Basic Information | |
---|---|
Family ID | F061957 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 131 |
Average Sequence Length | 49 residues |
Representative Sequence | MRMPILTYFLVVGVILFGGMRLVSSQLEAKPLPVSQRIGVPAPFKAPPDATR |
Number of Associated Samples | 86 |
Number of Associated Scaffolds | 131 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Unclassified |
% of genes with valid RBS motifs | 89.92 % |
% of genes near scaffold ends (potentially truncated) | 51.15 % |
% of genes from short scaffolds (< 2000 bps) | 82.44 % |
Associated GOLD sequencing projects | 80 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.41 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Unclassified (51.908 % of family members) |
NCBI Taxonomy ID | N/A |
Taxonomy | N/A |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere (25.954 % of family members) |
Environment Ontology (ENVO) | Unclassified (34.351 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (47.328 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Fibrous | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 32.50% β-sheet: 0.00% Coil/Unstructured: 67.50% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.41 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 131 Family Scaffolds |
---|---|---|
PF01546 | Peptidase_M20 | 4.58 |
PF08238 | Sel1 | 2.29 |
PF00353 | HemolysinCabind | 1.53 |
PF00440 | TetR_N | 1.53 |
PF09209 | CecR_C | 1.53 |
PF04116 | FA_hydroxylase | 0.76 |
PF04073 | tRNA_edit | 0.76 |
PF04311 | DUF459 | 0.76 |
PF05638 | T6SS_HCP | 0.76 |
PF00589 | Phage_integrase | 0.76 |
PF05656 | DUF805 | 0.76 |
PF02586 | SRAP | 0.76 |
PF13545 | HTH_Crp_2 | 0.76 |
PF07784 | DUF1622 | 0.76 |
PF03449 | GreA_GreB_N | 0.76 |
PF05239 | PRC | 0.76 |
PF04392 | ABC_sub_bind | 0.76 |
PF13458 | Peripla_BP_6 | 0.76 |
PF00188 | CAP | 0.76 |
PF05532 | CsbD | 0.76 |
COG ID | Name | Functional Category | % Frequency in 131 Family Scaffolds |
---|---|---|---|
COG0782 | Transcription elongation factor, GreA/GreB family | Transcription [K] | 0.76 |
COG2135 | ssDNA abasic site-binding protein YedK/HMCES, SRAP family | Replication, recombination and repair [L] | 0.76 |
COG2340 | Spore germination protein YkwD and related proteins with CAP (CSP/antigen 5/PR1) domain | Cell cycle control, cell division, chromosome partitioning [D] | 0.76 |
COG2845 | Peptidoglycan O-acetyltransferase, SGNH hydrolase family | Cell wall/membrane/envelope biogenesis [M] | 0.76 |
COG2984 | ABC-type uncharacterized transport system, periplasmic component | General function prediction only [R] | 0.76 |
COG3000 | Sterol desaturase/sphingolipid hydroxylase, fatty acid hydroxylase superfamily | Lipid transport and metabolism [I] | 0.76 |
COG3152 | Uncharacterized membrane protein YhaH, DUF805 family | Function unknown [S] | 0.76 |
COG3157 | Type VI protein secretion system component Hcp (secreted cytotoxin) | Intracellular trafficking, secretion, and vesicular transport [U] | 0.76 |
COG3237 | Uncharacterized conserved protein YjbJ, UPF0337 family | Function unknown [S] | 0.76 |
COG4828 | Uncharacterized membrane protein | Function unknown [S] | 0.76 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
Unclassified | root | N/A | 51.91 % |
All Organisms | root | All Organisms | 48.09 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2228664021|ICCgaii200_c0701010 | Not Available | 771 | Open in IMG/M |
3300000033|ICChiseqgaiiDRAFT_c0710074 | Not Available | 1425 | Open in IMG/M |
3300001431|F14TB_101046375 | Not Available | 2057 | Open in IMG/M |
3300003911|JGI25405J52794_10086470 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 692 | Open in IMG/M |
3300004479|Ga0062595_100367365 | Not Available | 1012 | Open in IMG/M |
3300005093|Ga0062594_101855396 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 637 | Open in IMG/M |
3300005290|Ga0065712_10108863 | All Organisms → cellular organisms → Bacteria | 1857 | Open in IMG/M |
3300005294|Ga0065705_10327932 | Not Available | 997 | Open in IMG/M |
3300005294|Ga0065705_10680839 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 662 | Open in IMG/M |
3300005295|Ga0065707_10616599 | Not Available | 681 | Open in IMG/M |
3300005332|Ga0066388_100186461 | All Organisms → cellular organisms → Bacteria | 2687 | Open in IMG/M |
3300005332|Ga0066388_103759993 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 774 | Open in IMG/M |
3300005332|Ga0066388_104565520 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 705 | Open in IMG/M |
