| Basic Information | |
|---|---|
| Family ID | F062063 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 131 |
| Average Sequence Length | 42 residues |
| Representative Sequence | KIGTVHSCLKEGCDWEKLVPEAQPQTQPEEAPVPVAAKS |
| Number of Associated Samples | 113 |
| Number of Associated Scaffolds | 131 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 99.24 % |
| % of genes from short scaffolds (< 2000 bps) | 90.08 % |
| Associated GOLD sequencing projects | 102 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.19 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (97.710 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (25.954 % of family members) |
| Environment Ontology (ENVO) | Unclassified (26.718 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (54.962 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 13.43% β-sheet: 0.00% Coil/Unstructured: 86.57% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.19 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 131 Family Scaffolds |
|---|---|---|
| PF02899 | Phage_int_SAM_1 | 86.26 |
| PF11695 | DUF3291 | 1.53 |
| PF00085 | Thioredoxin | 0.76 |
| PF13365 | Trypsin_2 | 0.76 |
| COG ID | Name | Functional Category | % Frequency in 131 Family Scaffolds |
|---|---|---|---|
| COG4973 | Site-specific recombinase XerC | Replication, recombination and repair [L] | 86.26 |
| COG4974 | Site-specific recombinase XerD | Replication, recombination and repair [L] | 86.26 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 98.47 % |
| Unclassified | root | N/A | 1.53 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001593|JGI12635J15846_10366492 | All Organisms → cellular organisms → Bacteria | 879 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_100966587 | All Organisms → cellular organisms → Bacteria | 735 | Open in IMG/M |
| 3300002561|JGI25384J37096_10262007 | All Organisms → cellular organisms → Bacteria | 503 | Open in IMG/M |
| 3300002914|JGI25617J43924_10007898 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3372 | Open in IMG/M |
| 3300002914|JGI25617J43924_10227595 | All Organisms → cellular organisms → Bacteria | 625 | Open in IMG/M |
| 3300003220|JGI26342J46808_1004653 | All Organisms → cellular organisms → Bacteria | 1233 | Open in IMG/M |
| 3300003372|JGI26336J50218_1007457 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 733 | Open in IMG/M |
| 3300004082|Ga0062384_100071186 | All Organisms → cellular organisms → Bacteria | 1766 | Open in IMG/M |
| 3300004091|Ga0062387_100067558 | All Organisms → cellular organisms → Bacteria | 1794 | Open in IMG/M |
| 3300004092|Ga0062389_102594657 | All Organisms → cellular organisms → Bacteria | 674 | Open in IMG/M |
| 3300004633|Ga0066395_10059070 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1727 | Open in IMG/M |
| 3300005177|Ga0066690_10913837 | All Organisms → cellular organisms → Bacteria | 559 | Open in IMG/M |
| 3300005180|Ga0066685_10030962 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3311 | Open in IMG/M |
| 3300005181|Ga0066678_10120883 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1609 | Open in IMG/M |
| 3300005555|Ga0066692_10251236 | All Organisms → cellular organisms → Bacteria | 1116 | Open in IMG/M |
| 3300005557|Ga0066704_10261623 | All Organisms → cellular organisms → Bacteria | 1174 | Open in IMG/M |
| 3300005558|Ga0066698_10455012 | All Organisms → cellular organisms → Bacteria | 873 | Open in IMG/M |
| 3300005566|Ga0066693_10086932 | All Organisms → cellular organisms → Bacteria | 1109 | Open in IMG/M |
| 3300005569|Ga0066705_10086967 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1835 | Open in IMG/M |
| 3300005591|Ga0070761_10788184 | All Organisms → cellular organisms → Bacteria | 598 | Open in IMG/M |
| 3300005602|Ga0070762_10919621 | All Organisms → cellular organisms → Bacteria | 597 | Open in IMG/M |
| 3300005764|Ga0066903_105430956 | All Organisms → cellular organisms → Bacteria | 672 | Open in IMG/M |
| 3300006046|Ga0066652_100336707 | All Organisms → cellular organisms → Bacteria | 1353 | Open in IMG/M |
| 3300006050|Ga0075028_100698699 | All Organisms → cellular organisms → Bacteria | 610 | Open in IMG/M |
| 3300006050|Ga0075028_100917709 | All Organisms → cellular organisms → Bacteria | 540 | Open in IMG/M |
| 3300006174|Ga0075014_100772745 | All Organisms → cellular organisms → Bacteria | 565 | Open in IMG/M |
| 3300006176|Ga0070765_100527388 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1111 | Open in IMG/M |
