Basic Information | |
---|---|
Family ID | F061933 |
Family Type | Metagenome |
Number of Sequences | 131 |
Average Sequence Length | 49 residues |
Representative Sequence | RQAVAAQLARGWNASQVRLPLEDTLKELSLRRRRAQIAARHALE |
Number of Associated Samples | 112 |
Number of Associated Scaffolds | 131 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | No |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 1.54 % |
% of genes near scaffold ends (potentially truncated) | 76.34 % |
% of genes from short scaffolds (< 2000 bps) | 87.02 % |
Associated GOLD sequencing projects | 105 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.47 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (91.603 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere (10.687 % of family members) |
Environment Ontology (ENVO) | Unclassified (41.221 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (54.198 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 41.67% β-sheet: 0.00% Coil/Unstructured: 58.33% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.47 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 131 Family Scaffolds |
---|---|---|
PF01878 | EVE | 9.16 |
PF00005 | ABC_tran | 4.58 |
PF08450 | SGL | 2.29 |
PF02441 | Flavoprotein | 2.29 |
PF13360 | PQQ_2 | 1.53 |
PF02687 | FtsX | 0.76 |
PF01258 | zf-dskA_traR | 0.76 |
PF13442 | Cytochrome_CBB3 | 0.76 |
PF00800 | PDT | 0.76 |
PF00326 | Peptidase_S9 | 0.76 |
PF07228 | SpoIIE | 0.76 |
PF03167 | UDG | 0.76 |
PF00903 | Glyoxalase | 0.76 |
COG ID | Name | Functional Category | % Frequency in 131 Family Scaffolds |
---|---|---|---|
COG1673 | Predicted RNA-binding protein, contains PUA-like EVE domain | General function prediction only [R] | 9.16 |
COG2947 | Predicted RNA-binding protein, contains EVE domain | General function prediction only [R] | 9.16 |
COG3386 | Sugar lactone lactonase YvrE | Carbohydrate transport and metabolism [G] | 2.29 |
COG3391 | DNA-binding beta-propeller fold protein YncE | General function prediction only [R] | 2.29 |
COG0077 | Prephenate dehydratase | Amino acid transport and metabolism [E] | 0.76 |
COG0692 | Uracil-DNA glycosylase | Replication, recombination and repair [L] | 0.76 |
COG1573 | Uracil-DNA glycosylase | Replication, recombination and repair [L] | 0.76 |
COG1734 | RNA polymerase-binding transcription factor DksA | Transcription [K] | 0.76 |
COG3663 | G:T/U-mismatch repair DNA glycosylase | Replication, recombination and repair [L] | 0.76 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 91.60 % |
Unclassified | root | N/A | 8.40 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300000363|ICChiseqgaiiFebDRAFT_10835320 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 900 | Open in IMG/M |
3300000881|JGI10215J12807_1047522 | All Organisms → cellular organisms → Bacteria | 722 | Open in IMG/M |
3300003319|soilL2_10139574 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Vicinamibacteria → Vicinamibacterales → Vicinamibacteraceae → Luteitalea → unclassified Luteitalea → Luteitalea sp. TBR-22 | 1800 | Open in IMG/M |
3300004157|Ga0062590_100492585 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1041 | Open in IMG/M |
3300004480|Ga0062592_100138531 | All Organisms → cellular organisms → Bacteria | 1603 | Open in IMG/M |
3300005332|Ga0066388_100969542 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1419 | Open in IMG/M |
3300005334|Ga0068869_101100700 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 695 | Open in IMG/M |
3300005335|Ga0070666_10712842 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 736 | Open in IMG/M |
3300005343|Ga0070687_100410847 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 890 | Open in IMG/M |
3300005344|Ga0070661_101287282 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 613 | Open in IMG/M |
3300005345|Ga0070692_10784147 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 649 | Open in IMG/M |
3300005353|Ga0070669_100240104 | All Organisms → cellular organisms → Bacteria | 1439 | Open in IMG/M |
3300005365|Ga0070688_101502961 | All Organisms → cellular organisms → Bacteria | 548 | Open in IMG/M |
3300005459|Ga0068867_101861471 | Not Available | 567 | Open in IMG/M |
3300005535|Ga0070684_100503896 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1121 | Open in IMG/M |
3300005535|Ga0070684_101777077 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 582 | Open in IMG/M |
3300005539|Ga0068853_100964327 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 820 | Open in IMG/M |
3300005543|Ga0070672_101648708 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 576 | Open in IMG/M |
3300005564|Ga0070664_101066986 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 760 | Open in IMG/M |
3300005564|Ga0070664_101782458 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 584 | Open in IMG/M |
3300005615|Ga0070702_100372196 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1013 | Open in IMG/M |
3300005615|Ga0070702_101584224 | All Organisms → cellular organisms → Bacteria | 541 | Open in IMG/M |
