NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F062068

Metagenome Family F062068

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F062068
Family Type Metagenome
Number of Sequences 131
Average Sequence Length 39 residues
Representative Sequence MATRAVEVAVGVPALAAERAVTWPKRTKARLSNGLEVIL
Number of Associated Samples 120
Number of Associated Scaffolds 131

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 100.00 %
% of genes near scaffold ends (potentially truncated) 96.95 %
% of genes from short scaffolds (< 2000 bps) 90.08 %
Associated GOLD sequencing projects 115
AlphaFold2 3D model prediction Yes
3D model pTM-score0.29

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (96.947 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(22.901 % of family members)
Environment Ontology (ENVO) Unclassified
(24.427 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(51.145 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 0.00%    β-sheet: 8.96%    Coil/Unstructured: 91.04%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.29
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 131 Family Scaffolds
PF05193Peptidase_M16_C 55.73
PF10728DUF2520 1.53
PF13641Glyco_tranf_2_3 0.76
PF00498FHA 0.76
PF09290AcetDehyd-dimer 0.76

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 131 Family Scaffolds
COG4569Acetaldehyde dehydrogenase (acetylating)Secondary metabolites biosynthesis, transport and catabolism [Q] 0.76

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms96.95 %
UnclassifiedrootN/A3.05 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000580|AF_2010_repII_A01DRAFT_1047843All Organisms → cellular organisms → Bacteria659Open in IMG/M
3300000955|JGI1027J12803_108950242All Organisms → cellular organisms → Bacteria914Open in IMG/M
3300001661|JGI12053J15887_10048448All Organisms → cellular organisms → Bacteria → Acidobacteria2380Open in IMG/M
3300002910|JGI25615J43890_1094253All Organisms → cellular organisms → Bacteria531Open in IMG/M
3300002911|JGI25390J43892_10001222All Organisms → cellular organisms → Bacteria5297Open in IMG/M
3300004092|Ga0062389_102291837All Organisms → cellular organisms → Bacteria712Open in IMG/M
3300004635|Ga0062388_100354918All Organisms → cellular organisms → Bacteria → Acidobacteria1252Open in IMG/M
3300005187|Ga0066675_11055621All Organisms → cellular organisms → Bacteria608Open in IMG/M
3300005451|Ga0066681_10503399All Organisms → cellular organisms → Bacteria → Proteobacteria747Open in IMG/M
3300005536|Ga0070697_101498316All Organisms → cellular organisms → Bacteria → Proteobacteria603Open in IMG/M
3300005539|Ga0068853_101937915All Organisms → cellular organisms → Bacteria571Open in IMG/M
3300005712|Ga0070764_11043041All Organisms → cellular organisms → Bacteria517Open in IMG/M
3300006050|Ga0075028_100307730All Organisms → cellular organisms → Bacteria885Open in IMG/M
3300006086|Ga0075019_10693357All Organisms → cellular organisms → Bacteria644Open in IMG/M
3300006162|Ga0075030_100905160All Organisms → cellular organisms → Bacteria696Open in IMG/M
3300006174|Ga0075014_100434723All Organisms → cellular organisms → Bacteria722Open in IMG/M
3300006796|Ga0066665_11138545All Organisms → cellular organisms → Bacteria594Open in IMG/M
3300007255|Ga0099791_10424261All Organisms → cellular organisms → Bacteria642Open in IMG/M
3300009038|Ga0099829_11096066All Organisms → cellular organisms → Bacteria660Open in IMG/M
3300009629|Ga0116119_1040945All Organisms → cellular organisms → Bacteria → Acidobacteria1219Open in IMG/M
3300009824|Ga0116219_10588346All Organisms → cellular organisms → Bacteria612Open in IMG/M
3300010043|Ga0126380_10419012All Organisms → cellular organisms → Bacteria1001Open in IMG/M
3300010159|Ga0099796_10511131All Organisms → cellular organisms → Bacteria538Open in IMG/M
3300010325|Ga0134064_10031705All Organisms → cellular organisms → Bacteria → Acidobacteria1554Open in IMG/M
3300010325|Ga0134064_10182058All Organisms → cellular organisms → Bacteria744Open in IMG/M
3300010335|Ga0134063_10780299All Organisms → cellular organisms → Bacteria → Acidobacteria500Open in IMG/M
3300010339|Ga0074046_10845723All Organisms → cellular organisms → Bacteria534Open in IMG/M
3300010376|Ga0126381_102546357All Organisms → cellular organisms → Bacteria733Open in IMG/M
3300010376|Ga0126381_104594817All Organisms → cellular organisms → Bacteria532Open in IMG/M
3300010401|Ga0134121_10078872All Organisms → cellular organisms → Bacteria2735Open in IMG/M
3300011269|Ga0137392_10709436All Organisms → cellular organisms → Bacteria833Open in IMG/M
3300011269|Ga0137392_11336389All Organisms → cellular organisms → Bacteria576Open in IMG/M