| 3300006796|Ga0066665_10594793 | All Organisms → cellular organisms → Bacteria | 891 | Open in IMG/M |
| 3300007265|Ga0099794_10123508 | All Organisms → cellular organisms → Bacteria | 1304 | Open in IMG/M |
| 3300009088|Ga0099830_11266122 | All Organisms → cellular organisms → Bacteria | 613 | Open in IMG/M |
| 3300009089|Ga0099828_11736303 | All Organisms → cellular organisms → Bacteria | 549 | Open in IMG/M |
| 3300009090|Ga0099827_11132915 | All Organisms → cellular organisms → Bacteria | 680 | Open in IMG/M |
| 3300010326|Ga0134065_10236037 | All Organisms → cellular organisms → Bacteria | 676 | Open in IMG/M |
| 3300010880|Ga0126350_10605074 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 644 | Open in IMG/M |
| 3300011082|Ga0138526_1153779 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 555 | Open in IMG/M |
| 3300011269|Ga0137392_10020744 | All Organisms → cellular organisms → Bacteria | 4606 | Open in IMG/M |
| 3300011270|Ga0137391_11338965 | All Organisms → cellular organisms → Bacteria | 563 | Open in IMG/M |
| 3300012189|Ga0137388_10868970 | All Organisms → cellular organisms → Bacteria | 835 | Open in IMG/M |
| 3300012199|Ga0137383_10342663 | All Organisms → cellular organisms → Bacteria | 1095 | Open in IMG/M |
| 3300012200|Ga0137382_10044694 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2737 | Open in IMG/M |
| 3300012202|Ga0137363_10159457 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia | 1779 | Open in IMG/M |
| 3300012202|Ga0137363_10551526 | All Organisms → cellular organisms → Bacteria | 971 | Open in IMG/M |
| 3300012203|Ga0137399_10035827 | All Organisms → cellular organisms → Bacteria | 3474 | Open in IMG/M |
| 3300012205|Ga0137362_10432028 | All Organisms → cellular organisms → Bacteria | 1140 | Open in IMG/M |
| 3300012205|Ga0137362_10655124 | All Organisms → cellular organisms → Bacteria | 904 | Open in IMG/M |
| 3300012209|Ga0137379_11187125 | All Organisms → cellular organisms → Bacteria | 670 | Open in IMG/M |
| 3300012210|Ga0137378_10421642 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1237 | Open in IMG/M |
| 3300012349|Ga0137387_10142888 | All Organisms → cellular organisms → Bacteria | 1699 | Open in IMG/M |
| 3300012349|Ga0137387_10491115 | All Organisms → cellular organisms → Bacteria | 891 | Open in IMG/M |
| 3300012356|Ga0137371_10546624 | All Organisms → cellular organisms → Bacteria | 892 | Open in IMG/M |
| 3300012361|Ga0137360_10348758 | All Organisms → cellular organisms → Bacteria | 1239 | Open in IMG/M |
| 3300012361|Ga0137360_11015403 | All Organisms → cellular organisms → Bacteria | 716 | Open in IMG/M |
| 3300012361|Ga0137360_11498006 | All Organisms → cellular organisms → Bacteria | 579 | Open in IMG/M |
| 3300012924|Ga0137413_10377275 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1014 | Open in IMG/M |
| 3300012925|Ga0137419_10644866 | All Organisms → cellular organisms → Bacteria | 854 | Open in IMG/M |
| 3300012925|Ga0137419_11931690 | All Organisms → cellular organisms → Bacteria | 507 | Open in IMG/M |
| 3300012930|Ga0137407_10866953 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 854 | Open in IMG/M |
| 3300012930|Ga0137407_11722855 | All Organisms → cellular organisms → Bacteria | 597 | Open in IMG/M |
| 3300012960|Ga0164301_10214502 | All Organisms → cellular organisms → Bacteria | 1238 | Open in IMG/M |
| 3300012977|Ga0134087_10211656 | All Organisms → cellular organisms → Bacteria | 873 | Open in IMG/M |
| 3300014150|Ga0134081_10037479 | All Organisms → cellular organisms → Bacteria | 1421 | Open in IMG/M |
| 3300014150|Ga0134081_10283412 | All Organisms → cellular organisms → Bacteria | 589 | Open in IMG/M |
| 3300015053|Ga0137405_1094554 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2608 | Open in IMG/M |
| 3300015053|Ga0137405_1094557 | All Organisms → cellular organisms → Bacteria | 818 | Open in IMG/M |
| 3300015054|Ga0137420_1263719 | All Organisms → cellular organisms → Bacteria | 1627 | Open in IMG/M |
| 3300015356|Ga0134073_10050383 | All Organisms → cellular organisms → Bacteria | 1115 | Open in IMG/M |
| 3300015356|Ga0134073_10195641 | All Organisms → cellular organisms → Bacteria | 668 | Open in IMG/M |
| 3300015357|Ga0134072_10187640 | All Organisms → cellular organisms → Bacteria | 707 | Open in IMG/M |
| 3300016357|Ga0182032_11541878 | All Organisms → cellular organisms → Bacteria | 577 | Open in IMG/M |
