NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F061818

Metagenome / Metatranscriptome Family F061818

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F061818
Family Type Metagenome / Metatranscriptome
Number of Sequences 131
Average Sequence Length 47 residues
Representative Sequence MTKSQEFWAWIDQCPDGVYVNHDFTDDEDDQKIHVFGFAVPKEIDDD
Number of Associated Samples 111
Number of Associated Scaffolds 130

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Viruses
% of genes with valid RBS motifs 80.30 %
% of genes near scaffold ends (potentially truncated) 24.43 %
% of genes from short scaffolds (< 2000 bps) 85.50 %
Associated GOLD sequencing projects 95
AlphaFold2 3D model prediction No

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Predicted Viral (28.244 % of family members)
NCBI Taxonomy ID 10239 (predicted)
Taxonomy All Organisms → Viruses → Predicted Viral

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous
(29.008 % of family members)
Environment Ontology (ENVO) Unclassified
(70.992 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Water (saline)
(90.840 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 14.89%    β-sheet: 21.28%    Coil/Unstructured: 63.83%
Feature Viewer
Powered by Feature Viewer

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 130 Family Scaffolds
PF00589Phage_integrase 2.31
PF06067DUF932 2.31
PF01612DNA_pol_A_exo1 1.54
PF03796DnaB_C 0.77
PF11753DUF3310 0.77

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 130 Family Scaffolds
COG0305Replicative DNA helicaseReplication, recombination and repair [L] 0.77
COG1066DNA repair protein RadA/Sms, contains AAA+ ATPase domainReplication, recombination and repair [L] 0.77

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms78.63 %
UnclassifiedrootN/A21.37 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000115|DelMOSum2011_c10156786All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon670Open in IMG/M
3300000116|DelMOSpr2010_c10010271All Organisms → Viruses → Predicted Viral4879Open in IMG/M
3300000116|DelMOSpr2010_c10043194All Organisms → Viruses → Predicted Viral2019Open in IMG/M
3300000116|DelMOSpr2010_c10115407Not Available980Open in IMG/M
3300000116|DelMOSpr2010_c10141537Not Available837Open in IMG/M
3300000947|BBAY92_10119947Not Available696Open in IMG/M
3300000973|BBAY93_10198193Not Available502Open in IMG/M
3300001460|JGI24003J15210_10147133All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon TMED164608Open in IMG/M
3300004448|Ga0065861_1059900All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon622Open in IMG/M
3300005078|Ga0070770_10128016Not Available585Open in IMG/M
3300005086|Ga0072334_10392255All Organisms → Viruses → Predicted Viral2101Open in IMG/M
3300006029|Ga0075466_1115955All Organisms → cellular organisms → Archaea → Euryarchaeota714Open in IMG/M
3300006637|Ga0075461_10046274All Organisms → Viruses → Predicted Viral1416Open in IMG/M
3300006735|Ga0098038_1004386All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria5814Open in IMG/M
3300006749|Ga0098042_1041184All Organisms → Viruses → Predicted Viral1277Open in IMG/M
3300006789|Ga0098054_1332413All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon TMED164541Open in IMG/M
3300006802|Ga0070749_10082666All Organisms → Viruses → Predicted Viral1917Open in IMG/M
3300006802|Ga0070749_10244187All Organisms → Viruses → Predicted Viral1019Open in IMG/M
3300006803|Ga0075467_10526817Not Available607Open in IMG/M
3300006810|Ga0070754_10235236All Organisms → cellular organisms → Archaea → Euryarchaeota841Open in IMG/M
3300006869|Ga0075477_10163907All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon TMED164923Open in IMG/M
3300006870|Ga0075479_10108001All Organisms → Viruses → Predicted Viral1152Open in IMG/M
3300006916|Ga0070750_10382263All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon590Open in IMG/M
3300006920|Ga0070748_1361267All Organisms → cellular organisms → Archaea → Euryarchaeota511Open in IMG/M
3300007229|Ga0075468_10116224All Organisms → cellular organisms → Archaea → Euryarchaeota834Open in IMG/M
3300007236|Ga0075463_10269627All Organisms → cellular organisms → Archaea → Euryarchaeota547Open in IMG/M
3300007276|Ga0070747_1070633All Organisms → Viruses → Predicted Viral1313Open in IMG/M
3300007276|Ga0070747_1188407All Organisms → cellular organisms → Archaea → Euryarchaeota730Open in IMG/M
3300007345|Ga0070752_1075939All Organisms → Viruses → Predicted Viral1478Open in IMG/M
3300007345|Ga0070752_1157491All Organisms → cellular organisms → Archaea → Euryarchaeota929Open in IMG/M