3300005616|Ga0068852_101417415 | All Organisms → cellular organisms → Bacteria | 717 | Open in IMG/M |
3300005719|Ga0068861_100265963 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1470 | Open in IMG/M |
3300005719|Ga0068861_100677065 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 956 | Open in IMG/M |
3300005843|Ga0068860_100310090 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1547 | Open in IMG/M |
3300006013|Ga0066382_10349375 | Not Available | 508 | Open in IMG/M |
3300006237|Ga0097621_100528185 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1072 | Open in IMG/M |
3300006876|Ga0079217_11112546 | Not Available | 591 | Open in IMG/M |
3300006881|Ga0068865_100071621 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis | 2459 | Open in IMG/M |
3300006954|Ga0079219_10137108 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1281 | Open in IMG/M |
3300006969|Ga0075419_10007079 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 7015 | Open in IMG/M |
3300007004|Ga0079218_10097112 | All Organisms → cellular organisms → Bacteria | 2012 | Open in IMG/M |
3300007004|Ga0079218_10594356 | All Organisms → cellular organisms → Bacteria | 1008 | Open in IMG/M |
3300007004|Ga0079218_11804286 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 685 | Open in IMG/M |
3300009011|Ga0105251_10233209 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 829 | Open in IMG/M |
3300009090|Ga0099827_10052210 | All Organisms → cellular organisms → Bacteria | 3079 | Open in IMG/M |
3300009094|Ga0111539_10048910 | All Organisms → cellular organisms → Bacteria | 5047 | Open in IMG/M |
3300009094|Ga0111539_10052864 | All Organisms → cellular organisms → Bacteria | 4835 | Open in IMG/M |
3300009094|Ga0111539_10278669 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1946 | Open in IMG/M |
3300009094|Ga0111539_12142999 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 649 | Open in IMG/M |
3300009094|Ga0111539_12206465 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 639 | Open in IMG/M |
3300009100|Ga0075418_10228913 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1979 | Open in IMG/M |
3300009100|Ga0075418_11684927 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 689 | Open in IMG/M |
3300009147|Ga0114129_10060982 | All Organisms → cellular organisms → Bacteria | 5273 | Open in IMG/M |
3300009147|Ga0114129_12973411 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 558 | Open in IMG/M |
3300009156|Ga0111538_10000103 | All Organisms → cellular organisms → Bacteria | 93278 | Open in IMG/M |
3300009156|Ga0111538_10155737 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae | 2902 | Open in IMG/M |
3300009162|Ga0075423_10233626 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1927 | Open in IMG/M |
3300009678|Ga0105252_10135104 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1017 | Open in IMG/M |
3300010304|Ga0134088_10199851 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 957 | Open in IMG/M |
3300010360|Ga0126372_10620382 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1041 | Open in IMG/M |
3300010362|Ga0126377_10040217 | All Organisms → cellular organisms → Bacteria | 4019 | Open in IMG/M |
3300010366|Ga0126379_11132348 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 889 | Open in IMG/M |
3300010373|Ga0134128_12060211 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 628 | Open in IMG/M |
3300010375|Ga0105239_13009619 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 549 | Open in IMG/M |
3300010399|Ga0134127_10009332 | All Organisms → cellular organisms → Bacteria | 7252 | Open in IMG/M |
3300010399|Ga0134127_10998406 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 897 | Open in IMG/M |
3300010401|Ga0134121_10525855 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1094 | Open in IMG/M |
3300011410|Ga0137440_1040042 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 875 | Open in IMG/M |
3300011436|Ga0137458_1185268 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 631 | Open in IMG/M |
3300012159|Ga0137344_1011465 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1333 | Open in IMG/M |
3300012160|Ga0137349_1066658 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 653 | Open in IMG/M |
3300012163|Ga0137355_1109529 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 530 | Open in IMG/M |
3300012212|Ga0150985_113025716 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 600 | Open in IMG/M |
3300012349|Ga0137387_10560368 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 829 | Open in IMG/M |
3300012902|Ga0157291_10413935 | All Organisms → cellular organisms → Bacteria | 503 | Open in IMG/M |
3300012944|Ga0137410_10771515 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 805 | Open in IMG/M |
3300012948|Ga0126375_11534330 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 571 | Open in IMG/M |
3300012957|Ga0164303_10479493 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 791 | Open in IMG/M |