| 3300017659|Ga0134083_10159901 | All Organisms → cellular organisms → Bacteria | 915 | Open in IMG/M |
| 3300017823|Ga0187818_10073869 | All Organisms → cellular organisms → Bacteria | 1468 | Open in IMG/M |
| 3300017930|Ga0187825_10348888 | All Organisms → cellular organisms → Bacteria | 560 | Open in IMG/M |
| 3300018060|Ga0187765_10152870 | All Organisms → cellular organisms → Bacteria | 1303 | Open in IMG/M |
| 3300020034|Ga0193753_10050403 | All Organisms → cellular organisms → Bacteria | 2233 | Open in IMG/M |
| 3300020060|Ga0193717_1158444 | All Organisms → cellular organisms → Bacteria | 657 | Open in IMG/M |
| 3300020580|Ga0210403_10157948 | All Organisms → cellular organisms → Bacteria | 1855 | Open in IMG/M |
| 3300020580|Ga0210403_10908669 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 694 | Open in IMG/M |
| 3300020581|Ga0210399_10183441 | All Organisms → cellular organisms → Bacteria | 1738 | Open in IMG/M |
| 3300021086|Ga0179596_10721446 | All Organisms → cellular organisms → Bacteria | 504 | Open in IMG/M |
| 3300021088|Ga0210404_10550472 | All Organisms → cellular organisms → Bacteria | 654 | Open in IMG/M |
| 3300021181|Ga0210388_10247047 | All Organisms → cellular organisms → Bacteria | 1566 | Open in IMG/M |
| 3300021405|Ga0210387_10693030 | All Organisms → cellular organisms → Bacteria | 903 | Open in IMG/M |
| 3300021474|Ga0210390_10400457 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon 13_1_20CM_2_54_9 | 1160 | Open in IMG/M |
| 3300021477|Ga0210398_10547644 | All Organisms → cellular organisms → Bacteria | 941 | Open in IMG/M |
| 3300021479|Ga0210410_11235013 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 639 | Open in IMG/M |
| 3300021559|Ga0210409_10382298 | All Organisms → cellular organisms → Bacteria | 1262 | Open in IMG/M |
| 3300021559|Ga0210409_10573407 | All Organisms → cellular organisms → Bacteria | 995 | Open in IMG/M |
| 3300021559|Ga0210409_10739792 | All Organisms → cellular organisms → Bacteria | 855 | Open in IMG/M |
| 3300021559|Ga0210409_10859664 | All Organisms → cellular organisms → Bacteria | 780 | Open in IMG/M |
| 3300021559|Ga0210409_11222979 | All Organisms → cellular organisms → Bacteria | 627 | Open in IMG/M |
| 3300021560|Ga0126371_12934696 | All Organisms → cellular organisms → Bacteria | 578 | Open in IMG/M |
| 3300024179|Ga0247695_1035860 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 710 | Open in IMG/M |
| 3300025898|Ga0207692_10990334 | All Organisms → cellular organisms → Bacteria | 555 | Open in IMG/M |
| 3300025906|Ga0207699_11361799 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 525 | Open in IMG/M |
| 3300026281|Ga0209863_10092420 | All Organisms → cellular organisms → Bacteria | 891 | Open in IMG/M |
| 3300026305|Ga0209688_1025557 | All Organisms → cellular organisms → Bacteria | 1144 | Open in IMG/M |
| 3300026313|Ga0209761_1342926 | All Organisms → cellular organisms → Bacteria | 507 | Open in IMG/M |
| 3300026324|Ga0209470_1349341 | All Organisms → cellular organisms → Bacteria | 531 | Open in IMG/M |
| 3300026335|Ga0209804_1308295 | All Organisms → cellular organisms → Bacteria | 537 | Open in IMG/M |
| 3300026532|Ga0209160_1342504 | All Organisms → cellular organisms → Bacteria | 512 | Open in IMG/M |
| 3300026538|Ga0209056_10379526 | All Organisms → cellular organisms → Bacteria | 896 | Open in IMG/M |
| 3300026557|Ga0179587_10390302 | All Organisms → cellular organisms → Bacteria | 906 | Open in IMG/M |
| 3300027174|Ga0207948_1024778 | All Organisms → cellular organisms → Bacteria | 713 | Open in IMG/M |
| 3300027559|Ga0209222_1122758 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 502 | Open in IMG/M |
| 3300027671|Ga0209588_1008935 | All Organisms → cellular organisms → Bacteria | 2982 | Open in IMG/M |
| 3300027737|Ga0209038_10028808 | All Organisms → cellular organisms → Bacteria | 1646 | Open in IMG/M |
| 3300027748|Ga0209689_1202301 | All Organisms → cellular organisms → Bacteria | 868 | Open in IMG/M |
| 3300027853|Ga0209274_10605943 | All Organisms → cellular organisms → Bacteria | 567 | Open in IMG/M |
| 3300027862|Ga0209701_10459082 | All Organisms → cellular organisms → Bacteria | 699 | Open in IMG/M |
| 3300027898|Ga0209067_10032904 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2646 | Open in IMG/M |
| 3300027908|Ga0209006_10390534 | All Organisms → cellular organisms → Bacteria | 1174 | Open in IMG/M |
| 3300028047|Ga0209526_10494715 | All Organisms → cellular organisms → Bacteria | 798 | Open in IMG/M |
