| Basic Information | |
|---|---|
| Family ID | F061858 |
| Family Type | Metagenome |
| Number of Sequences | 131 |
| Average Sequence Length | 48 residues |
| Representative Sequence | MKFVHNKIDGTFVIGISFSNYYSKKLGRKNTSLIFDLGKHSFAFVLRGEY |
| Number of Associated Samples | 97 |
| Number of Associated Scaffolds | 131 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Viruses |
| % of genes with valid RBS motifs | 18.90 % |
| % of genes near scaffold ends (potentially truncated) | 32.06 % |
| % of genes from short scaffolds (< 2000 bps) | 64.12 % |
| Associated GOLD sequencing projects | 89 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.47 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Duplodnaviria (80.916 % of family members) |
| NCBI Taxonomy ID | 2731341 |
| Taxonomy | All Organisms → Viruses → Duplodnaviria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater (17.557 % of family members) |
| Environment Ontology (ENVO) | Unclassified (53.435 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (57.252 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 38.46% Coil/Unstructured: 61.54% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.47 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 131 Family Scaffolds |
|---|---|---|
| PF04760 | IF2_N | 25.95 |
| PF06067 | DUF932 | 1.53 |
| PF00041 | fn3 | 0.76 |
| PF00011 | HSP20 | 0.76 |
| PF02467 | Whib | 0.76 |
| PF08883 | DOPA_dioxygen | 0.76 |
| PF13392 | HNH_3 | 0.76 |
| PF00534 | Glycos_transf_1 | 0.76 |
| PF09572 | RE_XamI | 0.76 |
| PF04860 | Phage_portal | 0.76 |
| COG ID | Name | Functional Category | % Frequency in 131 Family Scaffolds |
|---|---|---|---|
| COG0071 | Small heat shock protein IbpA, HSP20 family | Posttranslational modification, protein turnover, chaperones [O] | 0.76 |
| COG3805 | Aromatic ring-cleaving dioxygenase | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.76 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 90.08 % |
| Unclassified | root | N/A | 9.92 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000756|JGI12421J11937_10063462 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1138 | Open in IMG/M |
| 3300000756|JGI12421J11937_10107962 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 748 | Open in IMG/M |
| 3300000882|FwDRAFT_10000052 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 16836 | Open in IMG/M |
| 3300001282|B570J14230_10019147 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2521 | Open in IMG/M |
| 3300002140|M2t2FKB2_1239710 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5499 | Open in IMG/M |
| 3300002381|B570J29641_1013554 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 596 | Open in IMG/M |
| 3300002408|B570J29032_108899690 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 536 | Open in IMG/M |
| 3300002408|B570J29032_109115255 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 600 | Open in IMG/M |
| 3300002408|B570J29032_109819951 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1466 | Open in IMG/M |
| 3300002408|B570J29032_109912811 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2451 | Open in IMG/M |
| 3300002835|B570J40625_100001031 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 50205 | Open in IMG/M |
| 3300002835|B570J40625_100057360 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5403 | Open in IMG/M |
| 3300002835|B570J40625_100780820 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 842 | Open in IMG/M |
| 3300003277|JGI25908J49247_10034638 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1403 | Open in IMG/M |
| 3300003277|JGI25908J49247_10067357 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 901 | Open in IMG/M |
| 3300003393|JGI25909J50240_1017977 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1650 | Open in IMG/M |
| 3300003393|JGI25909J50240_1108993 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 547 | Open in IMG/M |
| 3300005527|Ga0068876_10279577 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 952 | Open in IMG/M |
| 3300005581|Ga0049081_10066892 | All Organisms → Viruses → Predicted Viral | 1352 | Open in IMG/M |
| 3300005581|Ga0049081_10091502 | Not Available | 1138 | Open in IMG/M |
| 3300005582|Ga0049080_10008445 | Not Available | 3576 | Open in IMG/M |
| 3300005582|Ga0049080_10079034 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1126 | Open in IMG/M |
| 3300005662|Ga0078894_11228136 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 634 | Open in IMG/M |
| 3300006484|Ga0070744_10003014 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5078 | Open in IMG/M |
| 3300006484|Ga0070744_10082473 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 931 | Open in IMG/M |
| 3300006484|Ga0070744_10095050 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 862 | Open in IMG/M |
| 3300006639|Ga0079301_1016837 | Not Available | 2607 | Open in IMG/M |
| 3300007162|Ga0079300_10192397 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 537 | Open in IMG/M |
| 3300007165|Ga0079302_1017482 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1842 | Open in IMG/M |
| 3300007545|Ga0102873_1098311 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 886 | Open in IMG/M |
