Basic Information | |
---|---|
Family ID | F061963 |
Family Type | Metagenome |
Number of Sequences | 131 |
Average Sequence Length | 48 residues |
Representative Sequence | MPMRQLIVIGTVLLAAACGGPQAPPARPAAEPSAAVQLGGPPTGAGTSTA |
Number of Associated Samples | 104 |
Number of Associated Scaffolds | 131 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | No |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 98.47 % |
% of genes near scaffold ends (potentially truncated) | 100.00 % |
% of genes from short scaffolds (< 2000 bps) | 96.95 % |
Associated GOLD sequencing projects | 97 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.31 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (58.779 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil (12.214 % of family members) |
Environment Ontology (ENVO) | Unclassified (35.115 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (61.832 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Fibrous | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 20.51% β-sheet: 0.00% Coil/Unstructured: 79.49% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.31 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 131 Family Scaffolds |
---|---|---|
PF01464 | SLT | 6.87 |
PF00741 | Gas_vesicle | 1.53 |
PF08281 | Sigma70_r4_2 | 1.53 |
PF06537 | DHOR | 1.53 |
PF00884 | Sulfatase | 1.53 |
PF12833 | HTH_18 | 0.76 |
PF13557 | Phenol_MetA_deg | 0.76 |
PF07508 | Recombinase | 0.76 |
PF01988 | VIT1 | 0.76 |
PF01139 | RtcB | 0.76 |
PF09865 | DUF2092 | 0.76 |
PF13502 | AsmA_2 | 0.76 |
PF00593 | TonB_dep_Rec | 0.76 |
PF13460 | NAD_binding_10 | 0.76 |
PF00313 | CSD | 0.76 |
PF00625 | Guanylate_kin | 0.76 |
PF00011 | HSP20 | 0.76 |
PF13376 | OmdA | 0.76 |
PF00232 | Glyco_hydro_1 | 0.76 |
PF13426 | PAS_9 | 0.76 |
PF04993 | TfoX_N | 0.76 |
PF01152 | Bac_globin | 0.76 |
PF12228 | DUF3604 | 0.76 |
COG ID | Name | Functional Category | % Frequency in 131 Family Scaffolds |
---|---|---|---|
COG3488 | Uncharacterized conserved protein with two CxxC motifs, DUF1111 family | General function prediction only [R] | 1.53 |
COG0071 | Small heat shock protein IbpA, HSP20 family | Posttranslational modification, protein turnover, chaperones [O] | 0.76 |
COG0194 | Guanylate kinase | Nucleotide transport and metabolism [F] | 0.76 |
COG1633 | Rubrerythrin, includes spore coat protein YhjR | Inorganic ion transport and metabolism [P] | 0.76 |
COG1690 | RNA-splicing ligase RtcB, repairs tRNA damage | Translation, ribosomal structure and biogenesis [J] | 0.76 |
COG1814 | Predicted Fe2+/Mn2+ transporter, VIT1/CCC1 family | Inorganic ion transport and metabolism [P] | 0.76 |
COG1961 | Site-specific DNA recombinase SpoIVCA/DNA invertase PinE | Replication, recombination and repair [L] | 0.76 |
COG2346 | Truncated hemoglobin YjbI | Inorganic ion transport and metabolism [P] | 0.76 |
COG2723 | Beta-glucosidase/6-phospho-beta-glucosidase/beta-galactosidase | Carbohydrate transport and metabolism [G] | 0.76 |
COG3070 | Transcriptional regulator of competence genes, TfoX/Sxy family | Transcription [K] | 0.76 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 58.78 % |
Unclassified | root | N/A | 41.22 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300000550|F24TB_10447434 | Not Available | 1138 | Open in IMG/M |
3300001305|C688J14111_10270141 | Not Available | 536 | Open in IMG/M |
3300001686|C688J18823_10576991 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Vicinamibacteria → Vicinamibacterales → Vicinamibacteraceae → Luteitalea → unclassified Luteitalea → Luteitalea sp. TBR-22 | 718 | Open in IMG/M |
3300001686|C688J18823_10983420 | Not Available | 535 | Open in IMG/M |
3300002128|JGI24036J26619_10130273 | All Organisms → cellular organisms → Bacteria | 523 | Open in IMG/M |
3300004114|Ga0062593_100276744 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1410 | Open in IMG/M |
3300004114|Ga0062593_100531856 | All Organisms → cellular organisms → Bacteria | 1100 | Open in IMG/M |
3300004157|Ga0062590_102341401 | All Organisms → cellular organisms → Bacteria | 562 | Open in IMG/M |
3300004463|Ga0063356_101614631 | All Organisms → cellular organisms → Bacteria | 966 | Open in IMG/M |
3300004480|Ga0062592_101097134 | All Organisms → cellular organisms → Bacteria | 736 | Open in IMG/M |
3300004480|Ga0062592_101462313 | All Organisms → cellular organisms → Bacteria | 654 | Open in IMG/M |
3300004643|Ga0062591_102761154 | All Organisms → cellular organisms → Bacteria | 520 | Open in IMG/M |
3300005093|Ga0062594_101852977 | All Organisms → cellular organisms → Bacteria | 638 | Open in IMG/M |
3300005280|Ga0065696_1372520 | Not Available | 536 | Open in IMG/M |
3300005290|Ga0065712_10226463 | All Organisms → cellular organisms → Bacteria | 1025 | Open in IMG/M |
3300005295|Ga0065707_10025578 | All Organisms → cellular organisms → Bacteria | 1760 | Open in IMG/M |
3300005328|Ga0070676_11282721 | Not Available | 559 | Open in IMG/M |