3300007538|Ga0099851_1244608All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria643Open in IMG/M
3300007539|Ga0099849_1015304All Organisms → Viruses → Predicted Viral3377Open in IMG/M
3300007539|Ga0099849_1179586All Organisms → cellular organisms → Archaea → Euryarchaeota806Open in IMG/M
3300007539|Ga0099849_1339074All Organisms → cellular organisms → Bacteria536Open in IMG/M
3300007640|Ga0070751_1308548All Organisms → cellular organisms → Bacteria588Open in IMG/M
3300008012|Ga0075480_10201330All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon1052Open in IMG/M
3300008219|Ga0114905_1058711All Organisms → Viruses → Predicted Viral1399Open in IMG/M
3300009001|Ga0102963_1005312Not Available5613Open in IMG/M
3300009071|Ga0115566_10292200All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon TMED164963Open in IMG/M
3300009414|Ga0114909_1204160All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Podoviridae → unclassified Podoviridae → Puniceispirillum phage HMO-2011501Open in IMG/M
3300009418|Ga0114908_1191506All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Podoviridae → unclassified Podoviridae → Puniceispirillum phage HMO-2011639Open in IMG/M
3300009426|Ga0115547_1180772Not Available668Open in IMG/M
3300009426|Ga0115547_1180772Not Available668Open in IMG/M
3300009433|Ga0115545_1234961All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Podoviridae → unclassified Podoviridae → Puniceispirillum phage HMO-2011618Open in IMG/M
3300009437|Ga0115556_1263359All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Podoviridae → unclassified Podoviridae → Puniceispirillum phage HMO-2011611Open in IMG/M
3300009472|Ga0115554_1352139Not Available578Open in IMG/M
3300009481|Ga0114932_10322707All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon TMED164923Open in IMG/M
3300009498|Ga0115568_10378536All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Podoviridae → unclassified Podoviridae → Puniceispirillum phage HMO-2011615Open in IMG/M
3300009507|Ga0115572_10315304All Organisms → cellular organisms → Archaea → Euryarchaeota884Open in IMG/M
3300009508|Ga0115567_10852192Not Available542Open in IMG/M
3300009604|Ga0114901_1044187All Organisms → Viruses → Predicted Viral1572Open in IMG/M
3300009605|Ga0114906_1145781All Organisms → cellular organisms → Archaea → Euryarchaeota820Open in IMG/M
3300010148|Ga0098043_1166050All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon TMED164620Open in IMG/M
3300010300|Ga0129351_1104007All Organisms → Viruses → Predicted Viral1139Open in IMG/M
3300010316|Ga0136655_1133545All Organisms → cellular organisms → Bacteria743Open in IMG/M
3300010368|Ga0129324_10218501All Organisms → cellular organisms → Archaea → Euryarchaeota769Open in IMG/M
3300013010|Ga0129327_10131796All Organisms → Viruses → Predicted Viral1239Open in IMG/M
3300016727|Ga0182051_1040731All Organisms → cellular organisms → Bacteria875Open in IMG/M
3300017697|Ga0180120_10020836All Organisms → Viruses → Predicted Viral3069Open in IMG/M
3300017697|Ga0180120_10349881All Organisms → cellular organisms → Archaea → Euryarchaeota585Open in IMG/M
3300017697|Ga0180120_10423155All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon521Open in IMG/M
3300017714|Ga0181412_1042338All Organisms → Viruses → Predicted Viral1182Open in IMG/M
3300017742|Ga0181399_1006540All Organisms → Viruses → Predicted Viral3553Open in IMG/M
3300017743|Ga0181402_1195931All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria502Open in IMG/M
3300017752|Ga0181400_1128997Not Available727Open in IMG/M
3300017756|Ga0181382_1159862All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon TMED164583Open in IMG/M
3300017757|Ga0181420_1004948All Organisms → Viruses → Predicted Viral4709Open in IMG/M
3300017762|Ga0181422_1191138Not Available619Open in IMG/M
3300017770|Ga0187217_1235654Not Available600Open in IMG/M
3300017818|Ga0181565_10793913Not Available595Open in IMG/M
3300017824|Ga0181552_10131464All Organisms → Viruses → Predicted Viral1352Open in IMG/M
3300018036|Ga0181600_10353791All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.723Open in IMG/M
3300018041|Ga0181601_10271309All Organisms → cellular organisms → Bacteria954Open in IMG/M
3300018413|Ga0181560_10391087All Organisms → cellular organisms → Bacteria639Open in IMG/M
3300018415|Ga0181559_10678098All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.554Open in IMG/M
3300018416|Ga0181553_10012968Not Available6497Open in IMG/M
3300018416|Ga0181553_10277360All Organisms → cellular organisms → Bacteria940Open in IMG/M