3300012096|Ga0137389_10406378All Organisms → cellular organisms → Bacteria → Acidobacteria1163Open in IMG/M
3300012096|Ga0137389_10462319All Organisms → cellular organisms → Bacteria1087Open in IMG/M
3300012096|Ga0137389_10750260All Organisms → cellular organisms → Bacteria838Open in IMG/M
3300012096|Ga0137389_10985676All Organisms → cellular organisms → Bacteria722Open in IMG/M
3300012189|Ga0137388_10622493All Organisms → cellular organisms → Bacteria1003Open in IMG/M
3300012203|Ga0137399_11149029All Organisms → cellular organisms → Bacteria654Open in IMG/M
3300012349|Ga0137387_10238753All Organisms → cellular organisms → Bacteria → Acidobacteria1309Open in IMG/M
3300012361|Ga0137360_10545386All Organisms → cellular organisms → Bacteria990Open in IMG/M
3300012362|Ga0137361_11642085All Organisms → cellular organisms → Bacteria563Open in IMG/M
3300012922|Ga0137394_11622431All Organisms → cellular organisms → Bacteria503Open in IMG/M
3300012927|Ga0137416_11895643All Organisms → cellular organisms → Bacteria545Open in IMG/M
3300012929|Ga0137404_10912923All Organisms → cellular organisms → Bacteria801Open in IMG/M
3300012930|Ga0137407_10688963All Organisms → cellular organisms → Bacteria962Open in IMG/M
3300012930|Ga0137407_12312781All Organisms → cellular organisms → Bacteria514Open in IMG/M
3300012986|Ga0164304_11211063All Organisms → cellular organisms → Bacteria610Open in IMG/M
3300014199|Ga0181535_10438278All Organisms → cellular organisms → Bacteria761Open in IMG/M
3300016357|Ga0182032_10788427All Organisms → cellular organisms → Bacteria802Open in IMG/M
3300016387|Ga0182040_10153309All Organisms → cellular organisms → Bacteria → Acidobacteria1645Open in IMG/M
3300016404|Ga0182037_12140402All Organisms → cellular organisms → Bacteria503Open in IMG/M
3300016445|Ga0182038_10403532All Organisms → cellular organisms → Bacteria1146Open in IMG/M
3300016445|Ga0182038_10781552All Organisms → cellular organisms → Bacteria836Open in IMG/M
3300017822|Ga0187802_10139801All Organisms → cellular organisms → Bacteria922Open in IMG/M
3300017933|Ga0187801_10230106All Organisms → cellular organisms → Bacteria741Open in IMG/M
3300017936|Ga0187821_10353799All Organisms → cellular organisms → Bacteria593Open in IMG/M
3300017955|Ga0187817_10994524All Organisms → cellular organisms → Bacteria537Open in IMG/M
3300017961|Ga0187778_10335543All Organisms → cellular organisms → Bacteria982Open in IMG/M
3300018007|Ga0187805_10189613All Organisms → cellular organisms → Bacteria938Open in IMG/M
3300018034|Ga0187863_10439602All Organisms → cellular organisms → Bacteria728Open in IMG/M
3300018085|Ga0187772_11369623All Organisms → cellular organisms → Bacteria525Open in IMG/M
3300020170|Ga0179594_10014922All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium2252Open in IMG/M
3300020579|Ga0210407_10085585All Organisms → cellular organisms → Bacteria2380Open in IMG/M
3300020579|Ga0210407_10494704All Organisms → cellular organisms → Bacteria956Open in IMG/M
3300020580|Ga0210403_10047926All Organisms → cellular organisms → Bacteria3417Open in IMG/M
3300020580|Ga0210403_11003755All Organisms → cellular organisms → Bacteria653Open in IMG/M
3300021088|Ga0210404_10398528All Organisms → cellular organisms → Bacteria769Open in IMG/M
3300021088|Ga0210404_10667844All Organisms → cellular organisms → Bacteria592Open in IMG/M
3300021168|Ga0210406_10918279All Organisms → cellular organisms → Bacteria657Open in IMG/M
3300021180|Ga0210396_10293730All Organisms → cellular organisms → Bacteria → Acidobacteria1440Open in IMG/M
3300021401|Ga0210393_10724288All Organisms → cellular organisms → Bacteria811Open in IMG/M
3300021403|Ga0210397_11395508All Organisms → cellular organisms → Bacteria544Open in IMG/M
3300021405|Ga0210387_11276329All Organisms → cellular organisms → Bacteria635Open in IMG/M
3300021406|Ga0210386_10032434All Organisms → cellular organisms → Bacteria4106Open in IMG/M
3300021407|Ga0210383_10692230All Organisms → cellular organisms → Bacteria876Open in IMG/M
3300021433|Ga0210391_10406943All Organisms → cellular organisms → Bacteria1068Open in IMG/M
3300021477|Ga0210398_10097276All Organisms → cellular organisms → Bacteria → Proteobacteria2390Open in IMG/M
3300021478|Ga0210402_11336233All Organisms → cellular organisms → Bacteria644Open in IMG/M
3300021559|Ga0210409_10779747All Organisms → cellular organisms → Bacteria828Open in IMG/M
3300022840|Ga0224549_1025567All Organisms → cellular organisms → Bacteria806Open in IMG/M
3300024222|Ga0247691_1062281All Organisms → cellular organisms → Bacteria563Open in IMG/M
3300024330|Ga0137417_1170627All Organisms → cellular organisms → Bacteria1096Open in IMG/M