3300005330|Ga0070690_101049344 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 644 | Open in IMG/M |
3300005330|Ga0070690_101782306 | Not Available | 502 | Open in IMG/M |
3300005336|Ga0070680_101288618 | All Organisms → cellular organisms → Bacteria | 632 | Open in IMG/M |
3300005343|Ga0070687_100669915 | Not Available | 721 | Open in IMG/M |
3300005344|Ga0070661_100481462 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 991 | Open in IMG/M |
3300005347|Ga0070668_100046868 | All Organisms → cellular organisms → Bacteria | 3322 | Open in IMG/M |
3300005353|Ga0070669_100440294 | All Organisms → cellular organisms → Bacteria | 1073 | Open in IMG/M |
3300005354|Ga0070675_100003971 | All Organisms → cellular organisms → Bacteria | 11216 | Open in IMG/M |
3300005365|Ga0070688_100985377 | Not Available | 669 | Open in IMG/M |
3300005365|Ga0070688_101545974 | All Organisms → cellular organisms → Bacteria | 541 | Open in IMG/M |
3300005366|Ga0070659_101084909 | Not Available | 705 | Open in IMG/M |
3300005441|Ga0070700_100466485 | All Organisms → cellular organisms → Bacteria | 964 | Open in IMG/M |
3300005441|Ga0070700_100554723 | All Organisms → cellular organisms → Bacteria | 893 | Open in IMG/M |
3300005444|Ga0070694_100158859 | All Organisms → cellular organisms → Bacteria | 1657 | Open in IMG/M |
3300005455|Ga0070663_100302293 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 1281 | Open in IMG/M |
3300005459|Ga0068867_101377809 | All Organisms → cellular organisms → Bacteria | 653 | Open in IMG/M |
3300005459|Ga0068867_101436692 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycolicibacterium → Mycolicibacterium tusciae | 641 | Open in IMG/M |
3300005466|Ga0070685_10533152 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 835 | Open in IMG/M |
3300005549|Ga0070704_100919735 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 788 | Open in IMG/M |
3300005563|Ga0068855_100564613 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1231 | Open in IMG/M |
3300005577|Ga0068857_100408686 | All Organisms → cellular organisms → Bacteria | 1264 | Open in IMG/M |
3300005617|Ga0068859_102294484 | All Organisms → cellular organisms → Bacteria | 595 | Open in IMG/M |
3300005617|Ga0068859_102315974 | All Organisms → cellular organisms → Bacteria | 592 | Open in IMG/M |
3300006196|Ga0075422_10048663 | All Organisms → cellular organisms → Bacteria | 1529 | Open in IMG/M |
3300006196|Ga0075422_10067692 | Not Available | 1324 | Open in IMG/M |
3300006237|Ga0097621_100542193 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1058 | Open in IMG/M |
3300006845|Ga0075421_100678448 | All Organisms → cellular organisms → Bacteria | 1200 | Open in IMG/M |
3300006845|Ga0075421_102620894 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Micromonospora → unclassified Micromonospora → Micromonospora sp. L5 | 523 | Open in IMG/M |
3300006853|Ga0075420_100015960 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 6710 | Open in IMG/M |
3300006853|Ga0075420_100237373 | All Organisms → cellular organisms → Bacteria | 1586 | Open in IMG/M |
3300006871|Ga0075434_100923170 | All Organisms → cellular organisms → Bacteria | 888 | Open in IMG/M |
3300006881|Ga0068865_100957021 | All Organisms → cellular organisms → Bacteria | 747 | Open in IMG/M |
3300006954|Ga0079219_11281368 | Not Available | 643 | Open in IMG/M |
3300006969|Ga0075419_10441291 | All Organisms → cellular organisms → Bacteria | 897 | Open in IMG/M |
3300007076|Ga0075435_100807868 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 817 | Open in IMG/M |
3300009094|Ga0111539_12869011 | Not Available | 558 | Open in IMG/M |
3300009100|Ga0075418_11379806 | Not Available | 764 | Open in IMG/M |
3300009148|Ga0105243_10844379 | All Organisms → cellular organisms → Bacteria | 906 | Open in IMG/M |
3300009156|Ga0111538_10913066 | Not Available | 1111 | Open in IMG/M |
3300009156|Ga0111538_13804345 | Not Available | 522 | Open in IMG/M |
3300009174|Ga0105241_12140680 | Not Available | 553 | Open in IMG/M |
3300009176|Ga0105242_11913475 | All Organisms → cellular organisms → Bacteria | 634 | Open in IMG/M |
3300009545|Ga0105237_12182609 | Not Available | 563 | Open in IMG/M |
3300010036|Ga0126305_11226396 | Not Available | 518 | Open in IMG/M |
3300010045|Ga0126311_11742641 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Vicinamibacteria → Vicinamibacterales → Vicinamibacteraceae → Luteitalea → unclassified Luteitalea → Luteitalea sp. TBR-22 | 527 | Open in IMG/M |
3300010375|Ga0105239_13514474 | All Organisms → cellular organisms → Bacteria | 509 | Open in IMG/M |
3300010401|Ga0134121_11726806 | Not Available | 650 | Open in IMG/M |
3300011119|Ga0105246_11889689 | Not Available | 573 | Open in IMG/M |
3300011441|Ga0137452_1171402 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Vicinamibacteria → Vicinamibacterales → Vicinamibacteraceae → Luteitalea → unclassified Luteitalea → Luteitalea sp. TBR-22 | 733 | Open in IMG/M |