| 3300028047|Ga0209526_10747872 | All Organisms → cellular organisms → Bacteria | 611 | Open in IMG/M |
| 3300029636|Ga0222749_10780875 | Not Available | 523 | Open in IMG/M |
| 3300030580|Ga0311355_10183112 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2213 | Open in IMG/M |
| 3300030693|Ga0302313_10388212 | All Organisms → cellular organisms → Bacteria | 555 | Open in IMG/M |
| 3300030991|Ga0073994_12134897 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 514 | Open in IMG/M |
| 3300031546|Ga0318538_10397394 | All Organisms → cellular organisms → Bacteria | 746 | Open in IMG/M |
| 3300031718|Ga0307474_10556403 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 902 | Open in IMG/M |
| 3300031753|Ga0307477_10475919 | All Organisms → cellular organisms → Bacteria | 850 | Open in IMG/M |
| 3300031754|Ga0307475_11015438 | All Organisms → cellular organisms → Bacteria | 651 | Open in IMG/M |
| 3300031763|Ga0318537_10021963 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2226 | Open in IMG/M |
| 3300031768|Ga0318509_10395215 | All Organisms → cellular organisms → Bacteria | 773 | Open in IMG/M |
| 3300031780|Ga0318508_1022640 | All Organisms → cellular organisms → Bacteria | 1540 | Open in IMG/M |
| 3300031795|Ga0318557_10059095 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1632 | Open in IMG/M |
| 3300031946|Ga0310910_10058632 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2739 | Open in IMG/M |
| 3300031962|Ga0307479_10531281 | All Organisms → cellular organisms → Bacteria | 1159 | Open in IMG/M |
| 3300032180|Ga0307471_101474337 | All Organisms → cellular organisms → Bacteria | 839 | Open in IMG/M |
| 3300032205|Ga0307472_102458615 | All Organisms → cellular organisms → Bacteria | 529 | Open in IMG/M |
| 3300032895|Ga0335074_10573971 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1137 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 25.95% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 17.56% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 12.21% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 6.11% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 5.34% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 4.58% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 4.58% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 3.05% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 3.05% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 3.05% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.29% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 1.53% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.53% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.53% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 1.53% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.76% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.76% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 0.76% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.76% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.76% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.76% |
| Prmafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil | 0.76% |
| Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 0.76% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300002561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_40cm | Environmental | Open in IMG/M |
| 3300002914 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm | Environmental | Open in IMG/M |
| 3300003220 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM1 | Environmental | Open in IMG/M |
| 3300003372 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM1 | Environmental | Open in IMG/M |
| 3300004082 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3 | Environmental | Open in IMG/M |
| 3300004091 | Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004633 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio | Environmental | Open in IMG/M |
| 3300005177 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 | Environmental | Open in IMG/M |
| 3300005180 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 | Environmental | Open in IMG/M |
| 3300005181 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 | Environmental | Open in IMG/M |
| 3300005541 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 | Environmental | Open in IMG/M |
| 3300005555 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 | Environmental | Open in IMG/M |