3300025409|Ga0208321_1067143All Organisms → cellular organisms → Bacteria508Open in IMG/M
3300025472|Ga0208692_1019042All Organisms → cellular organisms → Bacteria2075Open in IMG/M
3300025910|Ga0207684_11642625All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria519Open in IMG/M
3300025922|Ga0207646_10743470All Organisms → cellular organisms → Bacteria875Open in IMG/M
3300025937|Ga0207669_11810614Not Available522Open in IMG/M
3300026304|Ga0209240_1189269All Organisms → cellular organisms → Bacteria622Open in IMG/M
3300026333|Ga0209158_1249307All Organisms → cellular organisms → Bacteria609Open in IMG/M
3300026482|Ga0257172_1076569All Organisms → cellular organisms → Bacteria615Open in IMG/M
3300026537|Ga0209157_1307676All Organisms → cellular organisms → Bacteria579Open in IMG/M
3300026547|Ga0209156_10163176All Organisms → cellular organisms → Bacteria1076Open in IMG/M
3300027562|Ga0209735_1031756All Organisms → cellular organisms → Bacteria1109Open in IMG/M
3300027605|Ga0209329_1111888All Organisms → cellular organisms → Bacteria600Open in IMG/M
3300027629|Ga0209422_1013498All Organisms → cellular organisms → Bacteria2018Open in IMG/M
3300027725|Ga0209178_1131043All Organisms → cellular organisms → Bacteria855Open in IMG/M
3300027727|Ga0209328_10124303All Organisms → cellular organisms → Bacteria788Open in IMG/M
3300027729|Ga0209248_10236012All Organisms → cellular organisms → Bacteria535Open in IMG/M
3300027812|Ga0209656_10483524All Organisms → cellular organisms → Bacteria543Open in IMG/M
3300027842|Ga0209580_10675133All Organisms → cellular organisms → Bacteria511Open in IMG/M
3300027884|Ga0209275_10830334All Organisms → cellular organisms → Bacteria533Open in IMG/M
3300027889|Ga0209380_10398323All Organisms → cellular organisms → Bacteria807Open in IMG/M
3300028138|Ga0247684_1022219All Organisms → cellular organisms → Bacteria1002Open in IMG/M
3300028380|Ga0268265_10791957All Organisms → cellular organisms → Bacteria923Open in IMG/M
3300028536|Ga0137415_10914631All Organisms → cellular organisms → Bacteria687Open in IMG/M
3300028800|Ga0265338_10366211All Organisms → cellular organisms → Bacteria1033Open in IMG/M
3300031057|Ga0170834_102799399All Organisms → cellular organisms → Bacteria643Open in IMG/M
3300031680|Ga0318574_10777886All Organisms → cellular organisms → Bacteria561Open in IMG/M
3300031708|Ga0310686_108946688All Organisms → cellular organisms → Bacteria594Open in IMG/M
3300031715|Ga0307476_11081559All Organisms → cellular organisms → Bacteria589Open in IMG/M
3300031720|Ga0307469_10471452All Organisms → cellular organisms → Bacteria1092Open in IMG/M
3300031723|Ga0318493_10162733All Organisms → cellular organisms → Bacteria → Acidobacteria1161Open in IMG/M
3300031724|Ga0318500_10578145All Organisms → cellular organisms → Bacteria568Open in IMG/M
3300031736|Ga0318501_10755960All Organisms → cellular organisms → Bacteria → Acidobacteria537Open in IMG/M
3300031753|Ga0307477_10861977All Organisms → cellular organisms → Bacteria599Open in IMG/M
3300031798|Ga0318523_10261505All Organisms → cellular organisms → Bacteria865Open in IMG/M
3300031820|Ga0307473_11031235All Organisms → cellular organisms → Bacteria602Open in IMG/M
3300031833|Ga0310917_10614237All Organisms → cellular organisms → Bacteria738Open in IMG/M
3300031954|Ga0306926_10548327All Organisms → cellular organisms → Bacteria → Acidobacteria1416Open in IMG/M
3300031962|Ga0307479_12101383All Organisms → cellular organisms → Bacteria513Open in IMG/M
3300032035|Ga0310911_10836516All Organisms → cellular organisms → Bacteria531Open in IMG/M
3300032059|Ga0318533_10175362All Organisms → cellular organisms → Bacteria → Acidobacteria1526Open in IMG/M
3300032094|Ga0318540_10393416All Organisms → cellular organisms → Bacteria669Open in IMG/M
3300032180|Ga0307471_100595292All Organisms → cellular organisms → Bacteria → Acidobacteria1264Open in IMG/M
3300032828|Ga0335080_10596065All Organisms → cellular organisms → Bacteria → Acidobacteria1163Open in IMG/M
3300032892|Ga0335081_10705814All Organisms → cellular organisms → Bacteria → Acidobacteria1222Open in IMG/M
3300033290|Ga0318519_10089305All Organisms → cellular organisms → Bacteria → Acidobacteria1638Open in IMG/M