| 3300007559|Ga0102828_1044174 | All Organisms → Viruses → Predicted Viral | 1026 | Open in IMG/M |
| 3300007560|Ga0102913_1155537 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 737 | Open in IMG/M |
| 3300007617|Ga0102897_1248064 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 524 | Open in IMG/M |
| 3300007620|Ga0102871_1135006 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 700 | Open in IMG/M |
| 3300008107|Ga0114340_1044039 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1981 | Open in IMG/M |
| 3300008107|Ga0114340_1118761 | All Organisms → Viruses → Predicted Viral | 1791 | Open in IMG/M |
| 3300008107|Ga0114340_1233286 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 577 | Open in IMG/M |
| 3300008110|Ga0114343_1055948 | All Organisms → Viruses → Predicted Viral | 1504 | Open in IMG/M |
| 3300008111|Ga0114344_1006370 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 12672 | Open in IMG/M |
| 3300008113|Ga0114346_1018017 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3855 | Open in IMG/M |
| 3300008113|Ga0114346_1159892 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 950 | Open in IMG/M |
| 3300008113|Ga0114346_1285641 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 581 | Open in IMG/M |
| 3300008261|Ga0114336_1080375 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1582 | Open in IMG/M |
| 3300008267|Ga0114364_1187395 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 523 | Open in IMG/M |
| 3300009152|Ga0114980_10001751 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 15433 | Open in IMG/M |
| 3300009419|Ga0114982_1001262 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 12593 | Open in IMG/M |
| 3300009419|Ga0114982_1003007 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 7105 | Open in IMG/M |
| 3300009419|Ga0114982_1012358 | Not Available | 2981 | Open in IMG/M |
| 3300010316|Ga0136655_1098874 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 882 | Open in IMG/M |
| 3300010368|Ga0129324_10420327 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 515 | Open in IMG/M |
| 3300012012|Ga0153799_1057677 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 709 | Open in IMG/M |
| 3300012663|Ga0157203_1001038 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 7118 | Open in IMG/M |
| 3300012663|Ga0157203_1007602 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1922 | Open in IMG/M |
| 3300012665|Ga0157210_1002701 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4402 | Open in IMG/M |
| 3300013004|Ga0164293_10079416 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2563 | Open in IMG/M |
| 3300013004|Ga0164293_10274151 | All Organisms → Viruses → Predicted Viral | 1180 | Open in IMG/M |
| 3300013005|Ga0164292_10944783 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 540 | Open in IMG/M |
| 3300013372|Ga0177922_11184877 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 699 | Open in IMG/M |
| 3300017722|Ga0181347_1023791 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1926 | Open in IMG/M |
| 3300017761|Ga0181356_1033223 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1842 | Open in IMG/M |
| 3300017761|Ga0181356_1055186 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1361 | Open in IMG/M |
| 3300017761|Ga0181356_1228208 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 539 | Open in IMG/M |
| 3300017780|Ga0181346_1250476 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 619 | Open in IMG/M |
| 3300019784|Ga0181359_1039029 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1839 | Open in IMG/M |
| 3300019784|Ga0181359_1055146 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1529 | Open in IMG/M |
| 3300020141|Ga0211732_1039283 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4332 | Open in IMG/M |
| 3300020141|Ga0211732_1059744 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4514 | Open in IMG/M |
| 3300020141|Ga0211732_1602235 | All Organisms → Viruses → Predicted Viral | 2045 | Open in IMG/M |
| 3300020151|Ga0211736_10898772 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 7323 | Open in IMG/M |
| 3300020159|Ga0211734_10611438 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1023 | Open in IMG/M |
| 3300020160|Ga0211733_10064649 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 926 | Open in IMG/M |
| 3300020162|Ga0211735_11650657 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 851 | Open in IMG/M |
| 3300020172|Ga0211729_10799337 | All Organisms → Viruses → Predicted Viral | 1162 | Open in IMG/M |
| 3300020205|Ga0211731_10758256 | All Organisms → Viruses → Predicted Viral | 2213 | Open in IMG/M |
| 3300020489|Ga0207910_101683 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2610 | Open in IMG/M |
| 3300020506|Ga0208091_1007654 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1396 | Open in IMG/M |
| 3300020515|Ga0208234_1002629 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2709 | Open in IMG/M |
| 3300020524|Ga0208858_1030200 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 780 | Open in IMG/M |
| 3300020527|Ga0208232_1005743 | All Organisms → Viruses → Predicted Viral | 2043 | Open in IMG/M |
| 3300020549|Ga0207942_1002468 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3097 | Open in IMG/M |