3300011993|Ga0120182_1001948 | All Organisms → cellular organisms → Bacteria | 1013 | Open in IMG/M |
3300012469|Ga0150984_116722866 | Not Available | 525 | Open in IMG/M |
3300012892|Ga0157294_10189231 | Not Available | 598 | Open in IMG/M |
3300012899|Ga0157299_10179984 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Vicinamibacteria → Vicinamibacterales → Vicinamibacteraceae → Luteitalea → unclassified Luteitalea → Luteitalea sp. TBR-22 | 621 | Open in IMG/M |
3300012957|Ga0164303_11074960 | Not Available | 579 | Open in IMG/M |
3300012987|Ga0164307_11244518 | Not Available | 619 | Open in IMG/M |
3300012988|Ga0164306_11185649 | Not Available | 639 | Open in IMG/M |
3300014326|Ga0157380_10435888 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1254 | Open in IMG/M |
3300014326|Ga0157380_11765062 | Not Available | 677 | Open in IMG/M |
3300014745|Ga0157377_11376103 | Not Available | 555 | Open in IMG/M |
3300014874|Ga0180084_1036991 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Vicinamibacteria → Vicinamibacterales → Vicinamibacteraceae → Luteitalea → unclassified Luteitalea → Luteitalea sp. TBR-22 | 945 | Open in IMG/M |
3300015077|Ga0173483_10320719 | Not Available | 766 | Open in IMG/M |
3300015201|Ga0173478_10515989 | All Organisms → cellular organisms → Bacteria | 602 | Open in IMG/M |
3300015371|Ga0132258_11139056 | All Organisms → cellular organisms → Bacteria | 1972 | Open in IMG/M |
3300015371|Ga0132258_12533654 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1283 | Open in IMG/M |
3300015371|Ga0132258_13474034 | Not Available | 1080 | Open in IMG/M |
3300015371|Ga0132258_13711192 | Not Available | 1042 | Open in IMG/M |
3300015372|Ga0132256_102054977 | Not Available | 677 | Open in IMG/M |
3300015372|Ga0132256_103058269 | Not Available | 562 | Open in IMG/M |
3300015373|Ga0132257_104336786 | Not Available | 516 | Open in IMG/M |
3300015373|Ga0132257_104383913 | All Organisms → cellular organisms → Bacteria | 513 | Open in IMG/M |
3300015374|Ga0132255_100615048 | Not Available | 1607 | Open in IMG/M |
3300015374|Ga0132255_103892676 | Not Available | 634 | Open in IMG/M |
3300019356|Ga0173481_10098445 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1119 | Open in IMG/M |
3300019362|Ga0173479_10094348 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1094 | Open in IMG/M |
3300022899|Ga0247795_1028347 | Not Available | 913 | Open in IMG/M |
3300024055|Ga0247794_10151723 | Not Available | 724 | Open in IMG/M |
3300025271|Ga0207666_1038781 | All Organisms → cellular organisms → Bacteria | 743 | Open in IMG/M |
3300025899|Ga0207642_11053495 | All Organisms → cellular organisms → Bacteria | 525 | Open in IMG/M |
3300025903|Ga0207680_11375557 | All Organisms → cellular organisms → Bacteria | 501 | Open in IMG/M |
3300025920|Ga0207649_10429240 | All Organisms → cellular organisms → Bacteria | 994 | Open in IMG/M |
3300025933|Ga0207706_11244363 | Not Available | 617 | Open in IMG/M |
3300025935|Ga0207709_10675062 | Not Available | 825 | Open in IMG/M |
3300025935|Ga0207709_11088107 | All Organisms → cellular organisms → Bacteria | 656 | Open in IMG/M |
3300025939|Ga0207665_10247748 | Not Available | 1315 | Open in IMG/M |
3300025961|Ga0207712_10141679 | All Organisms → cellular organisms → Bacteria | 1846 | Open in IMG/M |
3300025986|Ga0207658_10373550 | All Organisms → cellular organisms → Bacteria | 1247 | Open in IMG/M |
3300025986|Ga0207658_11581660 | Not Available | 599 | Open in IMG/M |
3300025986|Ga0207658_11719837 | All Organisms → cellular organisms → Bacteria | 573 | Open in IMG/M |
3300026023|Ga0207677_12168253 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Vicinamibacteria → Vicinamibacterales → Vicinamibacteraceae → Luteitalea → unclassified Luteitalea → Luteitalea sp. TBR-22 | 517 | Open in IMG/M |
3300026035|Ga0207703_12378346 | Not Available | 505 | Open in IMG/M |
3300026075|Ga0207708_11530524 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Vicinamibacteria → Vicinamibacterales → Vicinamibacteraceae → Luteitalea → unclassified Luteitalea → Luteitalea sp. TBR-22 | 586 | Open in IMG/M |
3300026078|Ga0207702_12309429 | All Organisms → cellular organisms → Bacteria | 526 | Open in IMG/M |
3300026116|Ga0207674_10481349 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1200 | Open in IMG/M |
3300031226|Ga0307497_10275956 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Vicinamibacteria → Vicinamibacterales → Vicinamibacteraceae → Luteitalea → unclassified Luteitalea → Luteitalea sp. | 761 | Open in IMG/M |
3300031538|Ga0310888_10518661 | Not Available | 715 | Open in IMG/M |
3300031716|Ga0310813_11988054 | Not Available | 548 | Open in IMG/M |
3300031854|Ga0310904_10877893 | All Organisms → cellular organisms → Bacteria | 632 | Open in IMG/M |
3300031854|Ga0310904_10932058 | Not Available | 615 | Open in IMG/M |
3300031858|Ga0310892_10425704 | Not Available | 870 | Open in IMG/M |
3300031892|Ga0310893_10260374 | All Organisms → cellular organisms → Bacteria | 722 | Open in IMG/M |