3300033405|Ga0326727_10442880All Organisms → cellular organisms → Bacteria → Acidobacteria1164Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil22.90%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil16.79%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil6.11%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil4.58%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil4.58%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment3.82%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil3.82%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil3.05%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds3.05%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil3.05%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland2.29%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil2.29%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil2.29%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil2.29%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil2.29%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere2.29%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil1.53%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil1.53%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland1.53%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland0.76%
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog0.76%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil0.76%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil0.76%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil0.76%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil0.76%
Bog Forest SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil0.76%
SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Soil0.76%
Peat SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil0.76%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere0.76%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.76%
RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere0.76%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere0.76%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000580Forest soil microbial communities from Amazon forest - 2010 replicate II A01EnvironmentalOpen in IMG/M
3300000955Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300001661Mediterranean Blodgett CA OM1_O3 (Mediterranean Blodgett coassembly)EnvironmentalOpen in IMG/M
3300002910Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_80cmEnvironmentalOpen in IMG/M
3300002911Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cmEnvironmentalOpen in IMG/M
3300004092Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3EnvironmentalOpen in IMG/M
3300004635Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3EnvironmentalOpen in IMG/M
3300005187Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124EnvironmentalOpen in IMG/M
3300005451Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130EnvironmentalOpen in IMG/M
3300005536Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaGEnvironmentalOpen in IMG/M
3300005539Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2Host-AssociatedOpen in IMG/M
3300005712Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4EnvironmentalOpen in IMG/M
3300006050Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014EnvironmentalOpen in IMG/M
3300006086Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013EnvironmentalOpen in IMG/M
3300006162Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012EnvironmentalOpen in IMG/M
3300006174Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014EnvironmentalOpen in IMG/M
3300006796Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114EnvironmentalOpen in IMG/M
3300007255Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1EnvironmentalOpen in IMG/M
3300009038Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaGEnvironmentalOpen in IMG/M
3300009629Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_100EnvironmentalOpen in IMG/M
3300009824Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaGEnvironmentalOpen in IMG/M
3300010043Tropical forest soil microbial communities from Panama - MetaG Plot_26EnvironmentalOpen in IMG/M
3300010159Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3EnvironmentalOpen in IMG/M
3300010325Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_0_1 metaGEnvironmentalOpen in IMG/M
3300010335Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015EnvironmentalOpen in IMG/M
3300010339Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM3EnvironmentalOpen in IMG/M
3300010376Tropical forest soil microbial communities from Panama - MetaG Plot_28EnvironmentalOpen in IMG/M
3300010401Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1EnvironmentalOpen in IMG/M
3300011269Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaGEnvironmentalOpen in IMG/M
3300012096Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaGEnvironmentalOpen in IMG/M
3300012189Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaGEnvironmentalOpen in IMG/M
3300012203Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaGEnvironmentalOpen in IMG/M