| 3300020553|Ga0208855_1008922 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1699 | Open in IMG/M |
| 3300020571|Ga0208723_1033536 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 749 | Open in IMG/M |
| 3300021141|Ga0214163_1015097 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2439 | Open in IMG/M |
| 3300021960|Ga0222715_10373493 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 787 | Open in IMG/M |
| 3300021961|Ga0222714_10101404 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1820 | Open in IMG/M |
| 3300021961|Ga0222714_10140602 | Not Available | 1462 | Open in IMG/M |
| 3300021962|Ga0222713_10023893 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5063 | Open in IMG/M |
| 3300021963|Ga0222712_10557273 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 668 | Open in IMG/M |
| 3300022190|Ga0181354_1161263 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 695 | Open in IMG/M |
| 3300022200|Ga0196901_1169775 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 716 | Open in IMG/M |
| 3300024343|Ga0244777_10152972 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1489 | Open in IMG/M |
| 3300024346|Ga0244775_10036765 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4327 | Open in IMG/M |
| 3300027114|Ga0208009_1009563 | Not Available | 2430 | Open in IMG/M |
| 3300027242|Ga0208806_1103065 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 504 | Open in IMG/M |
| 3300027320|Ga0208923_1065854 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 642 | Open in IMG/M |
| 3300027608|Ga0208974_1009466 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3200 | Open in IMG/M |
| 3300027631|Ga0208133_1017801 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1854 | Open in IMG/M |
| 3300027659|Ga0208975_1188732 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 556 | Open in IMG/M |
| 3300027688|Ga0209553_1118534 | Not Available | 934 | Open in IMG/M |
| 3300027710|Ga0209599_10000365 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 30952 | Open in IMG/M |
| 3300027710|Ga0209599_10003639 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5850 | Open in IMG/M |
| 3300027710|Ga0209599_10010732 | Not Available | 2806 | Open in IMG/M |
| (restricted) 3300027730|Ga0247833_1081318 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1523 | Open in IMG/M |
| 3300027797|Ga0209107_10129084 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1316 | Open in IMG/M |
| 3300027797|Ga0209107_10426719 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 600 | Open in IMG/M |
| 3300027798|Ga0209353_10012571 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4072 | Open in IMG/M |
| 3300028025|Ga0247723_1005900 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5446 | Open in IMG/M |
| 3300028025|Ga0247723_1018993 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2365 | Open in IMG/M |
| 3300031758|Ga0315907_10175969 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1803 | Open in IMG/M |
| 3300031963|Ga0315901_10481264 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 973 | Open in IMG/M |
| 3300033992|Ga0334992_0021519 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3988 | Open in IMG/M |
| 3300033992|Ga0334992_0475078 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 546 | Open in IMG/M |
| 3300033993|Ga0334994_0214185 | All Organisms → Viruses → Predicted Viral | 1032 | Open in IMG/M |
| 3300033994|Ga0334996_0022015 | Not Available | 4137 | Open in IMG/M |
| 3300033995|Ga0335003_0232581 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 863 | Open in IMG/M |
| 3300033996|Ga0334979_0485519 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 671 | Open in IMG/M |
| 3300034022|Ga0335005_0466204 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 710 | Open in IMG/M |
| 3300034061|Ga0334987_0027121 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5059 | Open in IMG/M |
| 3300034062|Ga0334995_0694445 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 574 | Open in IMG/M |
| 3300034082|Ga0335020_0064877 | All Organisms → Viruses → Predicted Viral | 1895 | Open in IMG/M |
| 3300034082|Ga0335020_0552440 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 542 | Open in IMG/M |
| 3300034092|Ga0335010_0269132 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 995 | Open in IMG/M |
| 3300034093|Ga0335012_0014492 | All Organisms → Viruses → Predicted Viral | 4714 | Open in IMG/M |
| 3300034102|Ga0335029_0145052 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1629 | Open in IMG/M |
| 3300034104|Ga0335031_0001534 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 17447 | Open in IMG/M |
| 3300034104|Ga0335031_0197675 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1363 | Open in IMG/M |
| 3300034106|Ga0335036_0821344 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 536 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 17.56% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 12.21% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 9.92% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 9.16% |
| Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 7.63% |
| Deep Subsurface | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface | 7.63% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 6.87% |
| Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 4.58% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 3.82% |
| Estuarine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine | 3.82% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 3.82% |
| Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater And Sediment | 3.05% |
| Freshwater | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater | 2.29% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 1.53% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 1.53% |
| Deep Subsurface Sediment | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment | 1.53% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 0.76% |
| Freshwater And Marine | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater And Marine | 0.76% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 0.76% |
| Marine | Environmental → Aquatic → Unclassified → Unclassified → Unclassified → Marine | 0.76% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000756 | Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB hypolimnion July 2011 | Environmental | Open in IMG/M |
| 3300000882 | Freshwater microbial communities from the Columbia River | Environmental | Open in IMG/M |
| 3300001282 | Freshwater microbial communities from Lake Mendota, WI - Practice 20APR2010 epilimnion | Environmental | Open in IMG/M |
| 3300002140 | Marine microbial communities from the Baltic Sea, analyzing arctic terrigenous carbon compounds - M2t2FKB2 (112f) | Environmental | Open in IMG/M |
| 3300002381 | Freshwater microbial communities from Lake Mendota, WI - 13SEP2012 deep hole epilimnion | Environmental | Open in IMG/M |
| 3300002408 | Freshwater microbial communities from Lake Mendota, WI, sample - 15JUL2010 deep hole epilimnion (Lake Mendota Combined assembly, ASSEMBLY_DATE=20140123) | Environmental | Open in IMG/M |
| 3300002835 | Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605) | Environmental | Open in IMG/M |
| 3300003277 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD | Environmental | Open in IMG/M |
| 3300003393 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.DD | Environmental | Open in IMG/M |
| 3300005527 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG | Environmental | Open in IMG/M |
| 3300005581 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF | Environmental | Open in IMG/M |
| 3300005582 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF | Environmental | Open in IMG/M |
| 3300005662 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 4) | Environmental | Open in IMG/M |
| 3300006484 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535 | Environmental | Open in IMG/M |
| 3300006639 | Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Utica-2 Time Series FC 2014_7_11 | Environmental | Open in IMG/M |
| 3300007162 | Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Utica-2 Time Series HT 2014_7_11 | Environmental | Open in IMG/M |
| 3300007165 | Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Utica-2 Time Series FC 2014_7_16 | Environmental | Open in IMG/M |
| 3300007545 | Estuarine microbial communities from the Columbia River estuary - metaG 1547B-3 | Environmental | Open in IMG/M |
| 3300007559 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.541 | Environmental | Open in IMG/M |
| 3300007560 | Estuarine microbial communities from the Columbia River estuary - metaG 1560A-02 | Environmental | Open in IMG/M |
| 3300007617 | Estuarine microbial communities from the Columbia River estuary - metaG 1554B-02 | Environmental | Open in IMG/M |
| 3300007620 | Estuarine microbial communities from the Columbia River estuary - metaG 1546C-02 | Environmental | Open in IMG/M |
| 3300007706 | Estuarine microbial communities from the Columbia River estuary - metaG 1555B-3 | Environmental | Open in IMG/M |
| 3300008107 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-3-NA | Environmental | Open in IMG/M |
| 3300008110 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-3-NA | Environmental | Open in IMG/M |
| 3300008111 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0050-C-NA | Environmental | Open in IMG/M |
| 3300008113 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0050-3-NA | Environmental | Open in IMG/M |
| 3300008261 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0024-C-NA | Environmental | Open in IMG/M |
| 3300008267 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0024-100-LTR | Environmental | Open in IMG/M |
| 3300009152 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaG | Environmental | Open in IMG/M |
| 3300009419 | Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S input2 FT | Environmental | Open in IMG/M |
| 3300010316 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.8_DNA | Environmental | Open in IMG/M |
| 3300010368 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.2_DNA | Environmental | Open in IMG/M |
| 3300012012 | Freshwater microbial communities from Eastern Basin Lake Erie, Ontario, Canada - Station 879 - Top - Depth 1m | Environmental | Open in IMG/M |
| 3300012663 | Freshwater microbial communities from Indian River, Ontario, Canada - S50 | Environmental | Open in IMG/M |