3300031908|Ga0310900_11120554 | All Organisms → cellular organisms → Bacteria | 652 | Open in IMG/M |
3300031940|Ga0310901_10085444 | Not Available | 1110 | Open in IMG/M |
3300031995|Ga0307409_100880293 | Not Available | 908 | Open in IMG/M |
3300032003|Ga0310897_10227754 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 825 | Open in IMG/M |
3300032003|Ga0310897_10517006 | Not Available | 581 | Open in IMG/M |
3300032012|Ga0310902_10307372 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 978 | Open in IMG/M |
3300032012|Ga0310902_11139540 | Not Available | 547 | Open in IMG/M |
3300032013|Ga0310906_10292659 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1036 | Open in IMG/M |
3300032013|Ga0310906_10767560 | All Organisms → cellular organisms → Bacteria | 678 | Open in IMG/M |
3300032174|Ga0307470_11906630 | Not Available | 506 | Open in IMG/M |
3300032179|Ga0310889_10048890 | Not Available | 1644 | Open in IMG/M |
3300032211|Ga0310896_10008431 | Not Available | 3211 | Open in IMG/M |
3300032211|Ga0310896_10865403 | Not Available | 521 | Open in IMG/M |
3300032421|Ga0310812_10504524 | All Organisms → cellular organisms → Bacteria | 544 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 12.21% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 9.92% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 9.16% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 6.11% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 5.34% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 4.58% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 4.58% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 4.58% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 3.82% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 3.82% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 3.82% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 3.05% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 3.05% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 2.29% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 2.29% |
Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 1.53% |
Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 1.53% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.53% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.53% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 1.53% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 1.53% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.76% |
Terrestrial | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial | 0.76% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.76% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.76% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.76% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere | 0.76% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.76% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.76% |
Switchgrass Rhizosphere Bulk Soil | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Switchgrass Rhizosphere Bulk Soil | 0.76% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.76% |
Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.76% |
Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.76% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.76% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.76% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.76% |
Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 0.76% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300000550 | Amended soil microbial communities from Kansas Great Prairies, USA - BrdU amended with acetate total DNA F2.4 TB clc assemly | Environmental | Open in IMG/M |
3300001305 | Grasslands soil microbial communities from Hopland, California, USA | Environmental | Open in IMG/M |
3300001686 | Grasslands soil microbial communities from Hopland, California, USA | Environmental | Open in IMG/M |
3300002128 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 | Environmental | Open in IMG/M |
3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
3300004157 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2 | Environmental | Open in IMG/M |
3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
3300004480 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4 | Environmental | Open in IMG/M |
3300004643 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3 | Environmental | Open in IMG/M |
3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
3300005280 | Switchgrass rhizosphere microbial community from Michigan, USA - East Lansing bulk soil | Host-Associated | Open in IMG/M |
3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 | Host-Associated | Open in IMG/M |
3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 | Environmental | Open in IMG/M |
3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Host-Associated | Open in IMG/M |
3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Environmental | Open in IMG/M |