3300012349Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaGEnvironmentalOpen in IMG/M
3300012361Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaGEnvironmentalOpen in IMG/M
3300012362Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaGEnvironmentalOpen in IMG/M
3300012922Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaGEnvironmentalOpen in IMG/M
3300012927Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012929Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012930Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012986Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MGEnvironmentalOpen in IMG/M
3300014199Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_30_metaGEnvironmentalOpen in IMG/M
3300016357Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000EnvironmentalOpen in IMG/M
3300016387Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176EnvironmentalOpen in IMG/M
3300016404Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082EnvironmentalOpen in IMG/M
3300016445Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108EnvironmentalOpen in IMG/M
3300017822Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_2EnvironmentalOpen in IMG/M
3300017933Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_1EnvironmentalOpen in IMG/M
3300017936Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_1EnvironmentalOpen in IMG/M
3300017955Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2EnvironmentalOpen in IMG/M
3300017961Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MGEnvironmentalOpen in IMG/M
3300018007Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_5EnvironmentalOpen in IMG/M
3300018034Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_10EnvironmentalOpen in IMG/M
3300018085Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300020170Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad1_1_08_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300020579Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-MEnvironmentalOpen in IMG/M
3300020580Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-MEnvironmentalOpen in IMG/M
3300021088Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-MEnvironmentalOpen in IMG/M
3300021168Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-MEnvironmentalOpen in IMG/M
3300021180Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-OEnvironmentalOpen in IMG/M
3300021401Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-OEnvironmentalOpen in IMG/M
3300021403Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-OEnvironmentalOpen in IMG/M
3300021405Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-OEnvironmentalOpen in IMG/M
3300021406Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-OEnvironmentalOpen in IMG/M
3300021407Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-OEnvironmentalOpen in IMG/M
3300021433Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-OEnvironmentalOpen in IMG/M
3300021477Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-OEnvironmentalOpen in IMG/M
3300021478Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-MEnvironmentalOpen in IMG/M
3300021559Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-MEnvironmentalOpen in IMG/M
3300022840Peat soil microbial communities from Stordalen Mire, Sweden - 717 P3 1-5EnvironmentalOpen in IMG/M
3300024222Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK32EnvironmentalOpen in IMG/M
3300024330Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (PacBio error correction)EnvironmentalOpen in IMG/M
3300025409Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_4_150 (SPAdes)EnvironmentalOpen in IMG/M
3300025472Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_100 (SPAdes)EnvironmentalOpen in IMG/M
3300025910Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025922Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025937Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026297Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_40cm (SPAdes)EnvironmentalOpen in IMG/M
3300026304Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_80cm (SPAdes)EnvironmentalOpen in IMG/M
3300026328Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 (SPAdes)EnvironmentalOpen in IMG/M
3300026333Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 (SPAdes)EnvironmentalOpen in IMG/M
3300026482Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-16-BEnvironmentalOpen in IMG/M
3300026537Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 (SPAdes)EnvironmentalOpen in IMG/M
3300026547Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 (SPAdes)EnvironmentalOpen in IMG/M
3300027562Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M2 (SPAdes)EnvironmentalOpen in IMG/M
