHITVIQWNEDGREIVYREDEDFQCSEPQF |
| Ga0208689_10101051 | 3300025459 | Peatland | VSGQRDGGSVMTEDGTSIRVRIDEEGYTYITVMQWDEDGREIVYREDEHLQCSEPQF |
| Ga0208190_10486902 | 3300025473 | Peatland | GSVMEDGTSIRVRIDDEGYTHITVTQWNEDGREIVYREDEDFQCSEPQF |
| Ga0207645_1000762410 | 3300025907 | Miscanthus Rhizosphere | MEDGTSMRVRIDEEGYTYITVTQWDEDGREIVYREDEHSQFSAPQF |
| Ga0207700_103430022 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | MTEDGTSIRVRIDDEGYTCITVTQWDENGREIVYREDENFRCSEPQF |
| Ga0207664_100936434 | 3300025929 | Agricultural Soil | MTEDGTSIRVRIDDEGHTYITVTQWDENGREIVYREDENFQCSEPQF |
| Ga0207691_111985193 | 3300025940 | Miscanthus Rhizosphere | MEDGTSIRVRIDEEGSTYITVTQWDEDGREIVYRE |
| Ga0207661_109690941 | 3300025944 | Corn Rhizosphere | MEDGTSIRVRIDEEGSTYITVTQWDEDGREIVYREDEHFQSSAPQF |
| Ga0207676_118632301 | 3300026095 | Switchgrass Rhizosphere | ETALDNVGMSGQRNGGSVMEDGTSIRVRIDEEGSTYITVTQWDEDGREIVYREDEHFQSSAPQF |
| Ga0208043_10063544 | 3300027570 | Peatlands Soil | MTEDGTSIRVRIDDEGYTYITVTQWDENGREIVYRENENFRCSEPQF |
| Ga0208043_10184633 | 3300027570 | Peatlands Soil | MEDGTSIRVHIDDEGYTHITVIQWNEDEREIVYREDEDFQCSEPQF |
| Ga0209117_10021048 | 3300027645 | Forest Soil | MTEDGTSIRVRIDDEGYTYITVTQWDENGREMVYREDENFRCSEPQF |
| Ga0209446_10447242 | 3300027698 | Bog Forest Soil | MTEDGTSIHVRIDDEGYTHITVTQWSEDGQEIVYREDEDFQCSEPQF |
| Ga0209448_100796652 | 3300027783 | Bog Forest Soil | MTEDGTSIHVRIDDEGYTHITVIQWDENGREIVFREDEIFQCSEPQF |
| Ga0209656_100409171 | 3300027812 | Bog Forest Soil | MEDGTSIRICIDDEGYTHITVTQWNEDGQEIVYREDEDFQCSEPQF |
| Ga0209039_101341142 | 3300027825 | Bog Forest Soil | MTEDGTSIRVRIDDEGYTHITVIQWDENGREIVYREDENFQCSEPQF |
| Ga0209580_100423744 | 3300027842 | Surface Soil | MTQDGTSIRVRIDHEGYTYITVTQWDENGREIVYREDENFQCSEPQF |
| Ga0209517_102523632 | 3300027854 | Peatlands Soil | SVMEDGTSIRVHIDDEGYTHITVIQWNEDEREIVYREDEDFQCSEPQF |
| Ga0209067_100142738 | 3300027898 | Watersheds | MTEDGTSIHVRIDDEGYTHITVMQWDENGREIVYREDEIFQCSEPQF |
| Ga0209698_100471993 | 3300027911 | Watersheds | MTEEGTSIRVRIDDEGYTYITVTQWDENGREIVYRENENFRCSEPQC |
| Ga0209698_100629771 | 3300027911 | Watersheds | MEDGTSIRVRIDDQGHTYMTVVQWDENGRDMYREDENLQCSGPQF |
| Ga0209698_101809412 | 3300027911 | Watersheds | MIGERNKGSVMTEDGTSIHVRIDDEGYTHITVIQRDENGREIVYREDENFQCSEPQF |