3300012958|Ga0164299_10887818 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 645 | Open in IMG/M |
3300012971|Ga0126369_13616361 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 506 | Open in IMG/M |
3300013296|Ga0157374_12019720 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 603 | Open in IMG/M |
3300014326|Ga0157380_11783966 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 674 | Open in IMG/M |
3300014326|Ga0157380_13463505 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 505 | Open in IMG/M |
3300014745|Ga0157377_10016526 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae | 3797 | Open in IMG/M |
3300014745|Ga0157377_10038813 | All Organisms → cellular organisms → Bacteria | 2631 | Open in IMG/M |
3300015358|Ga0134089_10073681 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1277 | Open in IMG/M |
3300015371|Ga0132258_13109976 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1147 | Open in IMG/M |
3300015372|Ga0132256_100698893 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1130 | Open in IMG/M |
3300015373|Ga0132257_101061750 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1021 | Open in IMG/M |
3300015374|Ga0132255_102780731 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 748 | Open in IMG/M |
3300017965|Ga0190266_10072012 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1317 | Open in IMG/M |
3300018083|Ga0184628_10114022 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1395 | Open in IMG/M |
3300018432|Ga0190275_12747134 | Not Available | 569 | Open in IMG/M |
3300018476|Ga0190274_13078167 | Not Available | 560 | Open in IMG/M |
3300019362|Ga0173479_10081317 | All Organisms → cellular organisms → Bacteria | 1152 | Open in IMG/M |
3300022886|Ga0247746_1031697 | All Organisms → cellular organisms → Bacteria | 1180 | Open in IMG/M |
3300023102|Ga0247754_1056184 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 918 | Open in IMG/M |
3300025893|Ga0207682_10001517 | All Organisms → cellular organisms → Bacteria | 10703 | Open in IMG/M |
3300025917|Ga0207660_10174554 | All Organisms → cellular organisms → Bacteria | 1666 | Open in IMG/M |
3300025920|Ga0207649_11478465 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 538 | Open in IMG/M |
3300025923|Ga0207681_11236247 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 627 | Open in IMG/M |
3300025926|Ga0207659_11573672 | Not Available | 561 | Open in IMG/M |
3300025932|Ga0207690_10149644 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1729 | Open in IMG/M |
3300025933|Ga0207706_10727930 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 846 | Open in IMG/M |
3300025936|Ga0207670_11887403 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 508 | Open in IMG/M |
3300025940|Ga0207691_10141022 | All Organisms → cellular organisms → Bacteria | 2124 | Open in IMG/M |
3300025945|Ga0207679_11201568 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 696 | Open in IMG/M |
3300025945|Ga0207679_12179096 | Not Available | 503 | Open in IMG/M |
3300025960|Ga0207651_10224996 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1519 | Open in IMG/M |
3300025960|Ga0207651_11423321 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 624 | Open in IMG/M |
3300025961|Ga0207712_11991065 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 520 | Open in IMG/M |
3300026023|Ga0207677_10942950 | All Organisms → cellular organisms → Bacteria | 780 | Open in IMG/M |
3300026023|Ga0207677_11300974 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 668 | Open in IMG/M |
3300026041|Ga0207639_11964533 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 546 | Open in IMG/M |
3300027907|Ga0207428_10297033 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1196 | Open in IMG/M |
(restricted) 3300031248|Ga0255312_1203370 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 501 | Open in IMG/M |
3300031366|Ga0307506_10417679 | Not Available | 553 | Open in IMG/M |
3300031538|Ga0310888_10776584 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 592 | Open in IMG/M |
3300031547|Ga0310887_10527025 | All Organisms → cellular organisms → Bacteria | 715 | Open in IMG/M |
3300031720|Ga0307469_10367349 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1215 | Open in IMG/M |
3300031731|Ga0307405_10143565 | All Organisms → cellular organisms → Bacteria | 1668 | Open in IMG/M |
3300031740|Ga0307468_101384139 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 645 | Open in IMG/M |
3300031811|Ga0310125_10529539 | All Organisms → cellular organisms → Bacteria | 558 | Open in IMG/M |
3300031854|Ga0310904_10150422 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1351 | Open in IMG/M |
3300031938|Ga0308175_101548341 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 741 | Open in IMG/M |
3300031940|Ga0310901_10120721 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 972 | Open in IMG/M |
3300031943|Ga0310885_10919653 | Not Available | 502 | Open in IMG/M |