| 3300012665 | Freshwater microbial communities from Talbot River, Ontario, Canada - S11 | Environmental | Open in IMG/M |
| 3300013004 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES118 metaG | Environmental | Open in IMG/M |
| 3300013005 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES117 metaG | Environmental | Open in IMG/M |
| 3300013372 | Freshwater microbial communities from Lake Erie, Ontario, Canada. Combined Assembly of 10 SPs | Environmental | Open in IMG/M |
| 3300017722 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.N | Environmental | Open in IMG/M |
| 3300017761 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.N | Environmental | Open in IMG/M |
| 3300017780 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.D.N | Environmental | Open in IMG/M |
| 3300019784 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D | Environmental | Open in IMG/M |
| 3300020141 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_104 megahit1 | Environmental | Open in IMG/M |
| 3300020151 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_202 megahit1 | Environmental | Open in IMG/M |
| 3300020159 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_108 megahit1 | Environmental | Open in IMG/M |
| 3300020160 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_105 megahit1 | Environmental | Open in IMG/M |
| 3300020162 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_201 megahit1 | Environmental | Open in IMG/M |
| 3300020172 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_102 megahit1 | Environmental | Open in IMG/M |
| 3300020205 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_103 megahit1 | Environmental | Open in IMG/M |
| 3300020489 | Freshwater microbial communities from Lake Mendota, WI - 21JUL2008 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020506 | Freshwater microbial communities from Lake Mendota, WI - 26OCT2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020515 | Freshwater microbial communities from Lake Mendota, WI - 27SEP2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020524 | Freshwater microbial communities from Lake Mendota, WI - 16NOV2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020527 | Freshwater microbial communities from Lake Mendota, WI - 24AUG2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020549 | Freshwater microbial communities from Lake Mendota, WI - 12OCT2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020553 | Freshwater microbial communities from Lake Mendota, WI - 17MAY2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020571 | Freshwater microbial communities from Lake Mendota, WI - 31AUG2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300021141 | Freshwater microbial communities from Lake Mendota, WI - Practice 15JUN2010 epilimnion | Environmental | Open in IMG/M |
| 3300021960 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_9D | Environmental | Open in IMG/M |
| 3300021961 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_3D | Environmental | Open in IMG/M |
| 3300021962 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649D | Environmental | Open in IMG/M |
| 3300021963 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_657D | Environmental | Open in IMG/M |
| 3300022190 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.N | Environmental | Open in IMG/M |
| 3300022200 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (v3) | Environmental | Open in IMG/M |
| 3300024343 | Combined assembly of estuarine microbial communities from Columbia River, Washington, USA >3um size fraction | Environmental | Open in IMG/M |
| 3300024346 | Whole water sample coassembly | Environmental | Open in IMG/M |
| 3300027114 | Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Utica-2 Time Series FC 2014_7_16 (SPAdes) | Environmental | Open in IMG/M |
| 3300027242 | Estuarine microbial communities from the Columbia River estuary - metaG 1554B-02 (SPAdes) | Environmental | Open in IMG/M |
| 3300027320 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.575 (SPAdes) | Environmental | Open in IMG/M |
| 3300027608 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF (SPAdes) | Environmental | Open in IMG/M |
| 3300027631 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535 (SPAdes) | Environmental | Open in IMG/M |
| 3300027659 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF (SPAdes) | Environmental | Open in IMG/M |
| 3300027688 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.DN (SPAdes) | Environmental | Open in IMG/M |
| 3300027710 | Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S input2 FT (SPAdes) | Environmental | Open in IMG/M |
| 3300027730 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_8m | Environmental | Open in IMG/M |
| 3300027797 | Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB hypolimnion July 2011 (SPAdes) | Environmental | Open in IMG/M |
| 3300027798 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD (SPAdes) | Environmental | Open in IMG/M |
| 3300028025 | Subsurface sediment microbial communities from gas well in West Virginia, United States - MSEEL Well Study Marcellus 5H_FC | Environmental | Open in IMG/M |
| 3300028114 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_13.5m | Environmental | Open in IMG/M |