3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Environmental | Open in IMG/M |
3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Environmental | Open in IMG/M |
3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Host-Associated | Open in IMG/M |
3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Host-Associated | Open in IMG/M |
3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Host-Associated | Open in IMG/M |
3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Host-Associated | Open in IMG/M |
3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Environmental | Open in IMG/M |
3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Host-Associated | Open in IMG/M |
3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Environmental | Open in IMG/M |
3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Environmental | Open in IMG/M |
3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Host-Associated | Open in IMG/M |
3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Host-Associated | Open in IMG/M |
3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Environmental | Open in IMG/M |
3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Environmental | Open in IMG/M |
3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Host-Associated | Open in IMG/M |
3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Host-Associated | Open in IMG/M |
3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
3300006196 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 | Host-Associated | Open in IMG/M |
3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) | Host-Associated | Open in IMG/M |
3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
3300006853 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4 | Host-Associated | Open in IMG/M |
3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Host-Associated | Open in IMG/M |
3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
3300006969 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 | Host-Associated | Open in IMG/M |
3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
3300010036 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot26 | Environmental | Open in IMG/M |
3300010045 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot61 | Environmental | Open in IMG/M |
3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Host-Associated | Open in IMG/M |
3300011441 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT513_2 | Environmental | Open in IMG/M |
3300011993 | Terrestrial microbial communites from a soil warming plot in Okalahoma, USA - C1.rep1 | Environmental | Open in IMG/M |
3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
3300012892 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S209-509C-1 | Environmental | Open in IMG/M |
3300012899 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S058-202B-2 | Environmental | Open in IMG/M |
3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
3300012987 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MG | Environmental | Open in IMG/M |
3300012988 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MG | Environmental | Open in IMG/M |
3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Host-Associated | Open in IMG/M |
3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Host-Associated | Open in IMG/M |
3300014874 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT660_2_16_10D | Environmental | Open in IMG/M |
3300015077 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S178-409R-2 (version 2) | Environmental | Open in IMG/M |
3300015201 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S014-104B-1 (version 2) | Environmental | Open in IMG/M |
3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
3300019356 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2 (version 2) | Environmental | Open in IMG/M |
3300019362 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S104-311B-1 (version 2) | Environmental | Open in IMG/M |
3300022899 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S016-104C-6 | Environmental | Open in IMG/M |
3300024055 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S046-202B-6 | Environmental | Open in IMG/M |
3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) | Environmental | Open in IMG/M |
3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300031226 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 10_S | Environmental | Open in IMG/M |
3300031538 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D1 | Environmental | Open in IMG/M |
3300031716 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3 | Environmental | Open in IMG/M |
3300031854 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D1 | Environmental | Open in IMG/M |
3300031858 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D2 | Environmental | Open in IMG/M |
3300031892 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D2 | Environmental | Open in IMG/M |