3300005332|Ga0066388_104812883 | Not Available | 687 | Open in IMG/M |
3300005341|Ga0070691_10495855 | Not Available | 705 | Open in IMG/M |
3300005341|Ga0070691_10819611 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. ORS 285 | 568 | Open in IMG/M |
3300005354|Ga0070675_100577769 | Not Available | 1018 | Open in IMG/M |
3300005441|Ga0070700_100036070 | All Organisms → cellular organisms → Bacteria | 2997 | Open in IMG/M |
3300005614|Ga0068856_101593727 | Not Available | 666 | Open in IMG/M |
3300005713|Ga0066905_100052056 | Not Available | 2514 | Open in IMG/M |
3300005713|Ga0066905_100084299 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 2100 | Open in IMG/M |
3300005713|Ga0066905_100167492 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 1604 | Open in IMG/M |
3300005713|Ga0066905_100187906 | Not Available | 1531 | Open in IMG/M |
3300005713|Ga0066905_100597523 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 933 | Open in IMG/M |
3300005713|Ga0066905_101532899 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 608 | Open in IMG/M |
3300005713|Ga0066905_102074725 | Not Available | 528 | Open in IMG/M |
3300005764|Ga0066903_100404145 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → unclassified Spartobacteria → Spartobacteria bacterium | 2249 | Open in IMG/M |
3300005764|Ga0066903_100544998 | Not Available | 1986 | Open in IMG/M |
3300005764|Ga0066903_100723383 | Not Available | 1761 | Open in IMG/M |
3300005764|Ga0066903_100948673 | Not Available | 1564 | Open in IMG/M |
3300005764|Ga0066903_102326213 | Not Available | 1035 | Open in IMG/M |
3300005764|Ga0066903_103650348 | Not Available | 828 | Open in IMG/M |
3300005764|Ga0066903_105149303 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 692 | Open in IMG/M |
3300005764|Ga0066903_108232856 | Not Available | 533 | Open in IMG/M |
3300005937|Ga0081455_10003771 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 17302 | Open in IMG/M |
3300005937|Ga0081455_10216958 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1421 | Open in IMG/M |
3300005937|Ga0081455_10332543 | Not Available | 1078 | Open in IMG/M |
3300005937|Ga0081455_10785675 | Not Available | 599 | Open in IMG/M |
3300006049|Ga0075417_10040542 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1973 | Open in IMG/M |
3300006049|Ga0075417_10058229 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 1685 | Open in IMG/M |
3300006196|Ga0075422_10309703 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 679 | Open in IMG/M |
3300006196|Ga0075422_10337838 | Not Available | 654 | Open in IMG/M |
3300006755|Ga0079222_11429984 | Not Available | 642 | Open in IMG/M |
3300006844|Ga0075428_101005153 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 883 | Open in IMG/M |
3300006844|Ga0075428_102710038 | Not Available | 505 | Open in IMG/M |
3300006845|Ga0075421_100510731 | Not Available | 1426 | Open in IMG/M |
3300006845|Ga0075421_101671393 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 690 | Open in IMG/M |
3300006852|Ga0075433_10195037 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1801 | Open in IMG/M |
3300006854|Ga0075425_100676597 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1185 | Open in IMG/M |
3300006871|Ga0075434_100373112 | Not Available | 1447 | Open in IMG/M |
3300006880|Ga0075429_100092841 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2632 | Open in IMG/M |
3300006903|Ga0075426_10926764 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 657 | Open in IMG/M |
3300006904|Ga0075424_101036270 | Not Available | 875 | Open in IMG/M |
3300006904|Ga0075424_102826401 | Not Available | 505 | Open in IMG/M |
3300006914|Ga0075436_100743986 | Not Available | 728 | Open in IMG/M |
3300007076|Ga0075435_100109635 | Not Available | 2295 | Open in IMG/M |
3300007076|Ga0075435_101301237 | Not Available | 637 | Open in IMG/M |
3300009092|Ga0105250_10608876 | Not Available | 507 | Open in IMG/M |
3300009094|Ga0111539_10077767 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 3904 | Open in IMG/M |
3300009094|Ga0111539_11178232 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 890 | Open in IMG/M |
3300009100|Ga0075418_10221659 | Not Available | 2013 | Open in IMG/M |
3300009100|Ga0075418_11767684 | Not Available | 672 | Open in IMG/M |
3300009147|Ga0114129_11849036 | Not Available | 733 | Open in IMG/M |
3300009156|Ga0111538_12889119 | Not Available | 601 | Open in IMG/M |