| 3300031758 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123 | Environmental | Open in IMG/M |
| 3300031963 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA116 | Environmental | Open in IMG/M |
| 3300033992 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME16Jun2014-rr0035 | Environmental | Open in IMG/M |
| 3300033993 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2012-rr0037 | Environmental | Open in IMG/M |
| 3300033994 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME25Jul2006D11-rr0046 | Environmental | Open in IMG/M |
| 3300033995 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23May2014-rr0056 | Environmental | Open in IMG/M |
| 3300033996 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2016-rr0004 | Environmental | Open in IMG/M |
| 3300034022 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Apr2018-rr0058 | Environmental | Open in IMG/M |
| 3300034061 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Sep2004-rr0028 | Environmental | Open in IMG/M |
| 3300034062 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Jul2012-rr0045 | Environmental | Open in IMG/M |
| 3300034082 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME05Jun2015-rr0088 | Environmental | Open in IMG/M |
| 3300034092 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME03Aug2012-rr0069 | Environmental | Open in IMG/M |
| 3300034093 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME08Jun2014-rr0072 | Environmental | Open in IMG/M |
| 3300034102 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jul2002-rr0112 | Environmental | Open in IMG/M |
| 3300034104 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Aug2005-rr0120 | Environmental | Open in IMG/M |
| 3300034106 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23Aug2013-rr0131 | Environmental | Open in IMG/M |
| 3300034284 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME08Jul2016-rr0075 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI12421J11937_100634625 | 3300000756 | Freshwater And Sediment | MKFVHNKIDGTFILGISFSTYYNKKTETKNTSLIFDLGKHSFAFVLRGEY* |
| JGI12421J11937_101079621 | 3300000756 | Freshwater And Sediment | SFSNYYNKKTETKNSSLIFDLGKHSFAIILRGEY* |
| FwDRAFT_100000527 | 3300000882 | Freshwater And Marine | MKFVHNKIDGTFILGISFSSYYNKKTATKNTSLIFDLGKHSFAFVLRGEY* |
| B570J14230_100191471 | 3300001282 | Freshwater | MRFVHNKIDGTFVIGISFSNYYSKKLNRKNTSLIFDLGSHSFAFVLRGEY* |
| M2t2FKB2_123971014 | 3300002140 | Marine | MKFVHNKIDGTFILGISFSNYYNKKLGRKNTSLIFDLGKHSFAIILRGEY* |
| B570J29641_10135543 | 3300002381 | Freshwater | MRFAHSKIDGTFVIGISFSNYYNSKLGYKNTSLIFDLGKHSVAFI |
| B570J29032_1088996902 | 3300002408 | Freshwater | MRFAHSKIDGTFVIGISFSNYYNSKLGYKNTSLIFDLGKHSIAFIFRGEY* |
| B570J29032_1091152552 | 3300002408 | Freshwater | MKFVHNKIDGTFVIGISFSNYFSKNLGRKNTSLIFDLGKHSFAFVMRGEY* |
| B570J29032_1098199513 | 3300002408 | Freshwater | MEFIHNKIDGTFILGISFSNYYNKKLGSKNTSLIFDLGKHSFAFVIRGEY* |
| B570J29032_1099128119 | 3300002408 | Freshwater | MKFVHNKIDGTFVIGISFSNYYSKKLGRKNTSLIFDLGSHSFAFVLRGEY* |
| B570J40625_10000103141 | 3300002835 | Freshwater | MKFVHNKIDGTFVIGISFSNYYSKKLNRKNTSLIFDLGKHSFAFVLRGEY* |
| B570J40625_1000573609 | 3300002835 | Freshwater | MKFVHNKIDGTFILGISFSNYYNKKLGSKNTSLIFDLGSHSFAFVLRGEH* |
| B570J40625_1007808203 | 3300002835 | Freshwater | MKIVKNKIDGTFLIGVTFSNNFNYRTKRKDTTLIFDLGSNSFAFVLRGEY* |
| JGI25908J49247_100346381 | 3300003277 | Freshwater Lake | MKFAYNKIDGTFILGISFSNYYNKKTETKNSSLIFDLGKHSFAFILRGEY* |
| JGI25908J49247_100673571 | 3300003277 | Freshwater Lake | MKFVHNKIDGTFLIGVTFSNYFNKKTETKNTSLIFDLGKHSFAFIFRGEY* |
| JGI25909J50240_10179777 | 3300003393 | Freshwater Lake | MKFAYNKIDGTFILGISFSNYYNKKTETKNSSLIFDLGKHSFAFILRGE |
| JGI25909J50240_11089931 | 3300003393 | Freshwater Lake | MKIQHNKIDGTFVIGISFSNYYNKKTSTKNTSLIFDLGSRSLAFTFRGDY* |
| Ga0068876_102795772 | 3300005527 | Freshwater Lake | MKFVHNKIDGTFVIGISFSNYFSKNLGRKNTSLIFDLGKHSFAFVLRGEY* |
| Ga0049081_100668926 | 3300005581 | Freshwater Lentic | MRFVHNKIDGTFILGISFSTYYNKKLGSKNTSLIFDL |
| Ga0049081_100915021 | 3300005581 | Freshwater Lentic | MKFVHNKLDGTFVIGISFSNYFSKNLGRKNTSLIFDLGSHSFAFVLRGEY* |
| Ga0049080_100084456 | 3300005582 | Freshwater Lentic | MRFVHNKIDGTFILGISFSTYYNKKLGSKNTSLIFDLGKHSFAFVLRGEY* |
| Ga0049080_100790343 | 3300005582 | Freshwater Lentic | MRFAYNKIDGTFILGISFSNYYNKKTETKNSSLIFDLGKHSFAFIFRGEY* |
| Ga0078894_112281361 | 3300005662 | Freshwater Lake | MKIVKNKIDGTFLIGVTFSNNFNYRTKRKDTSLIFDLGSNSFAFVLR |
| Ga0070744_1000301413 | 3300006484 | Estuarine | MKFVHNKIDGTFILGISFSNYYNKKTETKNTSLIFDLGKYSYAIIFRGEH* |
| Ga0070744_100824732 | 3300006484 | Estuarine | MKFVHNKIDGTFILGISFSNYYNKKLGSKNTSLIFDLGKHSIAFIFRGEY* |
| Ga0070744_100950502 | 3300006484 | Estuarine | MKFVHNKIDGTFILGISFSSYYNKQTATKNTSLIFDLGKHSVAFIFRGEY* |
| Ga0079301_10168376 | 3300006639 | Deep Subsurface | MKFVHNKLDGTFVIGISFSNYFSPNLGRKNTSLIFDLGSHSFAFVLRGEY* |
| Ga0079300_101923972 | 3300007162 | Deep Subsurface | MKFVHNKIDGTFVIGISFSNYYSKKLNRKNTSLIFDLGSHSFAFVLRGEY* |
| Ga0079302_10174821 | 3300007165 | Deep Subsurface | MKFVHTKIDGTFVIGISFSNYFSKNLGRKNTSLIFDLGKHSFAFVMRGEY* |
| Ga0102873_10983111 | 3300007545 | Estuarine | MKFVHNKIDGTFVIGISFSNYYSKKLGRKNTSLIFDLGKHSFAFVLRGEY* |
| Ga0102828_10441744 | 3300007559 | Estuarine | MRFIHNQIDGTFILGISFSNYYNKKLGSKNTSLIFDLGSHSFAFVLRG |