| 3300005557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 | Environmental | Open in IMG/M |
| 3300005558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 | Environmental | Open in IMG/M |
| 3300005566 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_142 | Environmental | Open in IMG/M |
| 3300005569 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 | Environmental | Open in IMG/M |
| 3300005591 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 | Environmental | Open in IMG/M |
| 3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
| 3300006050 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014 | Environmental | Open in IMG/M |
| 3300006174 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014 | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300010326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010880 | Boreal forest soil eukaryotic communities from Alaska, USA - C5-1 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300011082 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 4 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
| 3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
| 3300012977 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300014150 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300015053 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015054 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015356 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300015357 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_0_1 metaG | Environmental | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300017659 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300017823 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_3 | Environmental | Open in IMG/M |
| 3300017930 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_5 | Environmental | Open in IMG/M |
| 3300018060 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MG | Environmental | Open in IMG/M |
| 3300020034 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1c2 | Environmental | Open in IMG/M |
| 3300020060 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2c2 | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300021086 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
| 3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
| 3300021477 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300024179 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK36 | Environmental | Open in IMG/M |
| 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026281 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-046 (SPAdes) | Environmental | Open in IMG/M |
| 3300026305 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_142 (SPAdes) | Environmental | Open in IMG/M |
| 3300026313 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026324 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 (SPAdes) | Environmental | Open in IMG/M |
| 3300026335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 (SPAdes) | Environmental | Open in IMG/M |
| 3300026532 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 (SPAdes) | Environmental | Open in IMG/M |
| 3300026538 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes) | Environmental | Open in IMG/M |
| 3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300027174 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF040 (SPAdes) | Environmental | Open in IMG/M |
| 3300027559 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_O3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027737 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027748 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 (SPAdes) | Environmental | Open in IMG/M |
| 3300027853 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027862 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027898 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 (SPAdes) | Environmental | Open in IMG/M |
| 3300027908 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300029636 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030580 | II_Palsa_N1 coassembly | Environmental | Open in IMG/M |
| 3300030693 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N2_2 | Environmental | Open in IMG/M |
| 3300030991 | Metatranscriptome of forest soil microbial communities from Montana, USA - Site 5 -Soil GP-1A (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031546 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23 | Environmental | Open in IMG/M |