3300009162|Ga0075423_12144938 | Not Available | 606 | Open in IMG/M |
3300009551|Ga0105238_12720005 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 531 | Open in IMG/M |
3300010043|Ga0126380_10000601 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 12313 | Open in IMG/M |
3300010043|Ga0126380_10401045 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1019 | Open in IMG/M |
3300010046|Ga0126384_11917858 | Not Available | 565 | Open in IMG/M |
3300010047|Ga0126382_10427166 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 1043 | Open in IMG/M |
3300010047|Ga0126382_12351901 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 516 | Open in IMG/M |
3300010047|Ga0126382_12498303 | Not Available | 504 | Open in IMG/M |
3300010358|Ga0126370_10531934 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1000 | Open in IMG/M |
3300010358|Ga0126370_12062626 | Not Available | 559 | Open in IMG/M |
3300010359|Ga0126376_10029524 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3689 | Open in IMG/M |
3300010359|Ga0126376_11999191 | Not Available | 621 | Open in IMG/M |
3300010360|Ga0126372_10390061 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1266 | Open in IMG/M |
3300010360|Ga0126372_11140947 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 800 | Open in IMG/M |
3300010361|Ga0126378_10283782 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1756 | Open in IMG/M |
3300010362|Ga0126377_11437198 | Not Available | 763 | Open in IMG/M |
3300010371|Ga0134125_11167791 | Not Available | 842 | Open in IMG/M |
3300010376|Ga0126381_101247204 | Not Available | 1074 | Open in IMG/M |
3300010397|Ga0134124_12398511 | Not Available | 569 | Open in IMG/M |
3300010398|Ga0126383_11426903 | Not Available | 782 | Open in IMG/M |
3300010868|Ga0124844_1013459 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophobacteraceae → Syntrophobacter → Syntrophobacter fumaroxidans → Syntrophobacter fumaroxidans MPOB | 2129 | Open in IMG/M |
3300011119|Ga0105246_12482523 | Not Available | 510 | Open in IMG/M |
3300012493|Ga0157355_1004720 | All Organisms → cellular organisms → Bacteria | 877 | Open in IMG/M |
3300012948|Ga0126375_11639095 | Not Available | 555 | Open in IMG/M |
3300012948|Ga0126375_12071007 | Not Available | 505 | Open in IMG/M |
3300012961|Ga0164302_10075413 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1777 | Open in IMG/M |
3300012971|Ga0126369_12746651 | Not Available | 576 | Open in IMG/M |
3300012986|Ga0164304_10001119 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462 | 8681 | Open in IMG/M |
3300012987|Ga0164307_10070600 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2085 | Open in IMG/M |
3300012987|Ga0164307_10185077 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1405 | Open in IMG/M |
3300012988|Ga0164306_11430953 | Not Available | 589 | Open in IMG/M |
3300013105|Ga0157369_10138574 | All Organisms → cellular organisms → Bacteria | 2575 | Open in IMG/M |
3300013307|Ga0157372_12622132 | Not Available | 578 | Open in IMG/M |
3300015077|Ga0173483_10272756 | Not Available | 816 | Open in IMG/M |
3300021560|Ga0126371_10569770 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1281 | Open in IMG/M |
3300022756|Ga0222622_10199723 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1326 | Open in IMG/M |
3300023168|Ga0247748_1007346 | All Organisms → cellular organisms → Bacteria | 1414 | Open in IMG/M |
3300025922|Ga0207646_10985147 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Methylorubrum → Methylorubrum extorquens | 745 | Open in IMG/M |
3300025972|Ga0207668_11957098 | Not Available | 528 | Open in IMG/M |
3300026761|Ga0207495_102220 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Methylorubrum → Methylorubrum extorquens | 675 | Open in IMG/M |
3300026853|Ga0207443_1009705 | Not Available | 551 | Open in IMG/M |
3300027252|Ga0209973_1069669 | Not Available | 549 | Open in IMG/M |
3300027873|Ga0209814_10000727 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 11153 | Open in IMG/M |
3300027873|Ga0209814_10006532 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 4493 | Open in IMG/M |
3300027873|Ga0209814_10275480 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 731 | Open in IMG/M |
3300027873|Ga0209814_10459519 | Not Available | 562 | Open in IMG/M |
3300027880|Ga0209481_10210974 | Not Available | 972 | Open in IMG/M |
3300027880|Ga0209481_10744187 | Not Available | 510 | Open in IMG/M |