3300018416|Ga0181553_10669246All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.545Open in IMG/M
3300018417|Ga0181558_10435465All Organisms → cellular organisms → Archaea → Euryarchaeota690Open in IMG/M
3300018420|Ga0181563_10717332All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.551Open in IMG/M
3300018423|Ga0181593_10661456Not Available744Open in IMG/M
3300018424|Ga0181591_10589665All Organisms → cellular organisms → Archaea → Euryarchaeota797Open in IMG/M
3300018428|Ga0181568_11066947Not Available612Open in IMG/M
3300018876|Ga0181564_10493695All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.657Open in IMG/M
3300020173|Ga0181602_10332743Not Available618Open in IMG/M
3300020247|Ga0211654_1000268Not Available10233Open in IMG/M
3300020274|Ga0211658_1081014All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium TMED38651Open in IMG/M
3300020336|Ga0211510_1030390All Organisms → Viruses → Predicted Viral1384Open in IMG/M
3300020349|Ga0211511_1038615All Organisms → Viruses → Predicted Viral1221Open in IMG/M
3300020388|Ga0211678_10293193All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon TMED164663Open in IMG/M
3300021958|Ga0222718_10432667All Organisms → cellular organisms → Bacteria650Open in IMG/M
3300021959|Ga0222716_10185741All Organisms → Viruses → Predicted Viral1328Open in IMG/M
3300021960|Ga0222715_10065400All Organisms → Viruses → Predicted Viral2450Open in IMG/M
3300021964|Ga0222719_10235938All Organisms → Viruses → Predicted Viral1225Open in IMG/M
3300022050|Ga0196883_1023352All Organisms → cellular organisms → Archaea → Euryarchaeota747Open in IMG/M
3300022072|Ga0196889_1064667Not Available695Open in IMG/M
3300022074|Ga0224906_1033735All Organisms → Viruses → Predicted Viral1732Open in IMG/M
3300022164|Ga0212022_1050641All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria642Open in IMG/M
3300022178|Ga0196887_1078295All Organisms → cellular organisms → Archaea → Euryarchaeota778Open in IMG/M
3300022178|Ga0196887_1112413All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon595Open in IMG/M
3300022178|Ga0196887_1124437All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon TMED164550Open in IMG/M
3300022907|Ga0255775_1222230All Organisms → cellular organisms → Bacteria706Open in IMG/M
3300022926|Ga0255753_1297350All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.627Open in IMG/M
3300022928|Ga0255758_10272571Not Available736Open in IMG/M
3300022929|Ga0255752_10054060All Organisms → Viruses → Predicted Viral2475Open in IMG/M
3300022929|Ga0255752_10085579All Organisms → Viruses → Predicted Viral1770Open in IMG/M
3300022929|Ga0255752_10216087All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.881Open in IMG/M
(restricted) 3300024059|Ga0255040_10071049All Organisms → Viruses → Predicted Viral1317Open in IMG/M
(restricted) 3300024062|Ga0255039_10036962All Organisms → Viruses → Predicted Viral1806Open in IMG/M
3300025101|Ga0208159_1018638All Organisms → Viruses → Predicted Viral1707Open in IMG/M
3300025120|Ga0209535_1057523All Organisms → Viruses → Predicted Viral1611Open in IMG/M
3300025137|Ga0209336_10148733Not Available621Open in IMG/M
3300025280|Ga0208449_1088948All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon747Open in IMG/M
3300025282|Ga0208030_1127637All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Podoviridae → unclassified Podoviridae → Puniceispirillum phage HMO-2011616Open in IMG/M
3300025543|Ga0208303_1044092All Organisms → Viruses → Predicted Viral1114Open in IMG/M
3300025630|Ga0208004_1108690Not Available648Open in IMG/M
3300025652|Ga0208134_1100309All Organisms → cellular organisms → Archaea → Euryarchaeota802Open in IMG/M
3300025671|Ga0208898_1108657Not Available826Open in IMG/M
3300025674|Ga0208162_1019817All Organisms → Viruses → Predicted Viral2613Open in IMG/M
3300025674|Ga0208162_1022918All Organisms → Viruses → Predicted Viral2376Open in IMG/M
3300025769|Ga0208767_1177629All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Podoviridae → unclassified Podoviridae → Puniceispirillum phage HMO-2011741Open in IMG/M
3300025816|Ga0209193_1018245All Organisms → Viruses → Predicted Viral2265Open in IMG/M
3300025870|Ga0209666_1024779All Organisms → Viruses → Predicted Viral3510Open in IMG/M
(restricted) 3300027996|Ga0233413_10425260All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon TMED164583Open in IMG/M
3300029448|Ga0183755_1000211All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Podoviridae → unclassified Podoviridae → Puniceispirillum phage HMO-201133347Open in IMG/M