| 3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
| 3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031763 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f29 | Environmental | Open in IMG/M |
| 3300031768 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22 | Environmental | Open in IMG/M |
| 3300031780 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f21 | Environmental | Open in IMG/M |
| 3300031795 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f19 | Environmental | Open in IMG/M |
| 3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032895 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.3 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI12635J15846_103664921 | 3300001593 | Forest Soil | IVEKRTKIGTVHACLKEGCDWEKLVPEAQPQAQPEEAPVPVAAKF* |
| JGIcombinedJ26739_1009665871 | 3300002245 | Forest Soil | TKIGTVHACIKEGCDWEKLVPETPPQAPSEEVPVPVTAKS* |
| JGI25384J37096_102620072 | 3300002561 | Grasslands Soil | FIVEKRSKIGTVHACLKEGCDWEKLVPEAQPQVQPEEAPVPVAVKS* |
| JGI25617J43924_100078983 | 3300002914 | Grasslands Soil | FIVEKKTKIGAVRACLKEGCDWEQLVPEAQPQTQLEEAPVPVAAKS* |
| JGI25617J43924_102275952 | 3300002914 | Grasslands Soil | KIGNVRACLKDGCDWEQLVPEAPPQVQPEEAAVPVAVKS* |
| JGI26342J46808_10046533 | 3300003220 | Bog Forest Soil | TKIGVVHSCLKEGCDWEKLAPEPQTAQPQVQSEEPTPVGAKP* |
| JGI26336J50218_10074572 | 3300003372 | Bog Forest Soil | IVEKKTKIGVVHSCLKEGCDWEKLAPEPQTAQPQVQSEEPTPVGAKP* |
| Ga0062384_1000711861 | 3300004082 | Bog Forest Soil | EKKSKIGTVHTCLKEGCDWEKLAPEPAPPPQFQPEEATPVGAKP* |
| Ga0062387_1000675583 | 3300004091 | Bog Forest Soil | EKKTKIGLVHTCLKEGCDWEKLAPEPVAPSQVQPEEATPVGAKP* |
| Ga0062389_1025946571 | 3300004092 | Bog Forest Soil | KKSKIGTVYTCLKEGCDWEKLAPEPVVAAPSPQEEPVPAGAKP* |
| Ga0066395_100590703 | 3300004633 | Tropical Forest Soil | VEKNSKIGKVHACLKEGCDWEKLVPEAPPPQQEEAPVPVAAKS* |
| Ga0066690_109138372 | 3300005177 | Soil | KNSKIGKVHACLKEGCDWEKLVPEVSSATQPEEAPVPVAAKS* |
| Ga0066685_100309625 | 3300005180 | Soil | IVEKRTKIGTVHSCIKEGCDWEKLVPEAQPQAQPEEAPVPVAAKS* |
| Ga0066678_101208833 | 3300005181 | Soil | FIVEKRAKIGTVHSCLKEGCDWEKLVPEAPPQAQPEEAPVPVAAKS* |
| Ga0070733_100901983 | 3300005541 | Surface Soil | HTCIKEGCDWEQLAPEPQPVAAPAPVEEPTPVGAKP* |
| Ga0066692_102512362 | 3300005555 | Soil | FIVEKRSKIGTVHACLKEGCDWEKLVPEAQPQAQPEEAPVPVAVKS* |
| Ga0066704_102616231 | 3300005557 | Soil | APFIVEKRTKTGTVRSCIKDGCDWEIPVSETPPQTQPEEVPVPVAAKP* |
| Ga0066698_104550122 | 3300005558 | Soil | FIVEKRSKIGTVHACLKEGCDWEKLVPEAPPAAQPEEAPVPVAAKS* |
| Ga0066693_100869322 | 3300005566 | Soil | NSKIGKVHACLKEGCDWEKLVPEVSPATQPEEAPVPVAAKS* |
| Ga0066705_100869671 | 3300005569 | Soil | KRTKTGSVRACLKEGCDWETPILEAQPQVQTEEAPVPVAAKS* |
| Ga0070761_107881842 | 3300005591 | Soil | FIVEKKSKIGTVHTCLKEGCDWEQLAPEPQPVAAPAPVEEPTPVGAKP* |
| Ga0070762_109196212 | 3300005602 | Soil | TKIGLVHTCLKEGCDWEKLAPEPIAAPAQPQPEEATPVGAKP* |
| Ga0066903_1054309561 | 3300005764 | Tropical Forest Soil | KNSKIGKVHACLKEGCDWEKLVPEAPPAAQPEEAPVPVAVKS* |
| Ga0066652_1003367073 | 3300006046 | Soil | RSKIGTVHACLKEGCDWEKLVPEAPPAAQPEEAPVPVAAKS* |
| Ga0075028_1006986992 | 3300006050 | Watersheds | PFIVEKKSKIGVVHSCVKEGCDWEKLAPEPASAPQQTQPAPTEEPTPVGAKP* |
| Ga0075028_1009177092 | 3300006050 | Watersheds | RAKIGTVHACLKEGCDWEKLVPEAQTPSEEVPVPVTAKS* |
| Ga0075014_1007727451 | 3300006174 | Watersheds | EKRTKTGNVRACLKENCDWEAAIPEAEPPAQPEEAAVPVAVKS* |
| Ga0070765_1005273883 | 3300006176 | Soil | KIGTVHACLKEGCDWEQLAPEPAPPQVQPEEAAPVGAKP* |
| Ga0066665_105947932 | 3300006796 | Soil | EKRTKTGSVRACLKEGCDWETPILEAQPQVQTEEAPVPVAAKS* |
| Ga0099794_101235081 | 3300007265 | Vadose Zone Soil | FIVEKRTKIGTVHSCLKEGCDWEKLVPEAQPQAQPEEAPVPVAAKS* |
| Ga0099830_112661221 | 3300009088 | Vadose Zone Soil | IGAVRACLKEGCDWEQLVPEAPPQTQLEEAPVPVAAKS* |
| Ga0099828_117363032 | 3300009089 | Vadose Zone Soil | KKSKIGTVHACLKEGCDWEKLVDEPAPHAQPEEVVAPVGAKP* |
| Ga0099827_111329151 | 3300009090 | Vadose Zone Soil | FIVEKRTKTGIVRACLKEGCDWEILVPEAHPQAQPEEAPVPVAAKS* |
| Ga0134065_102360371 | 3300010326 | Grasslands Soil | RSKIGTVHACLKEGCDWEKLVPEAQPQAQPEEAPVPVAVKS* |
| Ga0126350_106050741 | 3300010880 | Boreal Forest Soil | GVVHTCLTEGCDWEKLAPEPAATPQVQPEEPTPVGAKP* |
| Ga0138526_11537791 | 3300011082 | Peatlands Soil | IVEKKSKIGVVHTCLKEGCDWEKLAPEPAAAPQVQPEEPTPVGAKP* |
| Ga0137392_100207441 | 3300011269 | Vadose Zone Soil | IVEKRTKIGTVHACLKDGCDWEKLVPEAQPQAQTEEAVAPVGAKS* |
| Ga0137391_113389651 | 3300011270 | Vadose Zone Soil | EKRSKIGMVHACLKEGCDWEKLVPEIQPQAQPEETVAPVGAKS* |