3300027907|Ga0207428_10214810 | Not Available | 1444 | Open in IMG/M |
3300027907|Ga0207428_10218435 | Not Available | 1430 | Open in IMG/M |
3300028807|Ga0307305_10082202 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1488 | Open in IMG/M |
3300028828|Ga0307312_10042504 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2690 | Open in IMG/M |
3300030916|Ga0075386_11634811 | Not Available | 566 | Open in IMG/M |
3300031093|Ga0308197_10406324 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 534 | Open in IMG/M |
3300031446|Ga0170820_16743143 | Not Available | 637 | Open in IMG/M |
3300031562|Ga0310886_10441347 | Not Available | 775 | Open in IMG/M |
3300031719|Ga0306917_10519603 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 935 | Open in IMG/M |
3300031720|Ga0307469_11934034 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 572 | Open in IMG/M |
3300031720|Ga0307469_12527195 | Not Available | 502 | Open in IMG/M |
3300031833|Ga0310917_10424399 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 904 | Open in IMG/M |
3300031847|Ga0310907_10533783 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 631 | Open in IMG/M |
3300031854|Ga0310904_10129960 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1434 | Open in IMG/M |
3300031879|Ga0306919_10037085 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3130 | Open in IMG/M |
3300031940|Ga0310901_10591717 | Not Available | 507 | Open in IMG/M |
3300032174|Ga0307470_10284992 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1112 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 25.95% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 16.03% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 15.27% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 6.87% |
Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 3.82% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 3.05% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 3.05% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.05% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 2.29% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.29% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.53% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 1.53% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.53% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.53% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.53% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.76% |
Unplanted Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Unplanted Soil | 0.76% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.76% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.76% |
Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.76% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.76% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.76% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.76% |
Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.76% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.76% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.76% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.76% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.76% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.76% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2228664021 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
3300000033 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
3300001431 | Amended soil microbial communities from Kansas Great Prairies, USA - BrdU F1.4TB clc assemly | Environmental | Open in IMG/M |
3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Host-Associated | Open in IMG/M |
3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 | Host-Associated | Open in IMG/M |
3300005294 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk Soil | Environmental | Open in IMG/M |
3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 | Environmental | Open in IMG/M |
3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Environmental | Open in IMG/M |
3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Host-Associated | Open in IMG/M |
3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Environmental | Open in IMG/M |
3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Host-Associated | Open in IMG/M |
3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Host-Associated | Open in IMG/M |
3300006049 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 | Host-Associated | Open in IMG/M |