3300032002|Ga0307416_102273742 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 643 | Open in IMG/M |
3300032122|Ga0310895_10258516 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 807 | Open in IMG/M |
3300032126|Ga0307415_101684748 | All Organisms → cellular organisms → Bacteria | 611 | Open in IMG/M |
3300032144|Ga0315910_10790608 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 738 | Open in IMG/M |
3300032179|Ga0310889_10330258 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 743 | Open in IMG/M |
3300032180|Ga0307471_100616870 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1245 | Open in IMG/M |
3300032211|Ga0310896_10949117 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 500 | Open in IMG/M |
3300033485|Ga0316626_10913368 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 775 | Open in IMG/M |
3300033551|Ga0247830_10038031 | All Organisms → cellular organisms → Bacteria | 3056 | Open in IMG/M |
3300034147|Ga0364925_0059123 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1314 | Open in IMG/M |
3300034280|Ga0334997_0700703 | Not Available | 617 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 10.69% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 7.63% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 6.87% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 6.11% |
Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 4.58% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 3.82% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 3.82% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 3.82% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 3.82% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 3.05% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 3.05% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 2.29% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.29% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.29% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 2.29% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 2.29% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 2.29% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 2.29% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 2.29% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 2.29% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 2.29% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.53% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.53% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.53% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 1.53% |
Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 1.53% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.53% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.53% |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 0.76% |
Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 0.76% |
Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 0.76% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.76% |
Sugarcane Root And Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil | 0.76% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.76% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.76% |
Sandy Soil | Environmental → Terrestrial → Soil → Sand → Unclassified → Sandy Soil | 0.76% |
Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.76% |
Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.76% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.76% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.76% |
Visualization |
---|
Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300000363 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
3300000881 | Soil microbial communities from Great Prairies - Wisconsin Restored Prairie soil | Environmental | Open in IMG/M |
3300003319 | Sugarcane bulk soil Sample L2 | Environmental | Open in IMG/M |
3300004157 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2 | Environmental | Open in IMG/M |
3300004480 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4 | Environmental | Open in IMG/M |
3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Host-Associated | Open in IMG/M |
3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Host-Associated | Open in IMG/M |
3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Environmental | Open in IMG/M |
3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Host-Associated | Open in IMG/M |
3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Environmental | Open in IMG/M |
3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Host-Associated | Open in IMG/M |
3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Environmental | Open in IMG/M |
3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Host-Associated | Open in IMG/M |
3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Environmental | Open in IMG/M |
3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Host-Associated | Open in IMG/M |
3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Host-Associated | Open in IMG/M |