3300027605Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_M3 (SPAdes)EnvironmentalOpen in IMG/M
3300027629Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M3 (SPAdes)EnvironmentalOpen in IMG/M
3300027725Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 (SPAdes)EnvironmentalOpen in IMG/M
3300027727Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M1 (SPAdes)EnvironmentalOpen in IMG/M
3300027729Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM1 (SPAdes)EnvironmentalOpen in IMG/M
3300027812Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM2 (SPAdes)EnvironmentalOpen in IMG/M
3300027842Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027884Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes)EnvironmentalOpen in IMG/M
3300027889Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes)EnvironmentalOpen in IMG/M
3300028138Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK25EnvironmentalOpen in IMG/M
3300028380Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300028536Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300028800Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaGHost-AssociatedOpen in IMG/M
3300031057Oak Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031680Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22EnvironmentalOpen in IMG/M
3300031708FICUS49499 Metagenome Czech Republic combined assemblyEnvironmentalOpen in IMG/M
3300031715Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05EnvironmentalOpen in IMG/M
3300031720Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515EnvironmentalOpen in IMG/M
3300031723Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23EnvironmentalOpen in IMG/M
3300031724Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20EnvironmentalOpen in IMG/M
3300031736Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21EnvironmentalOpen in IMG/M
3300031753Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515EnvironmentalOpen in IMG/M
3300031798Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f19EnvironmentalOpen in IMG/M
3300031820Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515EnvironmentalOpen in IMG/M
3300031833Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178EnvironmentalOpen in IMG/M
3300031954Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2)EnvironmentalOpen in IMG/M
3300031962Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515EnvironmentalOpen in IMG/M
3300032035Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170EnvironmentalOpen in IMG/M
3300032059Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27EnvironmentalOpen in IMG/M
3300032094Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f25EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300032828Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4EnvironmentalOpen in IMG/M
3300032892Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5EnvironmentalOpen in IMG/M
3300033158Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1EnvironmentalOpen in IMG/M
3300033290Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15EnvironmentalOpen in IMG/M
3300033405Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB29MYEnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
AF_2010_repII_A01DRAFT_104784313300000580Forest SoilMASRPVEVAVGVPALAPERQVTWPKRTRTRLANGLEVILAASHTI
JGI1027J12803_10895024233300000955SoilMATKAAEISNLVPALTAERPVTWPKRTRARLANGLQVVLAEA
JGI12053J15887_1004844833300001661Forest SoilMATRAATEISSSVPPLSAERQVTWPKRTKARLTNGLEVVL
JGI25615J43890_109425323300002910Grasslands SoilMATRVVEVANGVPGLAAERAVTWPKRTKARLSNGLEVILAEAH
JGI25390J43892_1000122253300002911Grasslands SoilMATRAVEVAVGVPALAPERPVTWPKRTRARLSNGLEVILAEA
Ga0062389_10229183713300004092Bog Forest SoilMATKAPEMSSLIPALSAERVVTWPKRTRAKLANGLEVVLAE
Ga0062388_10035491813300004635Bog Forest SoilMATRAVEVNDAVPALSAERQVTWPNRKRARLSNGLEVVLVESHTI
Ga0066675_1105562123300005187SoilMASRPVEVAVGVPALAPEREVTWPKRTKAKLANGLEVILA
Ga0066681_1050339923300005451SoilMSSRAVEVAKGVPPLAPEREVIWPKPTREKLANGLQVILAESHSIPKFHGQL
Ga0070697_10149831613300005536Corn, Switchgrass And Miscanthus RhizosphereMATRAVEVKNDVPALAPERQVTWPKRQRARLSNGLEVILVESHTIPKFHGE
Ga0068853_10193791523300005539Corn RhizosphereMATRAAEVPTTVPALSAERPVTWPKVTKSRLANGLEIVLAE
Ga0070764_1104304113300005712SoilMATQTRVESAGTTVPALGAERAVTWPKRTRVRLANG
Ga0075028_10030773023300006050WatershedsMATRAVEVATSVPALTSERAVTWPKRTRARLSNGL
Ga0075019_1069335723300006086WatershedsMATRAAEIATGVPALSAERSVAWPKQTKARLSNGLEIILAES
Ga0075030_10090516013300006162WatershedsMATRASEIATGVPALSAERSVAWPKQTKARLSNGLEIILAES
Ga0075014_10043472313300006174WatershedsMATQAAEISNLVPGLAPERPVTWPKRTKARLSNGLQVVLA