| Ga0137388_108689702 | 3300012189 | Vadose Zone Soil | TKTGTVRACINEGCVWEMLVPGAQPPAQPEEAPVPVAAKF* |
| Ga0137383_103426631 | 3300012199 | Vadose Zone Soil | RTKIGAVHACLKEGCDWEQLVPEAQPQAQPEEAPVPVAAKS* |
| Ga0137382_100446945 | 3300012200 | Vadose Zone Soil | TKIGAVRACLKEGCDWEQLVPEAQPQAQPEEAPVPVAAKS* |
| Ga0137363_101594571 | 3300012202 | Vadose Zone Soil | PFIVEKRTKIGTVHACLKEGCDWEKLVPEAPPQTPSEEVPVPVAVKS* |
| Ga0137363_105515262 | 3300012202 | Vadose Zone Soil | VRACLKEGCDWEQLVPEAPPQTQLEEAPVPVVAKS* |
| Ga0137399_100358274 | 3300012203 | Vadose Zone Soil | IGTVHSCLKEGCDWEKLVPEAQPQAQPEESPVPVAAKS* |
| Ga0137362_104320282 | 3300012205 | Vadose Zone Soil | VHSCLKEGCDWEKLVPEAQPQAQPEEAPVPVAAKS* |
| Ga0137362_106551242 | 3300012205 | Vadose Zone Soil | VRACLKEGCDWEKLVPEVPPQAQPEEAPVPVAAKS* |
| Ga0137379_111871252 | 3300012209 | Vadose Zone Soil | IVEKRTKIGTVHSCLKEGCDWEKLVPEVQPQAQPEEAPVPVAAKS* |
| Ga0137378_104216421 | 3300012210 | Vadose Zone Soil | PFIVEKRSKIGTVHSCLKEGCDWEKLVPEAQPQAQPEETVAPVGAKP* |
| Ga0137387_101428881 | 3300012349 | Vadose Zone Soil | KCGAPFIVEKRSKIGTVHSCLKEGGDGEKLVPEAQPQAQPEETVAPVGAKP* |
| Ga0137387_104911151 | 3300012349 | Vadose Zone Soil | SKIGTVHTCLKEGCDWEKLAPEVPQPTQPEEAPVPVAVKS* |
| Ga0137371_105466241 | 3300012356 | Vadose Zone Soil | KKTKIGAVRACLKEGCDWEQLVPEAQPQTQLEEAPVPVAAKS* |
| Ga0137360_103487581 | 3300012361 | Vadose Zone Soil | TKIGAVRACLKEGCDWEQLVPEAQPQTQLEEAPVPVVAKS* |
| Ga0137360_110154031 | 3300012361 | Vadose Zone Soil | TVHSCLKEGCDWEKLVPEAQPQAQPEEAPVPVAAKS* |
| Ga0137360_114980061 | 3300012361 | Vadose Zone Soil | KIGTVHSCLKEGCDWEKLVPEAQPQTQPEEAPVPVAAKS* |
| Ga0137413_103772752 | 3300012924 | Vadose Zone Soil | IVEKKSKIGLVRTCIKEGCDWEKLAPEAPVTQPEEATPVGAKP* |
| Ga0137419_106448661 | 3300012925 | Vadose Zone Soil | TKIGTVHACLKEGCDWEQLVPEAQPQAQPEEAPVPVAAKP* |
| Ga0137419_119316901 | 3300012925 | Vadose Zone Soil | HSCLKEGCDWEKLVPEAQPQAQPEEAPVPVAAKS* |
| Ga0137407_108669531 | 3300012930 | Vadose Zone Soil | KSKIGLVRTCIKEGCDWEKLAPEAPVTQPEEATPVGAKP* |
| Ga0137407_117228552 | 3300012930 | Vadose Zone Soil | VHACLKEGCDWEKLVLEAPPQAPSEEVPVPVAAKS* |
| Ga0164301_102145021 | 3300012960 | Soil | KKSKIGLVRTCIKEGCDWEKLAPEAPVTQPEEATPVGAKP* |
| Ga0134087_102116562 | 3300012977 | Grasslands Soil | GTVRACLKEGCDWELLVPEGPPQAQPEEAPVPVAAKS* |
| Ga0134081_100374792 | 3300014150 | Grasslands Soil | IVEKRSKIGTVHACLKEGCDWEKLVPEAQPQVQPEEAPVPVAVKS* |
| Ga0134081_102834121 | 3300014150 | Grasslands Soil | TLHSCIKEGCDWEQLAPEPVPAAPQAQPEEAATPVGAKP* |
| Ga0137405_10945541 | 3300015053 | Vadose Zone Soil | EKRSKIGTVHSCLKEGSCLKEGCDWEKLVPEAQPQAQPEEAQVPVAAKS* |
| Ga0137405_10945571 | 3300015053 | Vadose Zone Soil | EKRSKIGTVHSCLKEGCDWEKLVPEAQPQAQPEEAQVPVAAKS* |
| Ga0137420_12637191 | 3300015054 | Vadose Zone Soil | RLPQRACLKEGCDWEMLVPEAQPQAQPEEAPVPVAAKS* |
| Ga0134073_100503832 | 3300015356 | Grasslands Soil | VEKRSKIGTVHACLKEGCDWEKLVPEAPPAAQPEEAPVPVAAKS* |
| Ga0134073_101956412 | 3300015356 | Grasslands Soil | HACLKEGCDWEKLVPEVSPATQPEEAPVPVAAKS* |
| Ga0134072_101876401 | 3300015357 | Grasslands Soil | KTGSVRACLKEGCDWETPVLEAQPQVQAEEAPVPVAAKS* |
| Ga0182032_115418782 | 3300016357 | Soil | FVVEKKSKIGMVRACIKDGCDWEKLAPEAPVVQQEEPTPVGAKS |
| Ga0134083_101599011 | 3300017659 | Grasslands Soil | RIKTGSVRACLKEGCDWETPVLEAQPQVQTEEAPVPVAAKS |
| Ga0187818_100738691 | 3300017823 | Freshwater Sediment | IGTVRACLKEGCDWEQLIPDAQPVAQPEEAAESVAAKS |
| Ga0187825_103488881 | 3300017930 | Freshwater Sediment | KRTKTGNVRACLKEGCDWEQEILEAQPQALPEEAPVPVAVKS |
| Ga0187765_101528701 | 3300018060 | Tropical Peatland | KIGTLHACIKEGCDWEKLADVPPAPASQPEEAAPVGAKP |
| Ga0193753_100504031 | 3300020034 | Soil | TVWTCIKDGCDWEKLAPENLPPPSQPEELAPVGAKV |
| Ga0193717_11584441 | 3300020060 | Soil | FIVEKKSKIGTVWTCIKDGCDWEKLAPENLPPPSQPEELAPVGAKV |
| Ga0210403_101579483 | 3300020580 | Soil | TKIGTVHSCLKEGCDWEKLIPDAPPQTQPEEDPVPVAAKS |
| Ga0210403_109086692 | 3300020580 | Soil | TKIGLVHTCLKEGCDWEKLAPEPAAVAPPQAQPEEATPVGAKL |
| Ga0210399_101834411 | 3300020581 | Soil | FIVEKKSKIGTVHTCIKEGCDWEQLAPEAQPAVQPEEATPVGAKP |
| Ga0179596_107214462 | 3300021086 | Vadose Zone Soil | GTVRSCLKEGCDWEMLVPETPPQTQPEEVPVPVAVKS |
| Ga0210404_105504722 | 3300021088 | Soil | KKTKIGTVHTCLKEGCDWEKLAPEPQTQPQPQVQPEEAAPVGAKL |
| Ga0210388_102470473 | 3300021181 | Soil | KIGTVHACLKEGCDWEQLVPEILPQTQPEEVPVPVASKF |
| Ga0210387_106930301 | 3300021405 | Soil | AAPFIVEKKSKIGVVHTCIKEGCDWEQLAPEPQPAAVPAPVHVEEPTPVGAKP |
| Ga0210390_104004572 | 3300021474 | Soil | FVVEKKTKIGTVHACLKEACDWEQLAPEPAVAPQAQPEEATPVGAKL |