3300029448|Ga0183755_1069351All Organisms → cellular organisms → Bacteria796Open in IMG/M
3300031519|Ga0307488_10765550Not Available538Open in IMG/M
3300032277|Ga0316202_10309633All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon736Open in IMG/M
3300034374|Ga0348335_113799All Organisms → cellular organisms → Bacteria818Open in IMG/M
3300034375|Ga0348336_006071Not Available8220Open in IMG/M
3300034375|Ga0348336_129711Not Available788Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous29.01%
Salt MarshEnvironmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh17.56%
SeawaterEnvironmental → Aquatic → Marine → Strait → Unclassified → Seawater8.40%
Pelagic MarineEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine7.63%
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine6.11%
Deep OceanEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean5.34%
Freshwater To Marine Saline GradientEnvironmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient5.34%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine5.34%
MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine3.82%
Estuarine WaterEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water3.05%
WaterEnvironmental → Aquatic → Unclassified → Unclassified → Unclassified → Water1.53%
Macroalgal SurfaceHost-Associated → Algae → Green Algae → Ectosymbionts → Unclassified → Macroalgal Surface1.53%
SeawaterEnvironmental → Aquatic → Marine → Inlet → Unclassified → Seawater0.76%
Microbial MatEnvironmental → Aquatic → Marine → Coastal → Sediment → Microbial Mat0.76%
Sackhole BrineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Sackhole Brine0.76%
MarineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Marine0.76%
MarineEnvironmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine0.76%
Deep SubsurfaceEnvironmental → Aquatic → Marine → Volcanic → Unclassified → Deep Subsurface0.76%
Pond WaterEnvironmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Pond Water0.76%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000115Marine microbial communities from Delaware Coast, sample from Delaware MO Summer July 2011EnvironmentalOpen in IMG/M
3300000116Marine microbial communities from Delaware Coast, sample from Delaware MO Spring March 2010EnvironmentalOpen in IMG/M
3300000947Macroalgal surface ecosystem from Botany Bay, Sydney, Australia - BBAY92Host-AssociatedOpen in IMG/M
3300000973Macroalgal surface ecosystem from Botany Bay, Sydney, Australia - BBAY93Host-AssociatedOpen in IMG/M
3300001460Marine viral communities from the Pacific Ocean - LP-28EnvironmentalOpen in IMG/M
3300004448Marine viral communities from Newfoundland, Canada BC-1EnvironmentalOpen in IMG/M
3300005078Microbial Community from Halfdan Field MHBA5EnvironmentalOpen in IMG/M
3300005086Microbial Community from Halfdan Field MHDA3EnvironmentalOpen in IMG/M
3300006029Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_<0.8_DNAEnvironmentalOpen in IMG/M
3300006637Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_>0.8_DNAEnvironmentalOpen in IMG/M
3300006735Marine viral communities from the Subarctic Pacific Ocean - 5B_ETSP_OMZ_AT15132_CsCl metaGEnvironmentalOpen in IMG/M
3300006749Marine viral communities from the Subarctic Pacific Ocean - 9_ETSP_OMZ_AT15188 metaGEnvironmentalOpen in IMG/M
3300006789Marine viral communities from the Subarctic Pacific Ocean - 16_ETSP_OMZ_AT15313 metaGEnvironmentalOpen in IMG/M
3300006802Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18EnvironmentalOpen in IMG/M
3300006803Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_>0.8_DNAEnvironmentalOpen in IMG/M
3300006810Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01EnvironmentalOpen in IMG/M
3300006869Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_>0.8_DNAEnvironmentalOpen in IMG/M
3300006870Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_>0.8_DNAEnvironmentalOpen in IMG/M
3300006916Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24EnvironmentalOpen in IMG/M
3300006920Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12EnvironmentalOpen in IMG/M
3300007229Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_<0.8_DNAEnvironmentalOpen in IMG/M
3300007236Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_>0.8_DNAEnvironmentalOpen in IMG/M
3300007276Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31EnvironmentalOpen in IMG/M
3300007345Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_30EnvironmentalOpen in IMG/M
3300007538Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaGEnvironmentalOpen in IMG/M