Ga0066665_1113854513300006796SoilMAARVVEVANGVPGLAAERAVTWPKRTKAQLSNGLEV
Ga0099791_1042426113300007255Vadose Zone SoilMATRTVEVATGIPGLAAERAVTWPKRTKARLSNGLEVIL
Ga0099829_1109606623300009038Vadose Zone SoilMAPRSVEVANGVPALAPEREVTWPKRAKTRLANGLEVIL
Ga0116119_104094513300009629PeatlandMATREAEVPTLAPALTPERPVTWPKRTRARLANGLE
Ga0116219_1058834613300009824Peatlands SoilMATRAPEVAIAAPALAPERAVTWPNRTRARLSNGLEIVLAEARSIPKFH
Ga0126380_1041901223300010043Tropical Forest SoilMATRAAEIPTTVPALSAERAVTWPKVTKARLANGLQVVLA
Ga0099796_1051113123300010159Vadose Zone SoilMATRTVEVATGIPALAAERAVTWPERTRARLSNGL
Ga0134064_1003170533300010325Grasslands SoilMATRAFVVAVGVPALAPERPMTWPKRTMARLSNGLEVILAEAHSIP
Ga0134064_1018205813300010325Grasslands SoilMTARVAEIANGVPGLAVERAVTWPKRTKARLPNGLDVILAEAHS
Ga0134063_1078029923300010335Grasslands SoilMASRTVEVAVGVPVLAPEREVTWPKRTKTRLSNGLEVIL
Ga0074046_1084572323300010339Bog Forest SoilMAPIATEVPTLAPALTPERPVTWPKRTRARLANGLAVVLAEAHSIP
Ga0126381_10254635723300010376Tropical Forest SoilMATKAAEISNLVPALTAERPVTWPKRTRTRLANGL
Ga0126381_10459481723300010376Tropical Forest SoilMASRAQEIPSAVPALTAERAVTWPKRTRARLANGLEVV
Ga0134121_1007887243300010401Terrestrial SoilMATRAAEVPTTVPALSAERPVTWPKVTKSRLANGLEIVLA
Ga0137392_1070943613300011269Vadose Zone SoilMATRTVEVATGVPALAPERAVTWPKRTRARLSNGLEVILAE
Ga0137392_1133638913300011269Vadose Zone SoilMATRVVEVANGVPGLAAERAVTWPKRTTARFSNGLEVILAEARS
Ga0137389_1040637823300012096Vadose Zone SoilMASRAPEFSAAVPALTAERPVTWPKRTRARLANGL
Ga0137389_1046231913300012096Vadose Zone SoilMATRVVEVANGVPGLAAERAVTWPKRTRARLSNGLEVILAEAHS
Ga0137389_1075026013300012096Vadose Zone SoilMATRAAADIHTAVPRLSPERQVTWPKRTKTRLANG
Ga0137389_1098567613300012096Vadose Zone SoilMATRAVEVANGVPGLAPERAVTWPKRTKARLSNGL
Ga0137388_1062249323300012189Vadose Zone SoilMATRTVEVATGVPGLSAERAVTWPKRTKTRLSNGLEVVLAEA
Ga0137399_1114902913300012203Vadose Zone SoilMATRTVEVATGVPGLSAERAVTWPKRTKAKLSNGL
Ga0137387_1023875313300012349Vadose Zone SoilMVARVAEIANGVPGLAAERAVTWPKRTKARLPNGLDVI
Ga0137360_1054538613300012361Vadose Zone SoilMATRTVEVATGAPALSAERAVTWPKRTKARLSNGLEVVL
Ga0137361_1164208523300012362Vadose Zone SoilMATRTVEVAQGVPALAPERAVTWPKRTKARLSNGLEVILAE
Ga0137394_1162243123300012922Vadose Zone SoilMATRTVEVATGVPGLSAERAVTWPRRSKSRLSNGLEVVLAE
Ga0137416_1189564313300012927Vadose Zone SoilMATRAVEVANGVPALSSERAVTWPKRTRARLSNGLEIILAEAHS
Ga0137404_1091292313300012929Vadose Zone SoilVATRAVEVNEAVPALSPERQVTWPPRKRTRLSNGLEVILVESH
Ga0137407_1068896313300012930Vadose Zone SoilMATSAVEVAVGVPALSSERAVTWPKRTRARLSNGLEVILAE
Ga0137407_1231278123300012930Vadose Zone SoilMATRTVEVATGVPALSAERAVTWPKRTKARLSNGLEVVL
Ga0164304_1121106313300012986SoilMATRAVEVNNAVPALAPERQVTWPKRQRARLSNGLEVILVESHTIPKFHGELF
Ga0181535_1043827823300014199BogMVTRAPQGAIAAPALASERAVTWPKRTRARLSNGLQV
Ga0182032_1078842723300016357SoilMASRAQEIPAVPALAAERPVTWPKRTRTRLSNGLEVVLA
Ga0182040_1015330913300016387SoilMATQATEMPVAVPALAPERAVKWPKRTRAQLANGLQVVLA
Ga0182037_1214040213300016404SoilMATQATEIAKGVPALAAERAVTWPKRTRARLANGLEVVLA
Ga0182038_1040353213300016445SoilMASRPVEVAVGVPALAPERQVTWPKLTRTRLANGLEVILA
Ga0182038_1078155213300016445SoilMATQATEMLVAAPALAPERAVKWPKRTRARLANGLQV
Ga0187802_1013980123300017822Freshwater SedimentMTTRTVEVATDVPALAAERAVTWPKRRKAVLSNGL
Ga0187801_1023010613300017933Freshwater SedimentMATREAEVPTLAPPLTPERPVTWPKRTRARLLNGL
Ga0187821_1035379923300017936Freshwater SedimentMATRTAEVTNSVPALTAERAVAWPKRTRARLSNGL
Ga0187817_1099452413300017955Freshwater SedimentMATKAPQVATAAPALAPERSVNWPKRTRARLSNGLQV
Ga0187778_1033554323300017961Tropical PeatlandMATREAEVPTLAPGLTPERPVTWPKRTRARLANGLEVV
Ga0187805_1018961323300018007Freshwater SedimentMATRAPEVAIAAPALAPERPVSWPKRTRARLSNGLE
Ga0187863_1043960213300018034PeatlandMATIAKEVPTLPPALTPERPVTWPKRTRTRLANGL
Ga0187772_1136962323300018085Tropical PeatlandMATRAQGVATTVPALAAERSVTWPKRTRARLSNGLEIVLAE
Ga0179594_1001492213300020170Vadose Zone SoilMATRAVEVAVGVPALAAERAVTWPKRTKARLSNGLEVIL
Ga0210407_1008558533300020579SoilMATRPAAEIHNAVPPLSAERQVTWPKRTKARLANGLEVV
Ga0210407_1049470413300020579SoilMATQATEVSTLVPALTAEQEVNWPKRTRAKLSNGLQVV
Ga0210403_1004792643300020580SoilVATRTAQLPTEAPALSPERPVSWPKRTKARLSNGLEVI
Ga0210403_1100375523300020580SoilMATRAAEVQTSVPPLSPERQVTWPKRTRTQLANGL
Ga0210404_1039852823300021088SoilMATRAVEVSDAVPALSAERQVTWPNRKRARLSNGLEVILVESHTIPKFHG
Ga0210404_1066784423300021088SoilMASRTMEVATGVPRLSAERAVTWPKRTKARLSNGLEVVLAEA
Ga0210406_1091827923300021168SoilMMASRATEISAAVPALTAERPVTWPKRTRARLANGLEVVLAEA
Ga0210396_1029373013300021180SoilMATRAPEVAIAAPALAPERPVTWPHRTRARLSNGLEVVLAEAH
Ga0210393_1072428813300021401SoilMATQTRVESAGTTVPALGAERAVTWPKRTRVRLAN
Ga0210397_1139550813300021403SoilMATRAVEVNHAVPALSAERQVTWPNRKRARLSNGLEVILVESHT
Ga0210387_1127632923300021405SoilMATRAVEVNDAVPALSAERQVTWPNRKRARLSNGLEVILVES