3300006196 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 | Host-Associated | Open in IMG/M |
3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
3300006880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Host-Associated | Open in IMG/M |
3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Host-Associated | Open in IMG/M |
3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Host-Associated | Open in IMG/M |
3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
3300010868 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (PacBio error correction) | Environmental | Open in IMG/M |
3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Host-Associated | Open in IMG/M |
3300012493 | Unplanted soil (control) microbial communities from North Carolina - M.Soil.10.yng.090610 | Environmental | Open in IMG/M |
3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
3300012986 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG | Environmental | Open in IMG/M |
3300012987 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MG | Environmental | Open in IMG/M |
3300012988 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MG | Environmental | Open in IMG/M |
3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Host-Associated | Open in IMG/M |
3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
3300015077 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S178-409R-2 (version 2) | Environmental | Open in IMG/M |
3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
3300022756 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1 | Environmental | Open in IMG/M |
3300023168 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S064-202C-5 | Environmental | Open in IMG/M |
3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026761 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G08A5-11 (SPAdes) | Environmental | Open in IMG/M |
3300026853 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G05A5w-12 (SPAdes) | Environmental | Open in IMG/M |
3300027252 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) | Host-Associated | Open in IMG/M |
3300027873 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 (SPAdes) | Host-Associated | Open in IMG/M |
3300027880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 (SPAdes) | Host-Associated | Open in IMG/M |
3300027907 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) | Host-Associated | Open in IMG/M |
3300028807 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_186 | Environmental | Open in IMG/M |
3300028828 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202 | Environmental | Open in IMG/M |
3300030916 | Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - FA12 EcM (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300031093 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_198 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031446 | Fir Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031562 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D3 | Environmental | Open in IMG/M |
3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
3300031833 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178 | Environmental | Open in IMG/M |
3300031847 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D4 | Environmental | Open in IMG/M |
3300031854 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D1 | Environmental | Open in IMG/M |
3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
3300031940 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D2 | Environmental | Open in IMG/M |
3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
ICCgaii200_07010102 | 2228664021 | Soil | MRMPVLAYFLVVGTVLFGGLVLLSTQLESKPLPVSQRIGVPPPFKGPADEPQIPRQD |
ICChiseqgaiiDRAFT_07100743 | 3300000033 | Soil | MRMPVLAYFLVVGTVLFGGLVLLSTQLESKPLPVSQRIGVPPPFKGPADEPQIPRQD* |
F14TB_1010463751 | 3300001431 | Soil | MRMPVLAYFLVVGTVLFGGLVLLSTQLESKPLPVSQRIGVPP |
JGI25405J52794_100864702 | 3300003911 | Tabebuia Heterophylla Rhizosphere | MRMPILAYFLVVGVILFGGMQLVSGQLEAKPLPVSQRIGVPAPFKALPGDAVIR* |
Ga0062595_1003673652 | 3300004479 | Soil | MRMPVLTYFLVVGVALFGGMRLVSSQLEAKPLPVSQRVGVPAPFKAPPVDAATH* |
Ga0062594_1018553962 | 3300005093 | Soil | MPVLTYFLVVGVALFGGMRLVSSQLEAKPLPVSQRVGVPAPFKAPPVDAATH* |
Ga0065712_101088633 | 3300005290 | Miscanthus Rhizosphere | MRMPLLAYFLVMGIILFTGLVLVSGQLESKSLPVSQRIGVPP |
Ga0065705_103279323 | 3300005294 | Switchgrass Rhizosphere | MPILAYFLVVGVILFGGMQLVSSQLEAKPLPVSQRIGVPASFKAPPSDAATR* |