| Ga0102913_11555374 | 3300007560 | Estuarine | MKFVHNKIDGTFILGISFSNYYNKKLGRKNTSLIFDLGKHSFAFVMRGEY* |
| Ga0102897_12480643 | 3300007617 | Estuarine | MKFVHNKIDGTFVIGISFSNYYSKKLGRKNTSLIFDLGKHSFAFVLRG |
| Ga0102871_11350062 | 3300007620 | Estuarine | DGTFVIGISFSNYYSKKLGRKNTSLIFDLGKHSFAFVLRGEY* |
| Ga0102899_11872491 | 3300007706 | Estuarine | MKFVHNKIDGTFILGISFSSYYNKKTATKNTSLIFDL |
| Ga0114340_10440391 | 3300008107 | Freshwater, Plankton | MRFVHNKIDETFILGISFSNYYNKKLGSKNTSLIFDLGSHSFAFVLR |
| Ga0114340_11187617 | 3300008107 | Freshwater, Plankton | MKFVHNKIDGTFVIGISFSNYFSKKLGRKNTSLIFDLGKHSFAFVLRGEY* |
| Ga0114340_12332863 | 3300008107 | Freshwater, Plankton | MKFVHNKIDGTFILGISFSNYYNKKLGSKNTSLIFDLGSHSFAFVLR |
| Ga0114343_10559481 | 3300008110 | Freshwater, Plankton | MKFVHNKIDGTFVMGISFSNYFSKKLGRKNTSLIFDLGKHSFAFVLRGEY* |
| Ga0114344_100637012 | 3300008111 | Freshwater, Plankton | MKFVHNKIDGTFLIGVTFSNNFNYRTKRKDTTLIFDLGSNSFAFVLRGEY* |
| Ga0114346_10180175 | 3300008113 | Freshwater, Plankton | MRFVHTKIDGTFVIGISFSNYFSKKLNRKNTSLIFDLGKHSFAFVLRGEY* |
| Ga0114346_11598924 | 3300008113 | Freshwater, Plankton | MKFVHNKIDGTFVIGISFSNYFSKKLGRKNTSLIFDLGKHSFAFVFRGEY* |
| Ga0114346_12856411 | 3300008113 | Freshwater, Plankton | MKFVHNKIDGTFILGISFSNYYNKKLGSKNTSLIFDLGSHSFAFVLRGE |
| Ga0114336_10803751 | 3300008261 | Freshwater, Plankton | FVIGISFSNYFSKKLNRKNTSLIFDLGKHSFAFVLRGEY* |
| Ga0114364_11873953 | 3300008267 | Freshwater, Plankton | MRFVHNKLDGTFVIGISFSNYFSKNLGRKNTSLIFDLGSHSFAFVLRGE |
| Ga0114980_1000175141 | 3300009152 | Freshwater Lake | MKIVKNKIDGTFLIGVTFSNNFNYRTKRKDTSLIFDLGSNSFAFVLRGEY* |
| Ga0114982_100126216 | 3300009419 | Deep Subsurface | MRFSHNKIDGNFVIGISFSNYYNSKLGYKNTSLIFDLGKHSVAFIFRGEH* |
| Ga0114982_10030073 | 3300009419 | Deep Subsurface | MKFVHNKIDGTFVIGISFSNYYSKKLGRKNTSLIFDLGKHSFAFVMRGEY* |
| Ga0114982_10123585 | 3300009419 | Deep Subsurface | MKIIHTKLDGTFVIGISFSNYYSKNLGRKNTSLIFDLGSHSFAFVLRGEY* |
| Ga0136655_10988743 | 3300010316 | Freshwater To Marine Saline Gradient | MKFVHNKIDGTFILGISFSSYYNKQTATKNTSLIFDLGKHSIAIIFRGEY* |
| Ga0129324_104203272 | 3300010368 | Freshwater To Marine Saline Gradient | MKFVHNKIDGTFILGISFSSYYNKQTATKNTSLIFDLGKHSIAFILRGEY* |
| Ga0153799_10576771 | 3300012012 | Freshwater | MKFAYNKIDGTFILGISFSNYYNKKTETKNTSLIFDLGKHSFAIIFRGEH* |
| Ga0157203_10010381 | 3300012663 | Freshwater | GTFILGISFSNYYNKKLGRKDTSLIFDLGKHSFAFVMRGEY* |
| Ga0157203_10076021 | 3300012663 | Freshwater | GTFILGISFSNYYNKKLGSKNTSLIFDLGKHSFAFVLRGEY* |
| Ga0157210_100270111 | 3300012665 | Freshwater | MRFAHNKIDGTFVIGISFSNYFSKNLGRKNTSLIFDLGKHSIAFIFRGEH* |
| Ga0164293_100794161 | 3300013004 | Freshwater | MRFVHNKIDGTFILGISFSNYYNKKLGNKNTSLIFDLGKHSFAFIFRGEY* |
| Ga0164293_102741515 | 3300013004 | Freshwater | MRFAHSKIDGTFVIGISFSNYYNSKLGYKNTSLIFDLGKHSFAFVMRGEY* |
| Ga0164292_109447831 | 3300013005 | Freshwater | MKFVHNKIDGTFILGISFSNYYNKKLGSKNTSLIFDLGKHSVAF |
| Ga0177922_111848772 | 3300013372 | Freshwater | MKFAYNKIDGTFILGISFSNYYNKKTETKNSSLIFDLGKHSFAIIFRGEH* |
| Ga0181347_10237911 | 3300017722 | Freshwater Lake | MKFVHNKIDGTFLIGVTFSNYFNKKTETKNTSLIFDLGKHSFAFVLRGEY |
| Ga0181356_10332231 | 3300017761 | Freshwater Lake | MKIQYNKIDGTFVIGISFSNYYNKKTSTKNTSLIFDLGSRSLAFT |
| Ga0181356_10551861 | 3300017761 | Freshwater Lake | NKIDGTFVIGISFSNYYNKKTSTKNTSLIFDLGSRSLAFTFRGDY |
| Ga0181356_12282081 | 3300017761 | Freshwater Lake | MKIQHNKIDGTFVIGISFSNYYNKKTSTKNTSLIFDLGSRSLAFT |
| Ga0181346_12504763 | 3300017780 | Freshwater Lake | MKIQYNKIDGTFVIGISFSNYYSKNLGRKNTSLIFDLGSHSL |
| Ga0181359_10390296 | 3300019784 | Freshwater Lake | MKIQHNKIDGTFVIGISFSNYYNKKTSTKNTSLIFDLGSRSLAFTFRG |
| Ga0181359_10551463 | 3300019784 | Freshwater Lake | MKIVKNKIDGTFLIGVTFSNNFNYRTKRKDTTLIFDLGSNSFAFVLRGEY |
| Ga0211732_10392836 | 3300020141 | Freshwater | MKFVHNKIDGTFILGISFSNYYNKKLATKNTSLIFDLGKHSFAIILRGEY |
| Ga0211732_105974415 | 3300020141 | Freshwater | MKIVKNKIDGTFLIGVTFSNNFNYRTKRKDTSLIFDLGSNSFAFVLRGEY |
| Ga0211732_10984205 | 3300020141 | Freshwater | MRFVHNQIDGTFILGISFSNYYNKKLGSKNTSLIFDL |
| Ga0211732_16022355 | 3300020141 | Freshwater | MKFVHNKIDGTFVIGISFSNYFSKKLNRKNTSLIFDLGKHSFAFVLRGEY |
| Ga0211736_108987726 | 3300020151 | Freshwater | MKFVHTKIDGTFVIGISFSNYFSKKLNRKNTSLIFDLGKHSFAFVLRGEY |
| Ga0211734_106114381 | 3300020159 | Freshwater | MRFVHNQIDGTFILGISFSNYYNKKTGNKNTSLIFDLGSHSFAFVLRGEW |
| Ga0211733_100646493 | 3300020160 | Freshwater | MRFVHNKIDGTFILGISFSNYYNKKLGSKNTSLIFDLGKH |
| Ga0211735_116506575 | 3300020162 | Freshwater | MRFVHNQIDGTFVIGISFSNYFSKKLNRKNTSLIFDLGKHS |
| Ga0211729_107993374 | 3300020172 | Freshwater | MRFVHNQIDGTFILGISFSNYYNKKTGNKNTSLIFDLGSHSFAFVLR |
| Ga0211731_107582561 | 3300020205 | Freshwater | MRFVHNQIDGTFILGISFSNYYNKKLGSKNTSLIFDLGKHSFAFI |
| Ga0207910_1016835 | 3300020489 | Freshwater | MKFVHNKIDGTFVIGISFSNYYSKKLNRKNTSLIFDLGKHSFAFVLRGEY |
| Ga0208091_10076544 | 3300020506 | Freshwater | DGTFVIGISFSNYYSKKLNRKNTSLIFDVGSHSFAFVLRGEY |
| Ga0208234_10026295 | 3300020515 | Freshwater | MRFAHSKIDGTFVIGISFSNYYNSKLGYKNTSLIFDLGKHSVAFIFRGEH |
| Ga0208858_10302003 | 3300020524 | Freshwater | MRFAHNKIDGTFVIGISFSNYYSKKLNRKNTSLIFDVGSHSFAFVLRGEY |
| Ga0208232_10057433 | 3300020527 | Freshwater | MKFVHNKIDGTFILGISFSNYYNKKLGSKNTSLIFDLGSHSFAFVFRGEY |