3300007539Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1M Viral MetaGEnvironmentalOpen in IMG/M
3300007640Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_28EnvironmentalOpen in IMG/M
3300008012Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_<0.8_DNAEnvironmentalOpen in IMG/M
3300008219Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_b05EnvironmentalOpen in IMG/M
3300009001Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_C_H2O_MGEnvironmentalOpen in IMG/M
3300009071Pelagic marine microbial communities from North Sea - COGITO_mtgs_120405EnvironmentalOpen in IMG/M
3300009414Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_906EnvironmentalOpen in IMG/M
3300009418Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_s17EnvironmentalOpen in IMG/M
3300009426Pelagic marine microbial communities from North Sea - COGITO_mtgs_100420EnvironmentalOpen in IMG/M
3300009433Pelagic marine microbial communities from North Sea - COGITO_mtgs_100330EnvironmentalOpen in IMG/M
3300009437Pelagic marine microbial communities from North Sea - COGITO_mtgs_110414EnvironmentalOpen in IMG/M
3300009472Pelagic marine microbial communities from North Sea - COGITO_mtgs_110404EnvironmentalOpen in IMG/M
3300009481Deep subsurface microbial communities from Kolumbo volcano to uncover new lineages of life (NeLLi) - 2SBTROV12_ACTIVE470 metaGEnvironmentalOpen in IMG/M
3300009498Pelagic marine microbial communities from North Sea - COGITO_mtgs_120426EnvironmentalOpen in IMG/M
3300009507Pelagic marine microbial communities from North Sea - COGITO_mtgs_120607EnvironmentalOpen in IMG/M
3300009508Pelagic marine microbial communities from North Sea - COGITO_mtgs_120412EnvironmentalOpen in IMG/M
3300009604Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_s16EnvironmentalOpen in IMG/M
3300009605Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_M9EnvironmentalOpen in IMG/M
3300010148Marine viral communities from the Subarctic Pacific Ocean - 9B_ETSP_OMZ_AT15188_CsCl metaGEnvironmentalOpen in IMG/M
3300010300Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.2_DNAEnvironmentalOpen in IMG/M
3300010316Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.8_DNAEnvironmentalOpen in IMG/M
3300010368Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.2_DNAEnvironmentalOpen in IMG/M
3300013010Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.8_DNAEnvironmentalOpen in IMG/M
3300016727Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 011510BT metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300017697Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.2_DNA (version 2)EnvironmentalOpen in IMG/M
3300017714Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 35 SPOT_SRF_2012-08-15EnvironmentalOpen in IMG/M
3300017742Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 22 SPOT_SRF_2011-05-21EnvironmentalOpen in IMG/M
3300017743Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 25 SPOT_SRF_2011-08-17EnvironmentalOpen in IMG/M
3300017752Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 23 SPOT_SRF_2011-06-22EnvironmentalOpen in IMG/M
3300017756Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 5 SPOT_SRF_2009-10-22EnvironmentalOpen in IMG/M
3300017757Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 43 SPOT_SRF_2013-05-22EnvironmentalOpen in IMG/M
3300017762Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 45 SPOT_SRF_2013-07-18EnvironmentalOpen in IMG/M
3300017770Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 15 SPOT_SRF_2010-09-15 (version 2)EnvironmentalOpen in IMG/M
3300017818Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101401AT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300017824Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011501BT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018036Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041406US metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018041Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041407BS metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018413Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011509CT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018415Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011508AT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018416Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011502XT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018417Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011507BT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018420Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011512CT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018423Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071413AT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018424Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071412AT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018428Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101404AT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018876Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011513CT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300020173Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041408US metaG (spades assembly)EnvironmentalOpen in IMG/M