3300031908 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D1 | Environmental | Open in IMG/M |
3300031940 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D2 | Environmental | Open in IMG/M |
3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Host-Associated | Open in IMG/M |
3300032003 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D1 | Environmental | Open in IMG/M |
3300032012 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D3 | Environmental | Open in IMG/M |
3300032013 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D3 | Environmental | Open in IMG/M |
3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
3300032179 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D2 | Environmental | Open in IMG/M |
3300032211 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D1 | Environmental | Open in IMG/M |
3300032421 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NN3 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
F24TB_104474342 | 3300000550 | Soil | MPMRQLIVIGTVLLAAACGGPQAPPARPAAEPSAAVQLGGPPTGAGTSTA |
C688J14111_102701411 | 3300001305 | Soil | MPVKQLIVIGTVLLAAACGSPQSTPGPQAPAATTAAEPSTAVQLGGPPT |
C688J18823_105769912 | 3300001686 | Soil | MFMRQLIVIGTVLLAAGCGGSQSPPGTPVATSSQAVQLGGPPTGAGTSTADT |
C688J18823_109834201 | 3300001686 | Soil | MKHLIVVATVLLAAACGGPQPPTSTPAAESSQAVQLGGPPSSAGT |
JGI24036J26619_101302731 | 3300002128 | Corn, Switchgrass And Miscanthus Rhizosphere | MMSLRKLVVTGTVLFAAACGGPRSAPVPPAAEPSSQAVQLGGPPSGAGT |
Ga0062593_1002767441 | 3300004114 | Soil | MPVRQTIVIGALSVAAACGGSQSPPGPQAPPVATAERSAATQLGGP |
Ga0062593_1005318561 | 3300004114 | Soil | MRQLIVTGIVSLAAACGGPQPPPAKPAAEPSAAVQLGGPPTGAG |
Ga0062590_1023414012 | 3300004157 | Soil | MSMMNRLVIGAALLAAACGGPQSAPATPAANASPAVQLGGPPSG |
Ga0063356_1016146312 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MPVRQLIVIGTVLLAAGCGQPQPPGGTPATASSQAVQLGGPPTDAGTLNAD |
Ga0062592_1010971341 | 3300004480 | Soil | MPMRQPIVIGTVLLAAACGGPKSTPGPQAPPATTTAEPSAAVQLGGPPTGAGTSTAD |
Ga0062592_1014623131 | 3300004480 | Soil | MRQLIVIGTVLLAAGCGGPQSTPGTPAGESSQAVQLGGPPSGAGTLNA |
Ga0062591_1027611541 | 3300004643 | Soil | MPMRQLIVIGTVVLAAGCGGAQSPSSAPAAESPQAVQLGGPPSGA |
Ga0062594_1018529772 | 3300005093 | Soil | MPMRQLIVIGTVVLAAGCGGAQSPSSAPAAESPQAVQLGGPPS |
Ga0065696_13725201 | 3300005280 | Switchgrass Rhizosphere Bulk Soil | MPMRRLIVIGTLLLAAACGGPASTPGPQAPPAPTAAEKSAAVQLGGPPTGAGTSNADTGE |
Ga0065712_102264633 | 3300005290 | Miscanthus Rhizosphere | MALRQVIVIGTVLLAACGGPPSTSQQHAPPATTAAAASAAVQLGGPPTGAGTTTA |
Ga0065707_100255783 | 3300005295 | Switchgrass Rhizosphere | MPMRQLVVIGTVLLGAACGSPQSTPAPQAPPATTAVQLGGPPTGAGTSTADS |
Ga0070676_112827211 | 3300005328 | Miscanthus Rhizosphere | MRQFIVIGTVLLAAACDSPQSTPGPQAPAATTAAGPSAAVQLGGPPSGAG |
Ga0070690_1010493441 | 3300005330 | Switchgrass Rhizosphere | MPVRQRIVIGAVLLSASCGGPQSPPAKPAAEPPAAVQLGGPPTGAGTS |
Ga0070690_1017823061 | 3300005330 | Switchgrass Rhizosphere | MRQLVIGTVFLAAACGGPNSTPGPQTPPATTGRETGAAVQLGGPPTGAGTS |
Ga0070680_1012886181 | 3300005336 | Corn Rhizosphere | MPMRQLIAIGAVLLSAACGGPQSPPAKPAAEPSAAVQLGGPPTGAGTSTADTGEI |
Ga0070687_1006699152 | 3300005343 | Switchgrass Rhizosphere | MRQLVIGTVLLAAACGGPQSPPAKPAADATPAVQLGGPPSSAGTATADSGEI |
Ga0070661_1004814623 | 3300005344 | Corn Rhizosphere | MPVRQRIVIGAVLLSASCGGPQSPPAKPAAEPPAAVQLGG |
Ga0070668_1000468684 | 3300005347 | Switchgrass Rhizosphere | MPMRQFIVIGTVLLAAACDSPQSTPGPQAPAATTAAGPSAAVQLGGPP |
Ga0070669_1004402943 | 3300005353 | Switchgrass Rhizosphere | MPMRQLIVIGTVVLAAGCGGAQSPSSAPAAESPQAVQLGGP |
Ga0070675_10000397113 | 3300005354 | Miscanthus Rhizosphere | MRRLLVCGTVWLAAACGGPQPPQGTPATEPSAAVQLGGPPSGAGSASADAGEI |
Ga0070688_1009853771 | 3300005365 | Switchgrass Rhizosphere | MRQLVIGTVFLAAACGGPNSTPGPQTPPATTGRETGAAVQLGGPPTGAGTST |
Ga0070688_1015459741 | 3300005365 | Switchgrass Rhizosphere | MRPLVLFATILLAAACGGPQSPPARPAAEPPAAVQLGGPPTGAGTSTAD |
Ga0070659_1010849092 | 3300005366 | Corn Rhizosphere | MPMRQVIVIGTVLLAAACGGPQSTPGPQAPAAKPAAEPSAAVQLGG |
Ga0070700_1004664853 | 3300005441 | Corn, Switchgrass And Miscanthus Rhizosphere | LAVRPLTVIGFVLLGAACGGPQPPPGKPAAAPSAAVQLGGPPTGAG |
Ga0070700_1005547231 | 3300005441 | Corn, Switchgrass And Miscanthus Rhizosphere | MPMRQLIVIGTVLLAAGCGGAQSPSSTPAAESPQAVQLGGPPSGAGT |
Ga0070694_1001588591 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | MRQFIVIGTVLLAAACDSPQSTPGPQAPAATTAAGPSAAVQLGGPP |
Ga0070663_1003022931 | 3300005455 | Corn Rhizosphere | MPVRQRIVIGAVLLSASCGGPQSPPAKPAAEPPAAVQLGGPPTGTGTTTADTGEIK |
Ga0068867_1013778091 | 3300005459 | Miscanthus Rhizosphere | MPVRQLIMIGTVLLAAGCGGSQSPSGTPAAESSPAVQLGGPPSGAGTLNADGGEI |
Ga0068867_1014366921 | 3300005459 | Miscanthus Rhizosphere | MRQLVIGTMFLAAACGGSQSPPGPQAPPATTATQPAAAVQLGGPP |
Ga0070685_105331522 | 3300005466 | Switchgrass Rhizosphere | MRQLVVIGTVLLTAACGGPQAPPAGPAAEPSAAVQLGGPPTGTGTSTADAGEITPADPTT |
Ga0070704_1009197352 | 3300005549 | Corn, Switchgrass And Miscanthus Rhizosphere | MPMRQLVVIGTVVLAAACGGPQSSPAQPAAEPPPAVQLGGPPTGAGTSTAD |