3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Host-Associated | Open in IMG/M |
3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Environmental | Open in IMG/M |
3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Host-Associated | Open in IMG/M |
3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
3300006013 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S23_td_NADW_ad_2500m_LV_B | Environmental | Open in IMG/M |
3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) | Host-Associated | Open in IMG/M |
3300006876 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS200 | Environmental | Open in IMG/M |
3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Host-Associated | Open in IMG/M |
3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
3300006969 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 | Host-Associated | Open in IMG/M |
3300007004 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost | Environmental | Open in IMG/M |
3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Host-Associated | Open in IMG/M |
3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
3300009678 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT100 | Environmental | Open in IMG/M |
3300010304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09182015 | Environmental | Open in IMG/M |
3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
3300011410 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT222_2 | Environmental | Open in IMG/M |
3300011436 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT642_2 | Environmental | Open in IMG/M |
3300012159 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT500_2 | Environmental | Open in IMG/M |
3300012160 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT630_2 | Environmental | Open in IMG/M |
3300012163 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT800_2 | Environmental | Open in IMG/M |
3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
3300012902 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S169-409C-1 | Environmental | Open in IMG/M |
3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
3300012958 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG | Environmental | Open in IMG/M |
3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Host-Associated | Open in IMG/M |
3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Host-Associated | Open in IMG/M |
3300015358 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
3300017965 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 220 T | Environmental | Open in IMG/M |
3300018083 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_b1 | Environmental | Open in IMG/M |
3300018432 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 550 T | Environmental | Open in IMG/M |
3300018476 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T | Environmental | Open in IMG/M |
3300019362 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S104-311B-1 (version 2) | Environmental | Open in IMG/M |
3300022886 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S079-202R-5 | Environmental | Open in IMG/M |
3300023102 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S184-509B-5 | Environmental | Open in IMG/M |
3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) | Environmental | Open in IMG/M |
3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) | Environmental | Open in IMG/M |
3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300027907 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) | Host-Associated | Open in IMG/M |
3300031248 (restricted) | Sandy soil microbial communities from University of British Columbia, Vancouver, Canada - EtOH5_T0_E5 | Environmental | Open in IMG/M |
3300031366 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 25_S | Environmental | Open in IMG/M |
3300031538 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D1 | Environmental | Open in IMG/M |
3300031547 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D4 | Environmental | Open in IMG/M |
3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Host-Associated | Open in IMG/M |
3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
3300031811 | Marine microbial communities from Western Arctic Ocean, Canada - CB11b_Tmax_Bot8 | Environmental | Open in IMG/M |
3300031854 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D1 | Environmental | Open in IMG/M |
3300031938 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1 | Environmental | Open in IMG/M |
3300031940 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D2 | Environmental | Open in IMG/M |
3300031943 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D2 | Environmental | Open in IMG/M |
3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Host-Associated | Open in IMG/M |
3300032122 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D4 | Environmental | Open in IMG/M |
3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Host-Associated | Open in IMG/M |