Ga0210386_1003243453300021406SoilMATQATEVSTLVPALTAERQVNWPKRTRATLSNGLQVVLAE
Ga0210383_1069223013300021407SoilVATRTAQVPTEAPSLSPERPVSWPKRTKARLSNGLEVIL
Ga0210391_1040694323300021433SoilMATRAVEVNDAVPALSAERQVTWPNRKRARLSNGLEVILVESHTI
Ga0210398_1009727633300021477SoilMATRAAEANDAVPALSAERQVTWPNRKRARLSNGLEVILVESHTIPKFHG
Ga0210402_1133623323300021478SoilMATRPAAEIHTAVPPLTSERQVTWPKRTRARLANGLEV
Ga0210409_1077974723300021559SoilMASRAAEVAVGVPALTPERSVTWPKRSKSRLANGLEIVLV
Ga0224549_102556723300022840SoilMAVFAVEVLAHAPALTAERPVTWPKRTKTRLANGLEVVLAE
Ga0247691_106228123300024222SoilMASSAPEYSAAVPALTAERPVTWPKRARARLANGL
Ga0137417_117062723300024330Vadose Zone SoilMATRAAAEIHTAVPPLSPERQVTWPKRTRARLANGL
Ga0208321_106714313300025409PeatlandMATREAEVPTLAPALTPERPVTWPKRTRARLANGLEVVLA
Ga0208692_101904233300025472PeatlandMATREAEVPTLAPALTPERPVTWPKRTRARLANGLEVVLAEAHS
Ga0207684_1164262513300025910Corn, Switchgrass And Miscanthus RhizosphereMATSVAEARSEVPALSTERAVTWPKRTKAKLVNGLEVVLAES
Ga0207646_1074347013300025922Corn, Switchgrass And Miscanthus RhizosphereMATRAATEIATSVPPLSAERQVTWPKRTKARLANGLEVV
Ga0207669_1181061423300025937Miscanthus RhizosphereMATRAAEVPTTVPALSAERPVTWPKVTKSRLANGLE
Ga0209237_113205023300026297Grasslands SoilVMAATPAPQALAGVPALAPERRVEWPKRTRARLANG
Ga0209240_118926933300026304Grasslands SoilMATRAVEVAMGVPALAPERSVTWPKRTRARLSNGLEVILAEAHSI
Ga0209802_108734623300026328SoilMAATPAPQALAGVPALAPERRVEWPKRTRARLANGMEVIL
Ga0209158_124930723300026333SoilMATRAMEVAIGVPALAAERAVTWPKRTRARLSNGL
Ga0257172_107656923300026482SoilMATRVAEIAKGVPALSEERQVTWPKRTRARLPNGLEVVLAESHA
Ga0209157_130767613300026537SoilMATRTVEVPRGAPALAAERAVTWPKRTKARLSNGLEVILA
Ga0209156_1016317623300026547SoilMASRPVEVAVGVPALAPEREVTWPKRTKAKLANGLEVILAE
Ga0209735_103175613300027562Forest SoilMATRVVEVANGVPGLAAERAVTWPKRTKARLSNGL
Ga0209329_111188813300027605Forest SoilMATRTAPSLTGAPGLSPERPVTWPKRTKARLSNGLE
Ga0209422_101349813300027629Forest SoilMASRAPEFSAAVPALTAERPVTWPKRTRTRLANGLEIVLAES
Ga0209178_113104323300027725Agricultural SoilMATRAIETNSSAPALAPERQVTWPKRKKARLSNGLELIL
Ga0209328_1012430313300027727Forest SoilMATRTAQLPTEAPALTAERPVTWPKRTKTRLANGL
Ga0209248_1023601213300027729Bog Forest SoilMATRAVEVNDAVPALSAERQVTWPNRKRARLSNGLE
Ga0209656_1048352423300027812Bog Forest SoilMATRAVEVNDAVPALAAERQVTWPNRKRARLSNGLEV
Ga0209580_1067513323300027842Surface SoilMATRPAAEIHTAVPPLTAERQVTWPKRTRARLTNGLEVVLAE
Ga0209275_1083033423300027884SoilMATRAVEVNDAVPGLSAERQVTWPNRKRARLSNGLE
Ga0209380_1039832313300027889SoilMATRAVEVNDAVPALSAERQVRWPNRKRARLSNGLEVIL
Ga0247684_102221923300028138SoilMATRAVEVNNGVPGLSPERQVTWPKRQRARLSNGL
Ga0268265_1079195723300028380Switchgrass RhizosphereMATRAAEVPTTVPALSAERPVTWPKVTKSRLANGLEIV
Ga0137415_1091463113300028536Vadose Zone SoilMATRAAEIHTSVPPLSAERQVTWPKRTRTRLGDGLE
Ga0265338_1036621113300028800RhizosphereMATRAADVNAAVPALSPERQVTWPKRTRARLSNGLEVVLVESH
Ga0170834_10279939913300031057Forest SoilMASRAPEYSAAVPALTAERPVTWPNRARARLANGLEIVLAEAHSIP
Ga0318574_1077788623300031680SoilMATQAKEMPVAAPALAAERAVKWPKRTRAQLTNGLRVVL
Ga0310686_10894668813300031708SoilMATRAVEVNDAVPALSAERQVTWPNRKRARLSNGLEVILVESHTIPKF
Ga0307476_1108155913300031715Hardwood Forest SoilMATQTRAQSAGTTVPALGTERTVTWPKRTRTRLTNGLEVLLAE
Ga0307469_1047145213300031720Hardwood Forest SoilMATRPAAEIHTAVPPLTAERQVTWPKRTRARLANG
Ga0318493_1016273313300031723SoilMATQAKEMPVAAPALAAERAVKWPKRTRAQLTNGLR
Ga0318500_1057814523300031724SoilMATRAAEVSFGVPALTPERAVSWPKRTRAQLANGLQVVLAE
Ga0318501_1075596023300031736SoilMGSRPAEVAVGVPALAPERQVTWPKRTGTRLANGLEVILAESH
Ga0307477_1086197713300031753Hardwood Forest SoilMATKAAEVANGVPALAPERAVTWPKRTKDRLSNGLEVILVEAHSI
Ga0318523_1026150523300031798SoilMATQATEMPVAAPALAPERAVKWPKRNRARQKKGKK
Ga0307473_1103123513300031820Hardwood Forest SoilMATKAAEISNLVPALTAERPVTWPKRTRARLSNGLQVVLA
Ga0310917_1061423723300031833SoilMATQATEMPVAVPALAPERAVKWPKRTRAQLANGL
Ga0306926_1054832723300031954SoilMATQATEMPVAAPALAPERAVKWPKRTRARLANGLQ
Ga0307479_1210138313300031962Hardwood Forest SoilMMATRAAAEIQTAVPPLAPERQVTWPKVTRTRLANGLEVVL
Ga0310911_1083651623300032035SoilMATQAKEMPVAAPALAAERAVKWPKRTRAQLTNGLRVVLAE
Ga0318533_1017536213300032059SoilMATQATEMPVAAPALAPERAVEWPKRTRARLANGLQV
Ga0318540_1039341613300032094SoilMATQATEMPVAAPALAPERAVEWPKRTRARLANGL
Ga0307471_10059529213300032180Hardwood Forest SoilMATRAVEVAVGVPALAAERAVTWPKRTKARLSNGLEVILVEAHS
Ga0335080_1059606523300032828SoilMATPAIEKNSPVPALTPERQVTWPKRQRTKLANGLEVILV
Ga0335081_1070581423300032892SoilMATRAVETNSMVPALAPERQVTWPKRRRSVLANGLEVI
Ga0335077_1053175423300033158SoilMATRAPEMNAAVPALAAERAVEWPKRTRVRLNNGMQVVLA
Ga0318519_1008930523300033290SoilMATQATEMPVAVPALAPERAVKWPKRTRAQLANGLQVV
Ga0326727_1044288023300033405Peat SoilMATRAPEVAIAAPALAPERPVTWPKRTRARLSNGMEV

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.