| Ga0210398_105476441 | 3300021477 | Soil | CLKEGCDWEKLAPEPQTQPQPQVQPEEAAPVGAKL |
| Ga0210410_112350131 | 3300021479 | Soil | TVRACLKEGCDWEQLAPEPAPQVQPEEAAPVGAKP |
| Ga0210409_103822982 | 3300021559 | Soil | KTGNVRACLKEGCDWEQEILEPQAQAQPQPQVQPEEAPVPVAVKS |
| Ga0210409_105734072 | 3300021559 | Soil | EKRTKIGTVHSCLKEGCDWEKLVPEAQPQAQPEEAPVPVAAKS |
| Ga0210409_107397921 | 3300021559 | Soil | EKRTKIGTVHSCLKEGCDWEKLVPEAQPQAQPEEAPVPVAAKF |
| Ga0210409_108596641 | 3300021559 | Soil | VEKKSKIGTVHTCIKEGCDWEQLAPETQPAPQPEEATPVGAKP |
| Ga0210409_112229791 | 3300021559 | Soil | IGTVHACIKENCDWEKLIPEALPQTQPEEVPVPVAAKS |
| Ga0126371_129346962 | 3300021560 | Tropical Forest Soil | VHACLKEGCDWEKLVPEAPPAAQPEEAPVPVAVKS |
| Ga0247695_10358601 | 3300024179 | Soil | KKSKIGLVRTCIKEGCDWEKLAPEAPVTQPEEATPVGAKP |
| Ga0207692_109903342 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | FIVEKKSKIGVVHTCLKEGCDWEQLAPEPQAPSVPAPVEEPTPVGAKP |
| Ga0207699_113617991 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | KSKIGLVRTCIKEGCDWEKLAPEAPVTQPEEATPVGAKP |
| Ga0209863_100924202 | 3300026281 | Prmafrost Soil | FIVEKKSKIGVVHTCVKDGCDWEKLAPEPQTQTQVPVPVQPEEPTPVGAKP |
| Ga0209688_10255572 | 3300026305 | Soil | IVEKNSKIGKVHACLKEGCDWEKLVPEVSPATQPEEAPVPVAAKS |
| Ga0209761_13429261 | 3300026313 | Grasslands Soil | FIVEKRSKIGTVHACLKEGCDWEKLVPEAQPQVQPEEAPVPVAVKS |
| Ga0209470_13493412 | 3300026324 | Soil | IGTVHSCLKEGCDWEKLVPDAQPQAQPEEAPIPVAAKS |
| Ga0209804_13082951 | 3300026335 | Soil | KNSKIGKVHACLKEGCDWEKLVPEVSSATQPEEAPVPVAAKS |
| Ga0209160_13425042 | 3300026532 | Soil | KIGTVHACLKEGCDWEKLVPEAQPQAQPEEAPVPVAVKS |
| Ga0209056_103795262 | 3300026538 | Soil | IVEKRTKTGSVRACLKEGCDWETPILEAQPQVQTEEAPVPVAVKS |
| Ga0179587_103903022 | 3300026557 | Vadose Zone Soil | EKRTKIGTVHSCLKEGRDWEKLVPEAQPQAQPEEAPVPVAAKS |
| Ga0207948_10247782 | 3300027174 | Forest Soil | FIVEKRTKIGTVHACLKEGCDWEQLVPEILPQTQPEEVPVPVASKS |
| Ga0209222_11227581 | 3300027559 | Forest Soil | CPKCGALFIVEKKSKIGIVHTCLKEGCDWEQLAPEPQPATVPVPVEEPTPVGAKP |
| Ga0209588_10089351 | 3300027671 | Vadose Zone Soil | IVEKRTKIGTVHACLKEGCDWEKLVPEAQPQAQPEEAVAPVGAKP |
| Ga0209038_100288083 | 3300027737 | Bog Forest Soil | SKIGTVYTCLKEGCDWEKLAPEPAVAPAPQQEEPVPVGAKS |
| Ga0209689_12023011 | 3300027748 | Soil | VEKRTKTGSVRACLKEGCDWETPVLEAQPQVQTEEAPVPVAAKS |
| Ga0209274_106059431 | 3300027853 | Soil | FIVEKKSKIGTVHTCLKEGCDWEQLAPEPQPVAAPAPVEEPTPVGAKP |
| Ga0209701_104590822 | 3300027862 | Vadose Zone Soil | KSKIGNVRACLKDGCDWEQLVPEAPPQVQPEEAAVPVAVKS |
| Ga0209067_100329041 | 3300027898 | Watersheds | LHACLKEGCDWEIEPPKPQPQALPEEAPVPVALKS |
| Ga0209006_103905342 | 3300027908 | Forest Soil | IVEKKSKIGTVYTCLKEGCDWEKLAPEPTPAASPSAAPQEEPVPAGAKL |
| Ga0209526_104947152 | 3300028047 | Forest Soil | KIGTVRACLKDGCDWEVLASEGQPPLLAEEAAVPVAAKF |
| Ga0209526_107478721 | 3300028047 | Forest Soil | KIGIVHTCIKEGCDWEQLAPEAQPAAQPEEATPVGAKP |
| Ga0222749_107808751 | 3300029636 | Soil | SKIGTVHTCIKDGCDWEQLAPEAQAPTAAQPEEATPVGAKP |
| Ga0311355_101831121 | 3300030580 | Palsa | FIVEKKSKIGTVHSCVKEGCDWEKLAPEPQTPVPVSVPAEEPTPVGAKP |
| Ga0302313_103882121 | 3300030693 | Palsa | FIVEKKSKIGTVHTCLTEGCDWEKLAPEPAAPPAAPQEEPVPAGVKS |
| Ga0073994_121348971 | 3300030991 | Soil | APFIVEKRTKIGTVHSCLKEGCDWEKLVPEAQPLAQPEETVAPVGAKP |
| Ga0318538_103973942 | 3300031546 | Soil | SKIGTVHACLKEGCDWEKLVPEAAPSAQPEEAQVPVAAKS |
| Ga0307474_105564032 | 3300031718 | Hardwood Forest Soil | VEKKTKIGTVRACLKEGCDWEQLAPEPAPQVQPEEAAPVGAKP |
| Ga0307477_104759192 | 3300031753 | Hardwood Forest Soil | RTKTGNVRACLKEGCDWEAVLPEAQPQAQAEEAPVPVAAKS |
| Ga0307475_110154382 | 3300031754 | Hardwood Forest Soil | IGTVHSCLKEGCDWEKLVPEAQPQAQPEEAPVPVAAKS |
| Ga0318537_100219633 | 3300031763 | Soil | IGTVHACLKEGCDWEKLVPEAAPSAQPEEAQVPVAAKS |
| Ga0318509_103952152 | 3300031768 | Soil | VHACLKEGCDWEKLVPEAAPSAQPEEAQVPVAAKVLSPLV |
| Ga0318508_10226401 | 3300031780 | Soil | EKRSKIGTVHACLKEGCDWEKLVPEAAPSAQPEEAQVPVAAKS |
| Ga0318557_100590951 | 3300031795 | Soil | VHACLKEGCDWEKLVPEAAPSAQPEEAQVPVAAKS |
| Ga0310910_100586321 | 3300031946 | Soil | TVHACLKEGCDWEKLVPEAAPSAQPEEAQVPVAAKS |
| Ga0307479_105312811 | 3300031962 | Hardwood Forest Soil | VHSCLKEGCDWEKLVPEAQPQAQPEEAQVPVAAKS |
| Ga0307471_1014743371 | 3300032180 | Hardwood Forest Soil | IGTVHACLKEGCDWEKLVPETPPQAPSEEVPVPVAAKS |
| Ga0307472_1024586151 | 3300032205 | Hardwood Forest Soil | TGNVRACLKEGCDWEQEILEAQPQAQPEEAPVPVAVKS |
| Ga0335074_105739711 | 3300032895 | Soil | VHACLREGCDWEKLAPEPESQPQVQPEEATPVGAKP |
| ⦗Top⦘ |