3300032144 | Garden soil microbial communities collected in Santa Monica, California, United States - Edamame soil | Environmental | Open in IMG/M |
3300032179 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D2 | Environmental | Open in IMG/M |
3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
3300032211 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D1 | Environmental | Open in IMG/M |
3300033485 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_T1_C1_D5_A | Environmental | Open in IMG/M |
3300033551 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day5 | Environmental | Open in IMG/M |
3300034115 | Sediment microbial communities from East River floodplain, Colorado, United States - 29_s17 | Environmental | Open in IMG/M |
3300034147 | Sediment microbial communities from East River floodplain, Colorado, United States - 44_j17 | Environmental | Open in IMG/M |
3300034280 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME10Aug2009-rr0048 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Protein ID | Sample Taxon ID | Habitat | Sequence |
ICChiseqgaiiFebDRAFT_108353202 | 3300000363 | Soil | MEMDKRRIDAAQLARGWNATQAELPLASRLETLARRRGRAQIAARRALELR* |
JGI10215J12807_10475221 | 3300000881 | Soil | LTRRQAVKARLARGWNAEQVSLPLEETLKQITHRRRQAQIAARHALGL* |
soilL2_101395741 | 3300003319 | Sugarcane Root And Bulk Soil | KWQFRLRRVPAAQLARGWNATQTELPLAATLETLARRRGRAQIAARRALNLG* |
Ga0062590_1004925851 | 3300004157 | Soil | MEISWRQDVAARLARGWNAQQAQLPLEATLSALTRRRRRAQIAARHALGL* |
Ga0062592_1001385313 | 3300004480 | Soil | VELTRRQAVRDRLARGWNGQQVSLPLEETLKTLTQRRRRAQIAARHALGL* |
Ga0066388_1009695421 | 3300005332 | Tropical Forest Soil | MDRRRIVAAQLARGWNATQKELPLADRLETFARRRGRAQIAARRALDLR* |
Ga0068869_1011007002 | 3300005334 | Miscanthus Rhizosphere | MEINHRQEVAARLARGWNAQQVSLPLEDTLNALTKRRRRAQIAARHALERA* |
Ga0070666_107128422 | 3300005335 | Switchgrass Rhizosphere | EMDRRRVVAAQLARGWNATQTELPLATKLETLARRRGRAQIAARRALGVR* |
Ga0070687_1004108471 | 3300005343 | Switchgrass Rhizosphere | RMEMDRRRAAAEMLARGWNATQADLPLAERIEETHRRRRRAQIAARHAIGLR* |
Ga0070661_1012872821 | 3300005344 | Corn Rhizosphere | DRRRVVAAQLARGWNATQTELPLATKLETLARRRGRAQIAARRALGVR* |
Ga0070692_107841471 | 3300005345 | Corn, Switchgrass And Miscanthus Rhizosphere | AQLARGWNATQTELPLATKLETLARRRGRAQIAARRALELR* |
Ga0070669_1002401041 | 3300005353 | Switchgrass Rhizosphere | RRQAVQARLARGWNARQVSLPLEDTLKQLTHRRRQAQIAARHALGL* |
Ga0070688_1015029611 | 3300005365 | Switchgrass Rhizosphere | SCFRVEITRRQAVQARLARGWNARQVSLPLEDTLKQLTHRRRQAQIAARHALGL* |
Ga0068867_1018614711 | 3300005459 | Miscanthus Rhizosphere | WRQDVAARMARGWNAEQTQLPLEATLSALTRRRRRAQIAARHALGEL* |
Ga0070684_1005038961 | 3300005535 | Corn Rhizosphere | MEMDRRRAAAEQLARGWNATQADLPLAGRLEDAGRRRRRAQIAARHALGVR* |
Ga0070684_1017770772 | 3300005535 | Corn Rhizosphere | LCFECFRMEIERRQTVSAQLARGWNANQEDLPLADTKYDELRRRRGRAQIAARRALALR* |
Ga0068853_1009643271 | 3300005539 | Corn Rhizosphere | QLARGWNATQKELPLADKLETFARRRGRAQIAARRALDLR* |
Ga0070672_1016487082 | 3300005543 | Miscanthus Rhizosphere | QLARGWNATQTELPLATKLETLARRRGRAQIAARRALELR* |
Ga0070664_1010669861 | 3300005564 | Corn Rhizosphere | RARGWNAVQAELPLEDKLRELARRRGRAQIAARKAIGA* |
Ga0070664_1017824582 | 3300005564 | Corn Rhizosphere | RAAAEMLARGWNATQADLPLAERIEETHRRRRRAQIAARHAIGLR* |
Ga0070702_1003721962 | 3300005615 | Corn, Switchgrass And Miscanthus Rhizosphere | MEMDRRRIVAAQLARGWNATQKELPLADKLETFARRRGRAQIAARRALDLR* |
Ga0070702_1015842241 | 3300005615 | Corn, Switchgrass And Miscanthus Rhizosphere | FRVELTRRQAVKDRLARGWNAQQVSLPLEETLKQLTHRRRQAQIAARRALGL* |
Ga0068852_1014174151 | 3300005616 | Corn Rhizosphere | TRRQAVRERLARGWNGQQVSLPLEETLKTLTQRRRRAQIAARHALGL* |
Ga0068861_1002659631 | 3300005719 | Switchgrass Rhizosphere | MEIARRQAVAAQLARGWNASQVRLPLEDTLKELSLRRRRAQIAARHALEQS* |
Ga0068861_1006770651 | 3300005719 | Switchgrass Rhizosphere | AAAAQLARGWNATQASLPLVGKLDALRRRRRRAQIAARHALELR* |
Ga0068860_1003100902 | 3300005843 | Switchgrass Rhizosphere | RMEMDRRRIVAAQLARGWNATQTELPLATKLETLARRRGRAQIAARRALGVR* |
Ga0066382_103493752 | 3300006013 | Marine | NCFRMELDRRRAVTAQLARGWNAFQVRLPLTATIEATARRRRFAQIAARKALDA* |
Ga0097621_1005281852 | 3300006237 | Miscanthus Rhizosphere | IEIDRRRRAAEQLARGWNAAQVGLPLEDTLNELSRRRRRAQIAARHALELA* |
Ga0079217_111125462 | 3300006876 | Agricultural Soil | DRRRRAAEQLARGWNAAQVGLPLEDTLNELTRRRRRAQIAARHALGV* |
Ga0068865_1000716214 | 3300006881 | Miscanthus Rhizosphere | WNATQKELPLADKLETFARRRGRAQIAARRALDLR* |
Ga0079219_101371082 | 3300006954 | Agricultural Soil | EINRRQSVAERLARGWNAHQVHLPLEETLNELTRRRRRAQIAARHALERAV* |
Ga0075419_100070799 | 3300006969 | Populus Rhizosphere | MEINYRQAVAARHARGWNAQQVRLPLEDTLNALTKRRRRAQIAARRALE |
Ga0079218_100971124 | 3300007004 | Agricultural Soil | FRVELGRRQAVTAQLARGWDARQENLPLEETLNTLTRRRRRAQIAARHALGL* |
Ga0079218_105943563 | 3300007004 | Agricultural Soil | SCFRVELTRRQAVKARLARGWNAEQTPLPLEETLKELTHRRRRAQIAARHAVGI* |
Ga0079218_118042862 | 3300007004 | Agricultural Soil | RGWNAVQESLPLDDKLRELRRRRGRAQIAARRAIGA* |