Ga0065705_106808392 | 3300005294 | Switchgrass Rhizosphere | MRMPILAYFLVVGVILFGGMQLVSGQLEAKPLPVSQRIGVPASFKAPPGDTVIR* |
Ga0065707_106165991 | 3300005295 | Switchgrass Rhizosphere | MPILAYFLVVGVILFGGMQLVSSQLEAKPLPVSQRIGVPASF |
Ga0066388_1001864612 | 3300005332 | Tropical Forest Soil | MRMPVLAYFLVVGVILFGGMHLVNNQLEAKPLPVSQRIGVPAPFKAPPEAPR* |
Ga0066388_1037599931 | 3300005332 | Tropical Forest Soil | MRMPVLAYFLVVGVILFGGMHLVNNQLEAKPLSVSQRIGVPAPFKTPPEATPYDFTQQLRRNE* |
Ga0066388_1045655202 | 3300005332 | Tropical Forest Soil | MRMPILTYFLVVGIVLFGGMRLVSSQLEAKPLPVSQKIGVPAPFKAPSEATH* |
Ga0066388_1048128831 | 3300005332 | Tropical Forest Soil | MRMPVLTYFLVVGVVLFGGMRLVSSQLEAKPLPVSQRVGVPAPFKAPSVDAATH* |
Ga0070691_104958551 | 3300005341 | Corn, Switchgrass And Miscanthus Rhizosphere | MRMPLLSYFLVAGTVLFGALILVGDKLEPKPLPVSQTVGVPAPFKAPPE |
Ga0070691_108196111 | 3300005341 | Corn, Switchgrass And Miscanthus Rhizosphere | MRMPVLSYFLVAGAALFGVLVLVGNMFEPKPLPVSQTVGVPAPFKAPPE |
Ga0070675_1005777692 | 3300005354 | Miscanthus Rhizosphere | MRMPVLTYFLVVGVALFGGMRLVSSQLEAKPLPVSQRVGVP |
Ga0070700_1000360704 | 3300005441 | Corn, Switchgrass And Miscanthus Rhizosphere | MRMPLLAYFLVMGIILFTGLVLVSGQLESKSLPVSQRIGVPPPFK |
Ga0068856_1015937272 | 3300005614 | Corn Rhizosphere | MRMPLLSYFLVAGTVLFGALILVGDKLEPKPLPVSQTVGVPAPFKAPP |
Ga0066905_1000520561 | 3300005713 | Tropical Forest Soil | PMRMPILAYFLVVGVILFGGMHLVNNQLEAKPLPVSQRIGVPAPFKAPPEATR* |
Ga0066905_1000842993 | 3300005713 | Tropical Forest Soil | MPILAYFLVVGVILFGGMQLVSSQPEAKPLPVSQRIGVPASFKAPLSDAATR* |
Ga0066905_1001674924 | 3300005713 | Tropical Forest Soil | MRMPILAYFLVVGVILFGGMQLVSGQLEAKPLPVSQRIGVPAPFKAPPGDAVVR* |
Ga0066905_1001879062 | 3300005713 | Tropical Forest Soil | MRMPIVTYFLVGGAMLFVGLVLVSSQLESNPVAVSQMVGVPAPFKAPPDEPGN* |
Ga0066905_1005975232 | 3300005713 | Tropical Forest Soil | MRMPILAYFLVVGVILFGGMQLLSSKLEAKPLPVSQRIGVPAPFKAPPGDAVIR* |
Ga0066905_1015328992 | 3300005713 | Tropical Forest Soil | MRMPILTYFLVVGTILFGGLVLVSSQLESKPLPVSQRIGLPAP |
Ga0066905_1020747252 | 3300005713 | Tropical Forest Soil | MPILAYFLVVGVVLFGGMRLVSSQLEAKPLPVSQSVGVPAPFKAPPV |
Ga0066903_1004041457 | 3300005764 | Tropical Forest Soil | PMRMPILTYFLVVGVILFGGIHLVNNQLEAKPLAVSQRIGVPAPFKAPPEATP* |
Ga0066903_1005449982 | 3300005764 | Tropical Forest Soil | MRMLVLAYFLVVGVILFGGMHLVNSQLEAKPLPVSQRIGVPAPFKAPPEAPGN* |
Ga0066903_1007233834 | 3300005764 | Tropical Forest Soil | MRMPILAYFLVVGLVLFGGMRLVSSQLEAKPLPVSQSLGVPAPFKPTG* |
Ga0066903_1009486733 | 3300005764 | Tropical Forest Soil | AMRMPILSYFLVAGAILFGGLVLVSSQLELKPLPVSQTIGVPQPFKAPPEAQNF* |
Ga0066903_1023262131 | 3300005764 | Tropical Forest Soil | MRMPILTYFLVVGVILFGGMHLVNNQLEAKPLPVSQRIGVPAPFKAPPE |
Ga0066903_1036503482 | 3300005764 | Tropical Forest Soil | MRMPVLAYFLVVGVILFGGMHLVNNQLEAKPLPVSQRIGVPAPF |
Ga0066903_1051493032 | 3300005764 | Tropical Forest Soil | MRMPILAYFLDVGAILFGGMHLVNNQLEAKPLPVSQRISVPAPFKAPPEATR* |
Ga0066903_1082328561 | 3300005764 | Tropical Forest Soil | MPVFTYFLVVGVVLFGGMRLVSNQLEAKPLPVSQRVGVPAPFKAPSVDTATH* |
Ga0066903_1089177671 | 3300005764 | Tropical Forest Soil | LVVGVVLFGGMRLVSSQLEAKPLPVSQRVGVPAPFKAPSVDAATH* |
Ga0081455_100037717 | 3300005937 | Tabebuia Heterophylla Rhizosphere | MRMPILTYFLVVGVILFGGMRLVSSQLEAKPLPVSQRIGVPAPFKAPPDATR* |
Ga0081455_102169583 | 3300005937 | Tabebuia Heterophylla Rhizosphere | MRMPILAYFLVVGVVLFGGMRLVSSQLEAKPLPVSQSVGVPAPFKAPPVDAATR* |
Ga0081455_103325432 | 3300005937 | Tabebuia Heterophylla Rhizosphere | MRMPILAYFLVVGVILFGGMHLVSSRLEAKPLPVSQRIGVPAPFKAPPVDTATR* |
Ga0081455_107856753 | 3300005937 | Tabebuia Heterophylla Rhizosphere | MRMPILAYFLVVGVILFGGMHLVSSQLEAKPLPVSQRIGVPAPFKALPEATR* |
Ga0075417_100405422 | 3300006049 | Populus Rhizosphere | MRVPILTYFLVVGVILFGGMQLVSSQLEAKPLPVSQRIGVPAPFKTPTNDAAVIR* |
Ga0075417_100582294 | 3300006049 | Populus Rhizosphere | MRMPVLAYFLVVGVILFGGMHLVSSQLEAKPLPVSQRIGVPAPFTAPLGDAVIR* |
Ga0075422_103097033 | 3300006196 | Populus Rhizosphere | MPVLAYFLVVGVILFGGMHLVSSQLEAKPLPVSQRIGVPAPFTAPLGDAVIR* |
Ga0075422_103378383 | 3300006196 | Populus Rhizosphere | MRMPLLAYFLVMGIILFTGLVFVSGQLESKSLPVSQRIGVPPPFK |
Ga0079222_114299841 | 3300006755 | Agricultural Soil | MRMPIFAYFLVMGITLFGGLILLSTQLESKPLAVSQRIGVPPPFKAAPD |
Ga0075428_1010051532 | 3300006844 | Populus Rhizosphere | MRVPILTYFLVVGVILFGGMQLVSSQLEAKPLPVSQRIGFPAPFKTPPNDAAVIR* |
Ga0075428_1027100381 | 3300006844 | Populus Rhizosphere | MRMPILAYFLVVGVILFGGMHVVSSQLEAKPLPVSQRIGVPAHFKALPEATR* |