Ga0068855_1005646132 | 3300005563 | Corn Rhizosphere | MPVRQTIVIGTLWVAAACGGSPSPPGPQAPQATGVAEPSAAVQLGGPPTGA |
Ga0068857_1004086861 | 3300005577 | Corn Rhizosphere | MPMRQLIVIGTVLLTAACGGPQPPVAKPAAEPSAAVQLGGPPTG |
Ga0068859_1022944841 | 3300005617 | Switchgrass Rhizosphere | MPMRQLILFGTVLLVAGCGGPQPAPAKPAAEPSAALQLGGPPTGAGTS |
Ga0068859_1023159742 | 3300005617 | Switchgrass Rhizosphere | MPLRQLIVIGTVSLAAACGGPPAPPAQPAAAPSAAVQL |
Ga0075422_100486631 | 3300006196 | Populus Rhizosphere | MRQLVVVATILVVTACGGPRSSPPAPAAEPSAAVQLGGPPTGAGTTTADTGEIQ |
Ga0075422_100676921 | 3300006196 | Populus Rhizosphere | MRQLVIGTVLLAAACGGPQSPPAKPAADATPAVQLGGPPSSAGTAT |
Ga0097621_1005421932 | 3300006237 | Miscanthus Rhizosphere | MRQLLVCGAGLLLAAACGGSQPPQGTPAAEPSAAVQLGGPPSGAG |
Ga0075421_1006784481 | 3300006845 | Populus Rhizosphere | MPMRQLIVIGTVLFAAACGSPQSTPGTQAPPATTAAEPSAAVQLGGPPTGAGT |
Ga0075421_1026208941 | 3300006845 | Populus Rhizosphere | MRQLVIGTVFLAAACGGPTSTPEPQTPQATTGAEPAAAVQLGGPPTGAGTSTADTGEI |
Ga0075420_1000159601 | 3300006853 | Populus Rhizosphere | MKRLRLIVIGTVLLAAACGGPESTPGPQAPSAKPASEPSAAVQLGGPPTDAGT |
Ga0075420_1002373732 | 3300006853 | Populus Rhizosphere | MPMRQLIVIGTVLFAAACGSPQSTPGTQAPPATTAAEPSAAVQLGGPPTGAGTT |
Ga0075434_1009231701 | 3300006871 | Populus Rhizosphere | MPMRPLIVIGTLLLGAACGGPQPPPAKPAAEPSAAVQLGGPPTGAGTSTADTGEIKPA |
Ga0068865_1009570211 | 3300006881 | Miscanthus Rhizosphere | MPMRQLVVIGTVVLAAACGGPQSSPAKPAAEPPPAVQLGGPPSSAGTVTADS |
Ga0079219_112813683 | 3300006954 | Agricultural Soil | MRQLVIATVLLAAACGSPQSTPGTQAPRATTAAEPSAAVQLGGPPTGAGTST |
Ga0075419_104412912 | 3300006969 | Populus Rhizosphere | MPIRQLIVIGTVLLAAACGGPQPPPAKPAAVPSAAVQLGGPPAGAGTSTADTG |
Ga0075435_1008078681 | 3300007076 | Populus Rhizosphere | MPMRPLIVIGTLLLGAACGGPQPPPAKPAAEPSAA |
Ga0111539_128690111 | 3300009094 | Populus Rhizosphere | MKRLRLIVIGTVLLAAACGGPESTPGPQAPSAKPASEPSAAVQL |
Ga0075418_113798061 | 3300009100 | Populus Rhizosphere | MPMKQLIVIGTVVLAAACGSPQSTPGPQAPPATTTAEPSAAVQLGGPPTGAGTS |
Ga0105243_108443792 | 3300009148 | Miscanthus Rhizosphere | MPVRQLIVIGTVLLAAGCGQPQPPGGTPATASSQAVQLGGPPTDAGTLSA |
Ga0111538_109130663 | 3300009156 | Populus Rhizosphere | MPMRQLIVIGTVLLTAACGGPQSPPAAQAPPAVQLGGPPSNAGTLTADSGDIQPA |
Ga0111538_138043452 | 3300009156 | Populus Rhizosphere | MRQLIVIGTVLLTAGCGGPQSTPGTPAGESSQAVQLGGPPSGAGTLNADGGEI |
Ga0105241_121406802 | 3300009174 | Corn Rhizosphere | MPMRQLIVIGAVLLSAACGGPQSPPAKPAAEPSAAVQLGGPP |
Ga0105242_119134751 | 3300009176 | Miscanthus Rhizosphere | MPVRQRIVIGAVLLSASCGGPQSPPAKPAAEPSAAVQLGGPPTAAGTSTAD |
Ga0105237_121826091 | 3300009545 | Corn Rhizosphere | MPMRPLIVIGTLLLGAACGGPQPPPAKPAAEPSAAVQLGGPPTGAGTS |
Ga0126305_112263961 | 3300010036 | Serpentine Soil | MRQLVLIGTVLLAAACGGSQPTPAPQAPASTTAAEPSAAIQLGGPPTGA |
Ga0126311_117426411 | 3300010045 | Serpentine Soil | MRQLIVIGTVLFAAACGGPPSTPGPQAPAATPAAEPSAAVQLGGPPTGAGTSTADTG |
Ga0105239_135144741 | 3300010375 | Corn Rhizosphere | MPVRQRIVIGAVLLSASCGGPQSPPAKPAAEPPAAVQLG |
Ga0134121_117268062 | 3300010401 | Terrestrial Soil | MPMRQLIVIGTVLLAAACGGPQPPPSKPAAESSQAVQLGGPPSSAGTSTADTGE |
Ga0105246_118896891 | 3300011119 | Miscanthus Rhizosphere | MPVRQLIVIGTVLLAAGCGQPQPPGGTPATASSQAVQLGGP |
Ga0137452_11714021 | 3300011441 | Soil | MRPLIVIGTVLLAAACGGPQAPPATPAAEPSAAVQLGGPP |
Ga0120182_10019481 | 3300011993 | Terrestrial | MPMRQLIVIGTVLFAAACGSPQSTPGTQAPPATTAAEPSA |
Ga0150984_1167228662 | 3300012469 | Avena Fatua Rhizosphere | MPMRPLIVIGTVLLAASCGGPKSTPGPQAPPATTTAEPSAAKQLGGPPSGAGTSTADTGDIE |
Ga0157294_101892311 | 3300012892 | Soil | MKQLVVIGTVLLAAACGDPQSTPPGSQAPPVTEPSAAVQLGGPGSGTGTARADV |
Ga0157299_101799843 | 3300012899 | Soil | MRQLVVVATILITTACGGTQSPPATPAAEAPPVVQLGAPPSSAGTVTADSG |
Ga0164303_110749602 | 3300012957 | Soil | MPMRLIVIGTVLLATACGGPQSLPGTPAAESSQAIQLGGPPSGAGTL |
Ga0164307_112445182 | 3300012987 | Soil | MFVGERHEESAMPMRQLIVMGTVLLAAACGGPKSTSEPQAPPATTAAEPSAAAQLGGPPT |
Ga0164306_111856492 | 3300012988 | Soil | MFVGERHEESAMPMRQLIVMGTVLLAAACGGPKSTSEPQAPPATTAAEPSAAA |
Ga0157380_104358881 | 3300014326 | Switchgrass Rhizosphere | MPMRQLVVIGIVLLATGCGGPQSSPPTPAAESSPAVQLGGPPTDA |
Ga0157380_117650622 | 3300014326 | Switchgrass Rhizosphere | MRQLVIGTVLFAAACGSPTSTPSTQAPPAPATSSAVQLGGPPTGAGTATA |
Ga0157377_113761031 | 3300014745 | Miscanthus Rhizosphere | MPVRQLIGIGTVLLAAGCGQPQPPGGTPATASSQAVQLGGPP |
Ga0180084_10369912 | 3300014874 | Soil | MPMRQLIVIGTVLLAAGCGGPQSPPGTPAAESSQAVQLGGPPSGAGTVNADGGEIQPAD |
Ga0173483_103207192 | 3300015077 | Soil | MPMRQLILIGTALLAAGCGGAQSPPSTPAAESPQAV |
Ga0173478_105159891 | 3300015201 | Soil | MPVRPLIVIGTVLLVAGCGGPQSTPGAPASESSQVVQLGGPPSGAGTLNA |
Ga0132258_111390561 | 3300015371 | Arabidopsis Rhizosphere | MPVRQLIVIGTVLLAAGCGQPQPPGGTPATASSQAVQ |
Ga0132258_125336541 | 3300015371 | Arabidopsis Rhizosphere | MRQFIVIGTVLLAAACGSPQSTPGPQTPAARPAAEPSAAVQLGGPPTGAGTSTADTGE |
Ga0132258_134740342 | 3300015371 | Arabidopsis Rhizosphere | MPMRQLIVIATVLVAAACGGPQSPPAKPAAEAPPAVQLGGPPSNAGTV |