Ga0105251_102332092 | 3300009011 | Switchgrass Rhizosphere | MEMDRRRIVAAQLARGWNATQKELPLADKLETFARRRGRAQIAARHALDLR* |
Ga0099827_100522103 | 3300009090 | Vadose Zone Soil | MEINRRQTIADRLARGWNATQTDLPLAETLHELSLRRRRAQIAARRAIGTDAGA* |
Ga0111539_100489105 | 3300009094 | Populus Rhizosphere | MEIARRQAVAAQLARGWNASQVRLPLDDTLKELSLRRRRAQIAARHALEQS* |
Ga0111539_100528642 | 3300009094 | Populus Rhizosphere | MEMDRRRVVAAQLARGWNATQTELPLATKLETLARRRGRAQIAARRALGVR* |
Ga0111539_102786692 | 3300009094 | Populus Rhizosphere | MEMDRRRIVAAQLARGWNATQTELPLATKLETLARRRGRAQIAARRALDLR* |
Ga0111539_121429991 | 3300009094 | Populus Rhizosphere | MEMDRRRIVAAQLARGWNATQTELPLATKLETLARRRGRAQIAARRALELR* |
Ga0111539_122064652 | 3300009094 | Populus Rhizosphere | MEMDRRRIVAAQLARGWNATQTELPLAATLETLARRRGRAQIAARRALDLR* |
Ga0075418_102289131 | 3300009100 | Populus Rhizosphere | MEVTWRQDVAARLARGWNAQQAQLPLEARLNALTRRRRRAQIAARHALDEKQ* |
Ga0075418_116849271 | 3300009100 | Populus Rhizosphere | VELSRREAVKARLARGWNAQQTALPLEETLKELTHRRRRAQI |
Ga0114129_100609826 | 3300009147 | Populus Rhizosphere | MEINYRQAVAARHARGWNAQQVRLPLEDTLNALTKRRRRAQIAARRALESA* |
Ga0114129_129734112 | 3300009147 | Populus Rhizosphere | AVAAQLARGWNAFQVRLPLAETLKELSLRRRRAQIAARHMLERP* |
Ga0111538_100001032 | 3300009156 | Populus Rhizosphere | MEIARRQSVAAQLARGWNASQVRLPLDDTLKELSLRRRRAQIAARHALEQS* |
Ga0111538_101557374 | 3300009156 | Populus Rhizosphere | RQAVAAQLARGWNASQVRLPLEDTLKELSLRRRRAQIAARHALE* |
Ga0075423_102336261 | 3300009162 | Populus Rhizosphere | MEINYRHAVAARHARGWNAQQVRLPLEDTLNALTKRRRRAQIAARRALESA* |
Ga0105252_101351041 | 3300009678 | Soil | MEITWRQDVAARMARGWNAEQAQLPLEATLSALTRRRRRAQIAARHALGDL* |
Ga0134088_101998512 | 3300010304 | Grasslands Soil | MEINRRQAIAAQLARGWNATQTELPLAETLNELSLRRRRAQIAARRAIGTDAGA* |
Ga0126372_106203821 | 3300010360 | Tropical Forest Soil | MEMDRRRIVAAQLARGWNATQKELPLADKLDTFARRRGRAQIAARRALE |
Ga0126377_100402174 | 3300010362 | Tropical Forest Soil | MEMNRRRIVAAQLARGWNATQKELPLADKLESFARRRGRAQIAARRALDLR* |
Ga0126379_111323482 | 3300010366 | Tropical Forest Soil | MEMDRRRVVAAQLARGWNATQAKLPLPDRLETLARRRGRAQIAARHALNLR* |
Ga0134128_120602112 | 3300010373 | Terrestrial Soil | AETGWTQATVQAVAAQLARGWNASQVRLPLEDTLKELSLRRRRAQIAARHALEQS* |
Ga0105239_130096191 | 3300010375 | Corn Rhizosphere | MEMDRRRVVAAQLARGWNATQTELPLATKLETLARRRGRAQI |
Ga0134127_100093325 | 3300010399 | Terrestrial Soil | MEMDRRRIVAAQLARGWNATQTELPLAARLETLARRRGRAQIAARRALNLR* |
Ga0134127_109984061 | 3300010399 | Terrestrial Soil | RQAVAALLARGWNASQVRLPLDDTLKELSLRRRRAQIAARHALEQS* |
Ga0134121_105258552 | 3300010401 | Terrestrial Soil | MEMDRRRVVAAQLARGWNATQAKLPLADRLETLARRRGRAQIAARHALNLR* |
Ga0137440_10400422 | 3300011410 | Soil | FRMEIDRRQAAAAQLARGWNATQASLPLAGKLDALSRLRRRAQIAARHALELR* |
Ga0137458_11852682 | 3300011436 | Soil | FGEELERRRQLVAARLASGWNARQVPLPLEDRLRTLSLRRRRSQIAARKALGL* |
Ga0137344_10114652 | 3300012159 | Soil | IDRRQAAAAQRAKGWNATQASLPLAGKLDALSRRRRRAQIAARHALELR* |
Ga0137349_10666582 | 3300012160 | Soil | MEIDRRQATAAQLAKGWNATQASLPLAGKLDALSRRRRRAQIAARHALELR* |
Ga0137355_11095291 | 3300012163 | Soil | RSEIERREATAAQLAKGWNATQASLPLAGKLDALSRRRRRAQIAARHALELR* |
Ga0150985_1130257161 | 3300012212 | Avena Fatua Rhizosphere | QSAEQQKARGWNAVQAELPLEDKLQELTLRRRRAQIAARRAVGA* |
Ga0137387_105603681 | 3300012349 | Vadose Zone Soil | MDRRRAVAEQLARGWNAKQTELPLAGTLDALTRRRRRAQIAARHALGA* |
Ga0157291_104139351 | 3300012902 | Soil | LARGWNATQTELPLATRLETLARRRGRAQIAARRALDLR* |
Ga0137410_107715151 | 3300012944 | Vadose Zone Soil | MEINRRQTIADRLARGWNATQTDLPLAETLHELSLRRRRAQIAARRAI |
Ga0126375_115343301 | 3300012948 | Tropical Forest Soil | MEMDRRRVVAAQLARGWNATQTELPLADKLERFARRRGRAQI |
Ga0164303_104794931 | 3300012957 | Soil | MEMDRRRVVAAQLARGWNATQAKLPLPDRLQTLARRRGRAQIAARH |
Ga0164299_108878181 | 3300012958 | Soil | RRRVVAAQLARGWNATQAKLPLPDRLETLARRRGRAQIAARHALNLR* |
Ga0126369_136163612 | 3300012971 | Tropical Forest Soil | VAAQLARGWNATQAELPLPNRLDALARRRGRAQIAARRALDLR* |
Ga0157374_120197202 | 3300013296 | Miscanthus Rhizosphere | FRMELTHRQAISARLARGWNASQASLPLEDTLNELTRRRRRAQIAARKALGL* |
Ga0157380_117839662 | 3300014326 | Switchgrass Rhizosphere | RMEMDRRRIVAAQLARGWNATQTELPLATKLETLARRRGRAQIAARRALELR* |
Ga0157380_134635052 | 3300014326 | Switchgrass Rhizosphere | GWNAVQTSLPLEDRLDELRRRRGRAQIAARKAIGA* |
Ga0157377_100165265 | 3300014745 | Miscanthus Rhizosphere | FDCFRMEMDRRRIVAAQLARGWNATQKELPLADKLETFARRRGRAQIAARRALDLR* |
Ga0157377_100388134 | 3300014745 | Miscanthus Rhizosphere | VELTRRQAVRERLARGWNGQQVSLPLEETLKTLTQRRRRAQIAARHALGL* |
Ga0134089_100736812 | 3300015358 | Grasslands Soil | MEINRRQAIAAQLARGWNATQTELPLAETLDELSLRRRRAQIAARRAIGTDAGA* |
Ga0132258_131099762 | 3300015371 | Arabidopsis Rhizosphere | MDRRRIVAAQLSRGWNATQAELPLAARLETLARRRGRAQIAARQALGLR* |
Ga0132256_1006988932 | 3300015372 | Arabidopsis Rhizosphere | DRRRIVAAQLARGWNATQKELPLADKLEAFARRRGRAQIAARRALDLR* |
Ga0132257_1010617501 | 3300015373 | Arabidopsis Rhizosphere | RRAAAEMLARGWNATQADLPLAERIEETHRRRRRAQIAARHAIGLR* |
Ga0132255_1027807311 | 3300015374 | Arabidopsis Rhizosphere | LAHRQAVASRLARGWNASQASLPLEDTLNELTRRRRRAQIAARKALNLG* |