Ga0075421_1005107311 | 3300006845 | Populus Rhizosphere | MRMPVLAYFLVVGTVLFGGLVLLSTQLESKPLPVSQRIGVPPPFKG |
Ga0075421_1016713933 | 3300006845 | Populus Rhizosphere | MRVPILTYFLVVGVILFGGMQLVSSQLEAKPLPVSQRIGVPAPFKTQQMMLL* |
Ga0075433_101950373 | 3300006852 | Populus Rhizosphere | MRVPILTYFLVVGVILFGGMQLVSSQLEAKPLPVSQRIGVPAPFKTPPNDAAVIR* |
Ga0075425_1006765971 | 3300006854 | Populus Rhizosphere | MPMPVLAYFLVMGMILFGGLALASGQLESKPLAVSQRIG |
Ga0075425_1013288782 | 3300006854 | Populus Rhizosphere | MRMPILSYFLVVGLVLFGGLVLVSSQLESKPLPVSQRIGLPTPFKALPE |
Ga0075434_1003731121 | 3300006871 | Populus Rhizosphere | MRMPLLSHFLVVGAVLFGGLILVSGQLASKPLPVSQRI |
Ga0075429_1000928411 | 3300006880 | Populus Rhizosphere | MRMPILTYFGVVGTVLFGGLVLVSSQLESKPLPVSQRVGVPPPLFW* |
Ga0075426_109267642 | 3300006903 | Populus Rhizosphere | DTRMRMPVLTYFLVVGVALFGGMRLVSSQLEAKPLPVSQRVGVPAPFKAPPVDAATH* |
Ga0075424_1010362703 | 3300006904 | Populus Rhizosphere | MRMPVLVYFLGMGMILFGGLALASGQLESKPLAVSQRI |
Ga0075424_1028264012 | 3300006904 | Populus Rhizosphere | MRMPLLFYFLVAGTVLFGALILVGDKLEPKPLPVSQTVGVPAPF |
Ga0075436_1007439861 | 3300006914 | Populus Rhizosphere | MPVLTYFPVVGVALFGGMRLVSSQLEAKPLPVSQRVGVPAPFKAPPVDAATH* |
Ga0075435_1001096351 | 3300007076 | Populus Rhizosphere | MRMPVLAYFLVVGTVLFGGLVLLSTQLESKPLPVSQRIGVPPPFKGPAD |
Ga0075435_1013012372 | 3300007076 | Populus Rhizosphere | MRMPILSYFLVIGAVVFGGLVLVSSQLESKPLPVSQRVGVP |
Ga0105250_106088762 | 3300009092 | Switchgrass Rhizosphere | MPLLAYFLVMGIILFTGLVLVSGQLESKSLPVSQRIGVPPPF |
Ga0111539_100777671 | 3300009094 | Populus Rhizosphere | MPILAYFLVVGVILFGGMQLVSGQLEAKPLPVSQRIGVPASFKAPPGDTVIR* |
Ga0111539_111782322 | 3300009094 | Populus Rhizosphere | MPILAYFLVVGVILFGGMHVVSSQLEAKPLPVSQRIGVPAHFKALPEATR* |
Ga0075418_102216596 | 3300009100 | Populus Rhizosphere | MPILSYFLVVGTVLFGGLVLVSSQLESKPLPVSQRVGVPP |
Ga0075418_117676842 | 3300009100 | Populus Rhizosphere | MRMPVLAYFLVVGTVLFGGLVLLSTQLESKPLPVSQR |
Ga0114129_118490361 | 3300009147 | Populus Rhizosphere | MPVLAYFLVVGVILFGGMHLVSSQLEAKPLPVSQRIGVPGPFTAPLADAVIR* |
Ga0111538_128891191 | 3300009156 | Populus Rhizosphere | MPIVSYFLVVGILLFGGLILVSSRLESKQLPVSQTIGLPAPFKAPPEDT |
Ga0075423_121449381 | 3300009162 | Populus Rhizosphere | MPILSYFLVIGAVVFGGLVLVSSQLESKPLPVSQRVGV |
Ga0105238_127200051 | 3300009551 | Corn Rhizosphere | MPVLVYFLGMGMILFGGLALASGQLESKPLAVSQRIGVPAPFNAPPD |
Ga0126380_100006018 | 3300010043 | Tropical Forest Soil | MPILAYFLVVGVVLFGGMRLVSSQLEAKPLPVSQSIGVPAPFKAPSDATR* |
Ga0126380_104010451 | 3300010043 | Tropical Forest Soil | LVEGLILEQIVMRMPVFAYFLVMGMILFGGLALASGQLESKPLAVSQRI |
Ga0126384_119178582 | 3300010046 | Tropical Forest Soil | MPILTYFLVVGVILFGGIHLVNNQLEAKPLAVSQRIGVPAPFKAPPEATR* |
Ga0126382_104271662 | 3300010047 | Tropical Forest Soil | MPILTYFLVVGVVLFGGMRLVSSQLEAKPLPVSQSVGVPAPFKAPPVDAATR* |
Ga0126382_123519011 | 3300010047 | Tropical Forest Soil | YFLVVGVVLFGGMRLVSSQLEAKPLPVSQSIGVPAPFKAPSDATR* |
Ga0126382_124983031 | 3300010047 | Tropical Forest Soil | MPILTYFLVVGVILFGGMRLVSSQLEAKPLPVSQKIGVPAPFKPPPDATR* |
Ga0126370_105319341 | 3300010358 | Tropical Forest Soil | MPILAYFLVVGVILFGGMHLVNNQLEAKPLPVSQRIGVPAPFKAPPEATR* |
Ga0126370_120626262 | 3300010358 | Tropical Forest Soil | MPVLTYFLVVGVVLFGGMRLVSSQLEAKPLPVSQRVGVPAPFKAPSVDAAAH* |
Ga0126376_100295245 | 3300010359 | Tropical Forest Soil | MRMPILAYFLVVGVILFGGMHLVNNQLEAKPLPVSQRIGVPAPFKAPPEAIR* |
Ga0126376_119991911 | 3300010359 | Tropical Forest Soil | MPILAYFLLVGVILFGGIHLVNNQLEAKPLAVSQRIGVPAPFKAPPEATR* |
Ga0126372_103900612 | 3300010360 | Tropical Forest Soil | MRMPILAYFLVVGVILFGGMHLVNNQLEAKPLPVSQRIGVPAPFKAPPEATR* |
Ga0126372_111409472 | 3300010360 | Tropical Forest Soil | MPVLTYFLVVGVVLFGGMRLVSSQLEAKPLPVSQRVGVPAPFKAPSVDAATH* |
Ga0126378_102837824 | 3300010361 | Tropical Forest Soil | MRMPILAYFLDVGAILFGGMHLVNNQLEAKPLPVSQRISVPAPFKTPPEAAR* |
Ga0126377_114371982 | 3300010362 | Tropical Forest Soil | MPILTYFLVVGVILFGGMRLVSSQLEAKPLPVSQKIGVPAPFNPSPDATR* |
Ga0134125_111677912 | 3300010371 | Terrestrial Soil | MRMPIFGYFVVVGAMLFGAIALVSSELESKPLPVSQTVGVPAPFK |
Ga0126381_1012472042 | 3300010376 | Tropical Forest Soil | MPVLTYFLVVGVVLFGGMRLVSSQLEAKPLPVSQRFGVPAPFKAPSFDAATH* |
Ga0134124_123985111 | 3300010397 | Terrestrial Soil | MPLLFYFLVAGTVLFGALILVGDKLEPKPLPVSQTVGVPAPF |
Ga0126383_114269031 | 3300010398 | Tropical Forest Soil | MPILSYFLVAGTILFGGLILLSSQLEIKPLPVSQTIGVPQPFKAPPEAQNF* |
Ga0124844_10134591 | 3300010868 | Tropical Forest Soil | MPILAYFLVVGVILFGGMHLVNNQLEAKPLPVSQRIGVPAPFK |