| Ga0247271_1103771 | 3300029903 | Soil | MIGQRNKGSVMTEDGTSIHVRIDHEGYTHIAVIQWDENGREIVYREDETFLCSEPQF |
| Ga0170823_105545652 | 3300031128 | Forest Soil | MSGQRNGGRIMTEDGTSIRVRIDDEGYTYITVTQWDENGREIVYREDENFRCSEPQF |
| Ga0170824_1000392941 | 3300031231 | Forest Soil | MTEDGTSIRVRIDDEGYTYITVTQWDENGRGIVYREDENF |
| Ga0307473_103635732 | 3300031820 | Hardwood Forest Soil | MSGQRNGGRVMTEDGTSIRVRIDDEGHTYITVTQWDENGREIVYREDENFQCSEPQF |
| Ga0307470_108834702 | 3300032174 | Hardwood Forest Soil | MSGQRNGGRVMTQDGASIRVRIDDEGYTCITVTQWNENGREIVYREDENFRCSEPQF |
| Ga0307471_1007087911 | 3300032180 | Hardwood Forest Soil | MTQDGASIRVRIDDEGYTCITVTQWNENGREIVYREDENFRCSEPQF |
| Ga0307472_1001456852 | 3300032205 | Hardwood Forest Soil | GNGGRVMTEDGTSIRVRIDHEGYTYITVTQWDENGREIVYREDQNFQCSEAQF |
| Ga0307472_1021263531 | 3300032205 | Hardwood Forest Soil | MTEDGTSIRVRIDHEGYTYITVTQWDENGREIVYRE |
| Ga0335082_101222121 | 3300032782 | Soil | MTEESTSIRVRIDEQGYTHVTVIQWDEDGREVVYREDENFQCP |
| Ga0335078_113476042 | 3300032805 | Soil | MQEVCRLGVMRKAGWVMTEESTSIRVRIDEQGYTHVTVIQWDEDGREVVYREDENFQCPEVQF |
| Ga0335080_114908511 | 3300032828 | Soil | SIRVRIDEQGYTHVTVIQWDEDGREVVYREDENFQCPEVQF |
| Ga0335070_100318231 | 3300032829 | Soil | MTEESTSIRVRIDEQGYTHVTVIQWDEDGREVVYREDENFQCPE |
| Ga0335070_109564991 | 3300032829 | Soil | DEQGYTHVTVIQWDEDGREVVYREDENFQCPEVQF |
| Ga0335081_100982643 | 3300032892 | Soil | MTEDGTSIRIRINDEGYTYITVTQWDEDGREIVYREDEQFQCSEPQL |
| Ga0335069_1001367414 | 3300032893 | Soil | MREESTSIRVRIDEQGYTHVTVIQWDEDGREVVYREDENFQCPEVQF |
| Ga0335074_100186536 | 3300032895 | Soil | MTEESTSIRVRIDEQGYTHVTVVQWDEDGREVICREDENFQCPEVQF |
| Ga0335074_108646222 | 3300032895 | Soil | MEDGTSIRVRIDDQGYTHVTVIQWDEDGQEVLYREDENFQCSEAEF |
| Ga0335072_100465908 | 3300032898 | Soil | MTEESTSIRVRIDEQGYTHVTVVQWDEDGREVIYREDENFQCPEVQF |
| Ga0335076_104709152 | 3300032955 | Soil | MTEESTSIRVRIDEQGYTHVTVIQWDEDGREVVYREDENFQCPEVQS |
| Ga0326728_1000911614 | 3300033402 | Peat Soil | MTEDGTSIRVRIDDEGYTHITVIQWDENGQEIVYREDEKFQCSEPQF |
| Ga0326727_100046963 | 3300033405 | Peat Soil | VTEDGTSIRVRIDDQGYTHITVIQWDEDGREIVYHEDEDFQCSEPQL |
| Ga0326724_0184694_2_205 | 3300034091 | Peat Soil | RKRNWVDNVRMSGQRNGGSVMTEDGTSIRVRIDDQGYTHITVIQWDENGREIVYREDENFQCSEPQF |
| ⦗Top⦘ |