Ga0132258_137111922 | 3300015371 | Arabidopsis Rhizosphere | MPMRQLIAIGTVLLAAACGSPTSTPGPQAPPATTAAER |
Ga0132256_1020549772 | 3300015372 | Arabidopsis Rhizosphere | MPMRQLIVIGTVLFAAACGSPQSTPGTQTRAPTTAAEPSAAVQLGGPPTGAGTSTA |
Ga0132256_1030582691 | 3300015372 | Arabidopsis Rhizosphere | MRQLVIGTVLLAAACGSPESTPGTSAPPATTAAEPSAAVQLGGPPTGAGTST |
Ga0132257_1043367861 | 3300015373 | Arabidopsis Rhizosphere | MAMRQVIVIGTVLLAACGSPQSTPGPQAPAAKPAAEPSA |
Ga0132257_1043839131 | 3300015373 | Arabidopsis Rhizosphere | MRQRIVIAAVLLSPACGGPQSPAKPAAEAPPAVQLGGPPSNAGTVTAD |
Ga0132255_1006150481 | 3300015374 | Arabidopsis Rhizosphere | MRQLIVIGTVLFAAACGSPQSTPGTQPAPAAEPSATVQLGGPPTGAGTTTADTGEI |
Ga0132255_1038926761 | 3300015374 | Arabidopsis Rhizosphere | MRQLVIGTVFLAAACGSPQSTPGTQAPAATTAAAPSAVEQLGGPPTGAGTS |
Ga0173481_100984451 | 3300019356 | Soil | MALRQVIVIGTVLLAACGGPPSTSQQHAPPATTAAAASAA |
Ga0173479_100943482 | 3300019362 | Soil | MMSLRKLVVTGTVLFAAACGGPRSAPVPPAAEPSSQAVQL |
Ga0247795_10283472 | 3300022899 | Soil | MRQLVIGTVLLAAACGGPQSPPAKPAADATPAVQLGGPPSSAGTATADSGEIQ |
Ga0247794_101517231 | 3300024055 | Soil | VGDGEEGVMPLRQLIVIGTLSLAAACGGAQSPPAKPATEPPAAVQLGGPPT |
Ga0207666_10387812 | 3300025271 | Corn, Switchgrass And Miscanthus Rhizosphere | MPVRQRIVIGAVLLSASCGGPQSPPAKPAAEPPAA |
Ga0207642_110534951 | 3300025899 | Miscanthus Rhizosphere | MPMRPLIVIATVLFAAACGSPQSTPGTQAPPPAPAAEPSAAVQLGGPPTGAGTSTAD |
Ga0207680_113755571 | 3300025903 | Switchgrass Rhizosphere | MPVRQRIVIGAVLLSASCGGPQSPPAKPAAEPPAAVQLGGPP |
Ga0207649_104292401 | 3300025920 | Corn Rhizosphere | MPVRQRIVIGAVLLSASCGGPQSPPAKPAAEPPAAVQLGGP |
Ga0207706_112443631 | 3300025933 | Corn Rhizosphere | MPMRPLIVIGTLLLGAACGGPQPPPAKPAAEPSAAVQLGGPPTGAGTSTADTGEI |
Ga0207709_106750621 | 3300025935 | Miscanthus Rhizosphere | MPMRQFIVIGTVLLAAACDSPQSTPGPQAPAATTAAGPS |
Ga0207709_110881072 | 3300025935 | Miscanthus Rhizosphere | MPMRQLIVIGTVLLAAGCGGAQSPSSTPAAESPQAVQ |
Ga0207665_102477481 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | MPMRQLIVIGTVLFAAACGGPNSTPGPQAPPAKPAAEPAAAVQLGGPPTGAGTST |
Ga0207712_101416793 | 3300025961 | Switchgrass Rhizosphere | MRQLVIGTVLLAAACGGPQSPPAKPAADATPAVQLGGPPS |
Ga0207658_103735501 | 3300025986 | Switchgrass Rhizosphere | MMSLRKLVVTGTVLFAAACGGPRSAPVPPAAEPSSQAVQLGGPPSGA |
Ga0207658_115816601 | 3300025986 | Switchgrass Rhizosphere | MPVRQLIVIGTVLLAAGCGQPQPPGGTPATASSQAVQL |
Ga0207658_117198371 | 3300025986 | Switchgrass Rhizosphere | MPMRQLILFGTVLLVAGCGGSQPAPAKPAAEPSAALQL |
Ga0207677_121682531 | 3300026023 | Miscanthus Rhizosphere | MRQLVVVATILITTACGGTQSPPATPAAEAPPVVQLGAPPSSAGTVTADSGDI |
Ga0207703_123783461 | 3300026035 | Switchgrass Rhizosphere | MGALLVAAACGGSPSPPRPQAPAATTAAEPPAAVQLGGPPTGA |
Ga0207708_115305241 | 3300026075 | Corn, Switchgrass And Miscanthus Rhizosphere | MRQLVVVAAILLATACGGPQSSPPTPAAEPSTAVQLGGPPTGAGTTTA |
Ga0207702_123094292 | 3300026078 | Corn Rhizosphere | MMSLRKLVVTGTVLFAAACGGPRSAPVPPAAEPSSQAVQLGGPPSGAGTL |
Ga0207674_104813494 | 3300026116 | Corn Rhizosphere | MPMRQLVVIGIVLLATGCGGPQSSPPTPAAESSPAVQLGGPPTDSGTLSA |
Ga0307497_102759562 | 3300031226 | Soil | MPMRQLIVIGTVLLAAACGNPQSTPGPPAPLPTTAAEPSAAVQ |
Ga0310888_105186612 | 3300031538 | Soil | MPMKQLIVIGTVVLAAACGSPQSTPGPQAPSATTAAEPSAAVQLGGPATG |
Ga0310813_119880542 | 3300031716 | Soil | MPMRQLIVIGAVLLSAACGGPQSPPAKPAAEPSAAVQLGGPPTGAGTSTADT |
Ga0310904_108778931 | 3300031854 | Soil | MPMRPLIVIATVLFAAACGSPQSTPGTQTPPATTAAEPS |
Ga0310904_109320581 | 3300031854 | Soil | MPVRQLIVIGTVLLAAGCGQPQPPGGTPATASSQAVQLGGPPS |
Ga0310892_104257042 | 3300031858 | Soil | MPMRQLVVIGIVLLAAGCGGPQSPPGTPVADSSEAVQLGGPPTDA |
Ga0310893_102603741 | 3300031892 | Soil | MPMRQLIVIATVLFAAACGSPQSTPGTQTPPATTAAEPSAAVQLGG |
Ga0310900_111205541 | 3300031908 | Soil | MPMRKLIVIGTVLAAAACGQPQSTPANTATEPPAAVQLGGP |
Ga0310901_100854442 | 3300031940 | Soil | MPMRQLILIGTALLAAGCGGAQSPPSTPAAESPQAVQLGGPPSGAGTVTADSG |
Ga0307409_1008802931 | 3300031995 | Rhizosphere | MRQVIVIGTVLLAVACGRSPAPPGTPAAEPTQAVQLGGP |
Ga0310897_102277541 | 3300032003 | Soil | MPVRQIILIATLSVAAACGGPQSTPGTQAPPATPAAAPSA |
Ga0310897_105170062 | 3300032003 | Soil | MRQLIVIGTVLLTAGCGGPQSTPGTPAGESSQAVQLGGPPSGAGTLNADGG |
Ga0310902_103073721 | 3300032012 | Soil | MPMRQLILFGTVLLVAACGGPQPAPAKPAAEPSAALQL |
Ga0310902_111395401 | 3300032012 | Soil | MPVRQIILIATLSVAAACGGPQSTPGTQAPPATPPAAPSAAVQLGGPPTGAGTSTADSGEIKPA |
Ga0310906_102926592 | 3300032013 | Soil | MALRQVIVIGTVLLAACGGPPSTSQQQAPPATTAPAASAAVQLGGPPTGA |
Ga0310906_107675601 | 3300032013 | Soil | MPMRQLIVIGTVLFAAGCGSPQSTPGTQAPPATAAAEPSAAVQLGGPPTGAG |
Ga0307470_119066301 | 3300032174 | Hardwood Forest Soil | MPVRQLIVIGTVLLAAGCGQPQPPGGTPATASSQAVQLGGPPTDA |
Ga0310889_100488902 | 3300032179 | Soil | MPMRQLILFGTVLLVAACGGPQPAPAKPAAEPSAALQLGGPPTGAGTSTADTGEIQ |
Ga0310896_100084314 | 3300032211 | Soil | MPMRQLILIGTALLAAGCGGAQSPPSTPAAESPQAVQLGGPPSGAGTVT |
Ga0310896_108654031 | 3300032211 | Soil | MPVRQIILIATLSVAAACGGPQSTPGTQAPPATPAAAPSAAVQLGGPPTGAGT |
Ga0310812_105045241 | 3300032421 | Soil | MRMRQLTVIGTVLIAAACGGSQRPPPKPAAEPSATVQLGGPPT |
⦗Top⦘ |