Ga0190266_100720121 | 3300017965 | Soil | DRRRLAAEQLARGWNAAQVGLPLEDTLNELSRRRRRAQIAARHALDAAGGNVAGGL |
Ga0184628_101140221 | 3300018083 | Groundwater Sediment | TWRQDVAARMARGWNAEQAQLPLEATLSALARRRRRAQIAARHALGDL |
Ga0190275_127471341 | 3300018432 | Soil | RVEIGRRQAVAAQLARGWNAEQARLPLEDTLEQLSLRRRRAQIAARHALGI |
Ga0190274_130781672 | 3300018476 | Soil | LCFECFRVEVTRRQLVRERMARGWNAQQVGLPLQETLRTLDTRRRRAQIAARHALEAEAW |
Ga0173479_100813173 | 3300019362 | Soil | VELTRRQAVRDRLARGWNGQQVSLPLEETLKALTQRRRRAQIAARHALGL |
Ga0247746_10316972 | 3300022886 | Soil | VELTRRQAVRDRLARGWNGQQVSLPLEETLKTLTQRRRRAQIAARHALGL |
Ga0247754_10561842 | 3300023102 | Soil | EIARRQAVAALLARGWNASQVRLPLDDTLKELSLRRRRAQIAARHALERS |
Ga0207682_100015178 | 3300025893 | Miscanthus Rhizosphere | MEISWRQDVAARLARGWNAQQAQLPLEATLSALTRRRRRAQIAARHALGL |
Ga0207660_101745543 | 3300025917 | Corn Rhizosphere | AVKARLARGWNAEQVSLPLEETLKQITHRRRQAQIAARHALGL |
Ga0207649_114784652 | 3300025920 | Corn Rhizosphere | AQLARGWNATQTELPLATKLETLAGRRGRAHIAARRALGVR |
Ga0207681_112362472 | 3300025923 | Switchgrass Rhizosphere | MEITWRQDVAARMARGWNAEQAQLPLEATLSALTRRRRRAQIAARHALGDL |
Ga0207659_115736722 | 3300025926 | Miscanthus Rhizosphere | RRRAAEQLARGWNAAQVGLPLEDTLHELSLRRRRAQIAARHALELS |
Ga0207690_101496443 | 3300025932 | Corn Rhizosphere | RQDVAARLARGWNAQQAQLPLEATLSALTRRRRRAQIAARHALGL |
Ga0207706_107279302 | 3300025933 | Corn Rhizosphere | SGWRRAWFDRRRRVAQQLAKGWNASQVGLPLDDTLNELSLRRRRAQIAARHALGLT |
Ga0207670_118874031 | 3300025936 | Switchgrass Rhizosphere | FRMEITWRQDVAARMARGWNAEQTQLPLEARLSALTRRRRRAQIAARHALGEL |
Ga0207691_101410221 | 3300025940 | Miscanthus Rhizosphere | DRRRRVAEQLARGWNACQVGLPLEDTLNELSLRRRRAQIAARHALGLV |
Ga0207679_112015681 | 3300025945 | Corn Rhizosphere | CFRIEIDRRRRVAEQLARGWNAAQVGLPLEDTLNELSLRRRRAQIAARHALQLS |
Ga0207679_121790962 | 3300025945 | Corn Rhizosphere | RARGWNAVQAELPLEDKLRELARRRGRAQIAARKAIGA |
Ga0207651_102249962 | 3300025960 | Switchgrass Rhizosphere | EIARRQAVAALLARGWNASQVRLPLDDTLKELSLRRRRAQIAARHALE |
Ga0207651_114233211 | 3300025960 | Switchgrass Rhizosphere | RVAEQLARGWNACQVGLPLEDTLNELSLRRRRAQIAARHALGLV |
Ga0207712_119910652 | 3300025961 | Switchgrass Rhizosphere | MEIGRRQAAAAQLARGWNASQVRLPLDDTLRELSLRRRRAQIAARHALERPEA |
Ga0207677_109429503 | 3300026023 | Miscanthus Rhizosphere | TRRQAVRDRLARGWNGQQVSLPLEETLKTLTQRRRRAQIAARHALGL |
Ga0207677_113009742 | 3300026023 | Miscanthus Rhizosphere | QMLARGWNATQPDLPLAGKIEEAHRRRRRAQIAARHALGVR |
Ga0207639_119645331 | 3300026041 | Corn Rhizosphere | QLARGWNATQKELPLADKLETFARRRGRAQIAARRALDLR |
Ga0207428_102970331 | 3300027907 | Populus Rhizosphere | FRMEIARRQSVAAQLARGWNASQVRLPLDDTLKELSLRRRRAQIAARHALEQS |
(restricted) Ga0255312_12033702 | 3300031248 | Sandy Soil | DCFRMEMDRRRAVAEQIARGWNAKQAELPLAGTLDTLTRRRRRAQIAARHALGA |
Ga0307506_104176792 | 3300031366 | Soil | FRIEIDRRRRVAAQLARGWNAAQVGLPLEDTLNALSLRRRRAQIAARHALELS |
Ga0310888_107765841 | 3300031538 | Soil | DCFRMEMDRRRVVAAQLARGWNATQTELPLADKLETFARRRGRAQIAARRALDLR |
Ga0310887_105270251 | 3300031547 | Soil | FSCFRVELTRRQAVRERLARGWNGQQVSLPLEETLKTLTQRRRRAQIAARHALGL |
Ga0307469_103673491 | 3300031720 | Hardwood Forest Soil | RVVAAQLARGWNATQAALPLSGTLEALSRRRRRAQIAARHALALR |
Ga0307405_101435651 | 3300031731 | Rhizosphere | RRQAVKARLARGWNAQQVSLPLEETLKELTRRRRRAQIAARHALGI |
Ga0307468_1013841392 | 3300031740 | Hardwood Forest Soil | VAAQLARGWNATQAALPLSGTLEALSRRRRRAQIAARHALALR |
Ga0310125_105295391 | 3300031811 | Marine | FRIELDRRQAVTAQLARGWNASPVRLPLTATIEATVRRRRFAQIAARKVLDA |
Ga0310904_101504221 | 3300031854 | Soil | QAVTALLARGWNASQVRLPLDDTLKELSLRRRRAQIAARHALE |
Ga0308175_1015483411 | 3300031938 | Soil | ELAYRQVVAARLARGWNALQVPLPLEDTLNALSLRRRRAQIAARKALGI |
Ga0310901_101207212 | 3300031940 | Soil | FDCFRMEIARRQAVAAQLARGWNASQVRLPLEDTLKELSLRRRRAQIAARHALEQS |
Ga0310885_109196531 | 3300031943 | Soil | HRQLVRERLARGWNAQQVGLPLEDTLRALDKRRRRAQIAARHALDTAR |
Ga0307416_1022737421 | 3300032002 | Rhizosphere | FRVELGYRQDVKARLARGWNASQVPLPLEEKLNELTRRRRRAQIAARHALNL |
Ga0310895_102585162 | 3300032122 | Soil | EIARRQAVTALLARGWNASQVRLPLDDTLKELSLRRRRAQIAARHALE |
Ga0307415_1016847481 | 3300032126 | Rhizosphere | MEIDRRQRVAAQLARGWNAEQVRLPLADTLQELTRRRRRAQIAARHAICA |
Ga0315910_107906081 | 3300032144 | Soil | IAWRQAVAAQLARGWNASQVRLPLEDTLKELSLRRRRAQIAARHALEQP |
Ga0310889_103302582 | 3300032179 | Soil | ITWRQDVAARMARGWNAEQTQLPLEATLSALTRRRRRAQIAARHALGEL |
Ga0307471_1006168702 | 3300032180 | Hardwood Forest Soil | LARGWNATQAELPLAARLETLARRRGRAQIAARRALDLR |
Ga0310896_109491172 | 3300032211 | Soil | RGWNATQTELPLADKLETFARRRGRAQIAARRALDLR |
Ga0316626_109133681 | 3300033485 | Soil | AVAARMARGWNATQVTLPLEKTLETLDRRRRKAQIAARHALALG |
Ga0247830_100380316 | 3300033551 | Soil | TRRQAVKARLARGWNAQQVSLPLEETLKELTHRRRRAQIAARHALGI |
Ga0364945_0002147_5317_5448 | 3300034115 | Sediment | AAAQRAKGWNATQASLPLAGKLDALSRRRRRAQIAARHALELR |
Ga0364925_0059123_1_177 | 3300034147 | Sediment | DCFRIEIDRRRRAAEQIARGWNAAQVGLPLEDTLNELSRRRRRAQIAARHALDVAGGL |
Ga0334997_0700703_8_163 | 3300034280 | Freshwater | MELDRRHAVAERLARSWDADQAPLPLAQVLEDATRRRRRAQIAARHALGLR |
⦗Top⦘ |