| Ga0207942_10024688 | 3300020549 | Freshwater | MRFAHSKIDGTFVIGISFSNYYNSKLGYKNTSLIFDLGKHSIAFIFRGEY |
| Ga0208855_10089223 | 3300020553 | Freshwater | MKFVHNKIDGTFILGISFSNYYNKKLGSKNTSLIFDLGSHSFAFVLRGEH |
| Ga0208723_10335361 | 3300020571 | Freshwater | MRFAHNKIDGTFVIGISFSNYYNSKLGYKNTSLIFDLGKHSIAFIFRGEY |
| Ga0214163_10150976 | 3300021141 | Freshwater | MRFVHNKIDGTFVIGISFSNYYSKKLNRKNTSLIFDLGKHSFAFVLRGEY |
| Ga0222715_103734933 | 3300021960 | Estuarine Water | MKFVHNKLDGTFVIGISFSNYFSKNLGRKNTSLIFDLGSHSFAFVLRGEY |
| Ga0222714_101014041 | 3300021961 | Estuarine Water | DGTFVIGISFSNYFSKKLGRKNTSLIFDLGKHSFAFVFRGEY |
| Ga0222714_101406026 | 3300021961 | Estuarine Water | MEFIHNKIDGTFILGISFSNYYNKKLGSKNTSLIFDLGKHSFAFVMRGEY |
| Ga0222713_100238938 | 3300021962 | Estuarine Water | MKFVHNKIDGTFVIGISFSNYFSKKLGRKNTSLIFDLGKHSFAFVFRGEY |
| Ga0222712_105572734 | 3300021963 | Estuarine Water | MRFVHNKIDGTFILGISFSNYYNKKLGSKNTSMIFDLGKH |
| Ga0181354_11612633 | 3300022190 | Freshwater Lake | MKIQYNKIDGTFVIGISFSNYYNKKTSTKNTSLIFDLGSRSLAFTFRGDY |
| Ga0196901_11697753 | 3300022200 | Aqueous | MKFVHNKIDGTFILGISFSSYYNKQTATKNTSLIFDLGKHSIAFILRGEY |
| Ga0244777_101529721 | 3300024343 | Estuarine | MKFVHNKIDGTFVIGISFSNYYSKKLGRKNTSLIFDLGKHSFAFVLRGEY |
| Ga0244775_100367656 | 3300024346 | Estuarine | MKFVHNKIDGTFILGISFSNYYNKKTETKNTSLIFDLGKYSYAIIFRGEH |
| Ga0208009_10095636 | 3300027114 | Deep Subsurface | MKFVHNKLDGTFVIGISFSNYFSPNLGRKNTSLIFDLGSHSFAFVLRGEY |
| Ga0208806_11030651 | 3300027242 | Estuarine | MKFVHNKIDGTFVIGISFSNYYSKKLGRKNTSLIFDLGKHSF |
| Ga0208923_10658543 | 3300027320 | Estuarine | MKFVHNKIDGTFILGISFSSYYNKKTATKNTSLIFDLGKH |
| Ga0208974_10094663 | 3300027608 | Freshwater Lentic | MKIQHNKIDGTFVIGISFSNYYNKKTSTKNTSLIFDLGSRSLAFTFRGDY |
| Ga0208133_10178011 | 3300027631 | Estuarine | FVHNKIDGTFILGISFSNYYNKKTETKNTSLIFDLGKYSYAIIFRGEH |
| Ga0208975_11887321 | 3300027659 | Freshwater Lentic | MRFVHNKIDGTFILGISFSTYYNKKLGSKNTSLIFDLG |
| Ga0209553_11185344 | 3300027688 | Freshwater Lake | NKIDGTFILGISFSNYYNKKTETKNSSLIFDLGKHSFAFILRGEY |
| Ga0209599_1000036529 | 3300027710 | Deep Subsurface | MRFSHNKIDGTFVIGISFSNYYNSKLGYKNTSLIFDLGKHSVAFIFRGEH |
| Ga0209599_1000363915 | 3300027710 | Deep Subsurface | MKFVHNKIDGTFVIGISFSNYYSKKLGRKNTSLIFDLGKHSFAFVMRGEY |
| Ga0209599_100107324 | 3300027710 | Deep Subsurface | MKIIHTKLDGTFVIGISFSNYYSKNLGRKNTSLIFDLGSHSFAFVLRGEY |
| (restricted) Ga0247833_10813185 | 3300027730 | Freshwater | MRFVHNKIDGTFILGISFSNYFNKKTGNKNTSLIFDLGSHSFAIIFRGEY |
| Ga0209107_101290843 | 3300027797 | Freshwater And Sediment | MRFAYNKIDGTFILGISFSNYYNKKTETKNSSLIFDLGKHSFAIILRGEY |
| Ga0209107_104267193 | 3300027797 | Freshwater And Sediment | MKFVHNKIDGTFILGISFSTYYNKKTETKNTSLIFDLGKHSFAFVLRGEY |
| Ga0209353_100125714 | 3300027798 | Freshwater Lake | MKFAYNKIDGTFILGISFSNYYNKKTETKNTSLIFDLGKHSFAFIFRGEY |
| Ga0247723_10059008 | 3300028025 | Deep Subsurface Sediment | MKFVHNKIDGTFVIGISFSNYYSKKLNRKNTSLIFDLGSHSFAFVLRGEY |
| Ga0247723_10189938 | 3300028025 | Deep Subsurface Sediment | MKIAHNKIDGTFVIGISFSNHFNKKLGSKNTSLIFDLGSHSLAFIFRGEY |
| (restricted) Ga0247835_12137633 | 3300028114 | Freshwater | MRFVHNKIDGTFILGISFSNYFNKKTGNKNTSLIFD |
| Ga0315907_101759694 | 3300031758 | Freshwater | MKFVHNKIDGTFVIGISFSNYFSKNLGRKNTSLIFDLGKHSFAFVLRGEY |
| Ga0315901_104812641 | 3300031963 | Freshwater | MKFVHNKIDGTFVIGISFSNYFSKNLGRKNTSLIFDLGKHSFAFVF |
| Ga0334992_0021519_965_1117 | 3300033992 | Freshwater | MRFVHNKIDGTFILGISFSNYYNKKLGSKNTSLIFDLGKHSVAFIFRGEY |
| Ga0334992_0475078_407_544 | 3300033992 | Freshwater | NKIDGTFILGISFSNYYNKKLGSKNTSLIFDLGSHSFAFVLRGEH |
| Ga0334994_0214185_8_160 | 3300033993 | Freshwater | MRFVHNKIDGTFILGISFSNYYNKKTETKNSSLIFDLGKHSFAFVMRGEY |
| Ga0334996_0022015_3895_4047 | 3300033994 | Freshwater | MKFVHNKIDGTFVIGISFSNYYSKKLNRKNTSLIFDLGSHSFAIIFRGEH |
| Ga0335003_0232581_716_862 | 3300033995 | Freshwater | FVHNKIDGTFILGISFSNYYNKKTETKNSSLIFDLGKHSFAFVMRGEY |
| Ga0334979_0485519_492_644 | 3300033996 | Freshwater | MKFVHNKIDGTFILGISFSNYYNKKTETKNSSLIFDLGKHSFAFVLRGEY |
| Ga0335005_0466204_551_703 | 3300034022 | Freshwater | MRFAHSKIDGTFVIGISFSNYYNSKLGYKNTSLIFDLGKHSVAFIFRGEY |
| Ga0334987_0027121_2767_2919 | 3300034061 | Freshwater | MRFVHNKIDGTFVIGISFSNYYSKKLNRKNTSLIFDLGSHSFAFVLRGEY |
| Ga0334995_0694445_1_147 | 3300034062 | Freshwater | MEFIHNKIDGTFILGISFSNYYNKKLGSKNTSLIFDLGKHSFAFVIRGE |
| Ga0335020_0064877_1248_1400 | 3300034082 | Freshwater | MRFAHSKIDGTFVIGISFSNYYNSKLGYKNTSLIFDLGKHSFAFVMRGEY |
| Ga0335020_0552440_416_541 | 3300034082 | Freshwater | MKFVHNKIDGTFVIGISFSNYYSKKLNRKNTSLIFDVGSHSF |
| Ga0335010_0269132_2_148 | 3300034092 | Freshwater | MKFVHNKIDGTFILGISFSNYYNKKTETKNSSLIFDLGKHSFAFVLRGE |
| Ga0335012_0014492_2839_2991 | 3300034093 | Freshwater | MEFIHNKIDGTFILGISFSNYYNKKLGSKNTSLIFDLGKHSFAFVIRGEY |
| Ga0335029_0145052_988_1140 | 3300034102 | Freshwater | MRFAHNKIDGTFVIGISFSNYYSKKLGYKNTSLIFDLGKHSVAFIFRGEH |
| Ga0335031_0001534_13510_13662 | 3300034104 | Freshwater | MKFVHNKIDGTFVIGISFSNYFSKNLGRKNTSLIFDLGKHSFAFVMRGEY |
| Ga0335031_0197675_232_384 | 3300034104 | Freshwater | MRFAHNKIDGTFVIGISFSNYYSKKLNRKNTSLIFDVGSHSFAFVMRGEY |
| Ga0335036_0821344_387_536 | 3300034106 | Freshwater | RFAHNKIDGTFVIGISFSNYYSKKLNRKNTSLIFDVGSHSFAFVLRGEY |
| Ga0335013_0726714_1_108 | 3300034284 | Freshwater | MRFVHNKIDGTFILGISFSNYYNKKLGSKNTSLIFD |
| ⦗Top⦘ |