Ga0105246_124825232 | 3300011119 | Miscanthus Rhizosphere | MPLLAYFLVMGIILFTGLVLVSGQLESKSLPVSQRIGVPPPFKAQPDA |
Ga0157355_10047201 | 3300012493 | Unplanted Soil | MPLLAYFLVMGIILFTGLVFVSGQLESKSLPVSQRIGVP |
Ga0126375_116390951 | 3300012948 | Tropical Forest Soil | MAYFLVVGVVLFGGMRLVSSQLEAKPLPVSQSIGVPAPFKAPSDATR* |
Ga0126375_120710071 | 3300012948 | Tropical Forest Soil | MPILAYFLVVGVILFGGIHLVNNQLEAKPLAVSQRIGVPAPFKAPPEATP* |
Ga0164302_100754132 | 3300012961 | Soil | MPVLTYFLVVGVALFGGMRLVSSQLEAKPLTVSQRVGVPAPFKAPPVDAATH* |
Ga0126369_127466511 | 3300012971 | Tropical Forest Soil | MPILTYFLVVGVILFGGMHLVNNQLEAKPLAVSQRIGVPAPFKAPPEATP* |
Ga0164304_100011199 | 3300012986 | Soil | MPLLAYFLVMGIILFTGLVFVSGQLESKSLPVSQRIGVPPPF |
Ga0164307_100706001 | 3300012987 | Soil | MPLLFYFLVAGTVLFGALILVGDKLEPKPLPVSQTVGVPAPFKAPPEE |
Ga0164307_101850773 | 3300012987 | Soil | LVEGFSLEQIVMRMPVLAYFFVMGMILFGGLALASGQLESKPLAVSQRIGVPAPF |
Ga0164306_114309531 | 3300012988 | Soil | MRMPILSYFLAAGIILFGGLILVSSQLESKPLPVSQ |
Ga0157369_101385741 | 3300013105 | Corn Rhizosphere | MPLLAYFLVMGIILFTGLVFVSGQLESKSLPVSQRI |
Ga0157372_126221321 | 3300013307 | Corn Rhizosphere | MPLLAYFLVMGIILFTGLVLVSGQLESKSLPVSQRIGVPPPFKAQPDAN |
Ga0173483_102727563 | 3300015077 | Soil | MRMPIFGYFVVVGAMLFGAIALVSSELESKPLPVSQTVGVPAPFKA |
Ga0126371_105697701 | 3300021560 | Tropical Forest Soil | MRMPILAYFLVVGVILFGGMHLVNNQLEAKPLPVSQRIGVPAPFKAPPEATR |
Ga0222622_101997233 | 3300022756 | Groundwater Sediment | MPVLTYFLVVGVVLFGGMRLVSSQLEAKPLPVSQRVGVPAPFKAPPVDAATH |
Ga0247748_10073463 | 3300023168 | Soil | MRMPLLAYFLVMGIILFTGLVFVSGQLESKSLPVSQRIGVPPPFKAQ |
Ga0207646_109851473 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MRMPLLAYFLAMGIILFTGLVLVSSQLESKSLPVS |
Ga0207668_119570981 | 3300025972 | Switchgrass Rhizosphere | MRMPLLFYFLVAGTVLFGALILVGDKLEPKPLPVSQTVGVPAPFKAPP |
Ga0207495_1022201 | 3300026761 | Soil | MRMPLLAYFLAMGIILFTGLVLVSSQLESKSLPVSQRIGVPP |
Ga0207443_10097052 | 3300026853 | Soil | MRMPLLAYFLAMGIILFTGLVLVSSQLESKSLPVSQRIGVPPPFKAQP |
Ga0209973_10696692 | 3300027252 | Arabidopsis Thaliana Rhizosphere | MRMPLLAYFLVMGIILITGLVLVSSQLESKSLPVSQRIGVP |
Ga0209814_100007272 | 3300027873 | Populus Rhizosphere | MRMPVLAYFLVVGVILFGGMHLVSSQLEAKPLPVSQRIGVPAPFTAPLGDAVIR |
Ga0209814_100065329 | 3300027873 | Populus Rhizosphere | MRMPILAYFLVVGVILFGGMQLVSGQLEAKPLPVSQRIGVPASFKAPPGDTVIR |
Ga0209814_102754802 | 3300027873 | Populus Rhizosphere | MPILAYFLVVGVILFGGMQLVSSQLEAKPLPVSQRIGVPAPFKTPTNDAAVIR |
Ga0209814_104595191 | 3300027873 | Populus Rhizosphere | MRMPLLSHFLVVGAVLFGGLILVSSQLASKPLPVSQRIGVPPPFKAPPDQT |
Ga0209481_102109741 | 3300027880 | Populus Rhizosphere | MRMPVLAYFLVVGTVLFGGLVLLSTQLESKPLPVSQRIGAPPPFKGPADEPQIPRQD |
Ga0209481_107441871 | 3300027880 | Populus Rhizosphere | MRMPVLAYFLVVGTVLFGGLVLLSTQLESKPLPVSQRIGVPPPTLFWRC |
Ga0207428_102148102 | 3300027907 | Populus Rhizosphere | MRMPVLAYFLVVGTVLFGGLVLLSTQLESKPLPVSQRIGVPPPTLFWRCR |
Ga0207428_102184352 | 3300027907 | Populus Rhizosphere | RMPVLAYFLVVGTVLFGGLVLLSTQLESKPLPVSQRIGVPPPFKGPADEPQIPRQD |
Ga0307305_100822023 | 3300028807 | Soil | MPVLTYFLVVGVVLFGGMRLVSSQLEAKPLPVSQRIGVPAPFKAPPVDAATH |
Ga0307312_100425043 | 3300028828 | Soil | MRMPVLTYFLVVGVVLFGGMRLVSSQLEAKPLPVSQRVGVPAPFKAPPVDAATH |
Ga0075386_116348112 | 3300030916 | Soil | MRMPVLSYLLVAGTVLFGVLVLVGNKLEPKPLPVSQMVGVPAPFKAPPEDVREQAL |
Ga0308197_104063242 | 3300031093 | Soil | TQMRMPVLTYFLVVCVVLFGGMRLVSSQLEAKPLPVSQRIGVPAPFKAPPVDAATH |
Ga0170820_167431431 | 3300031446 | Forest Soil | MRMPILSYFLAAGIILFGGLILVSSQLESKPLPVSQRIGVPPPFKA |
Ga0310886_104413472 | 3300031562 | Soil | LVEGRILEQIVMRMPVLVYFLGMGMILFGGLALASGQLESKPLAVSQRIGVPAPFKAPPD |
Ga0306917_105196031 | 3300031719 | Soil | APNLEPPMRMPILAYFLVVGVILFGGMHLVNNQLEAKPLPVSQRIGVPAPFKAPPEATR |
Ga0307469_119340342 | 3300031720 | Hardwood Forest Soil | MRMPLLSYFLVAGTVLFGALVLVGNKLEPKPLPVSQA |
Ga0307469_125271951 | 3300031720 | Hardwood Forest Soil | MPILAYFLVVGVILFGGMQLVSSQLEAKPLPVSQRIGVPASFKAPPSDAATR |
Ga0310917_104243991 | 3300031833 | Soil | FLVVGVILFGGMHLVNNQLEAKPLPVSQRIGVPAPFKAPPEATR |
Ga0310907_105337831 | 3300031847 | Soil | MRMPLLAYFLAMGIILFTGLVLVSGQLESKSLPVSQ |
Ga0310904_101299603 | 3300031854 | Soil | MRMPVLVYFLGMGMILFGGLALASGQLESKPLAVSQRIGVPA |
Ga0306919_100370853 | 3300031879 | Soil | MPILAYFLVVGVILFGGMHLVNNQLEAKPLPVSQRIGVPAPFKAPPEATR |
Ga0310901_105917171 | 3300031940 | Soil | MPVLVYFLGMGMILFGGLALASGQLESKPLAVSQRIGVPTPFKVPPDAN |
Ga0307470_102849921 | 3300032174 | Hardwood Forest Soil | MRMPLLSYFLVAGTVLFGALVLVGNKLEPKPLPVSQTVG |
⦗Top⦘ |