3300020247Marine microbial communities from Tara Oceans - TARA_B100000902 (ERX556048-ERR598962)EnvironmentalOpen in IMG/M
3300020274Marine microbial communities from Tara Oceans - TARA_B100000900 (ERX556029-ERR598943)EnvironmentalOpen in IMG/M
3300020336Marine microbial communities from Tara Oceans - TARA_E500000081 (ERX289008-ERR315860)EnvironmentalOpen in IMG/M
3300020349Marine microbial communities from Tara Oceans - TARA_E500000081 (ERX289006-ERR315859)EnvironmentalOpen in IMG/M
3300020388Marine microbial communities from Tara Oceans - TARA_B100001063 (ERX555965-ERR599064)EnvironmentalOpen in IMG/M
3300021958Estuarine water microbial communities from San Francisco Bay, California, United States - C33_27DEnvironmentalOpen in IMG/M
3300021959Estuarine water microbial communities from San Francisco Bay, California, United States - C33_13DEnvironmentalOpen in IMG/M
3300021960Estuarine water microbial communities from San Francisco Bay, California, United States - C33_9DEnvironmentalOpen in IMG/M
3300021964Estuarine water microbial communities from San Francisco Bay, California, United States - C33_34DEnvironmentalOpen in IMG/M
3300022050Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4 (v3)EnvironmentalOpen in IMG/M
3300022072Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 (v3)EnvironmentalOpen in IMG/M
3300022074Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 56 SPOT_SRF_2014-09-10 (v2)EnvironmentalOpen in IMG/M
3300022164Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 (v2)EnvironmentalOpen in IMG/M
3300022178Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 (v3)EnvironmentalOpen in IMG/M
3300022907Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011511BT metaGEnvironmentalOpen in IMG/M
3300022926Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041412US metaGEnvironmentalOpen in IMG/M
3300022928Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011513CT metaGEnvironmentalOpen in IMG/M
3300022929Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011512CT metaGEnvironmentalOpen in IMG/M
3300024059 (restricted)Seawater microbial communities from Strait of Georgia, British Columbia, Canada - BC1_12_2EnvironmentalOpen in IMG/M
3300024062 (restricted)Seawater microbial communities from Strait of Georgia, British Columbia, Canada - BC1_12_1EnvironmentalOpen in IMG/M
3300025101Marine viral communities from the Subarctic Pacific Ocean - 9_ETSP_OMZ_AT15188 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025120Marine viral communities from the Pacific Ocean - LP-28 (SPAdes)EnvironmentalOpen in IMG/M
3300025137Marine viral communities from the Pacific Ocean - LP-32 (SPAdes)EnvironmentalOpen in IMG/M
3300025280Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_s17 (SPAdes)EnvironmentalOpen in IMG/M
3300025282Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_M9 (SPAdes)EnvironmentalOpen in IMG/M
3300025543Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300025630Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_>0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025652Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 (SPAdes)EnvironmentalOpen in IMG/M
3300025671Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4 (SPAdes)EnvironmentalOpen in IMG/M
3300025674Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1M Viral MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300025769Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 (SPAdes)EnvironmentalOpen in IMG/M
3300025816Pelagic marine microbial communities from North Sea - COGITO_mtgs_100330 (SPAdes)EnvironmentalOpen in IMG/M
3300025870Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI037_S3LV_125m_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300027996 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_6_MGEnvironmentalOpen in IMG/M
3300029448Marine viral communities collected during Tara Oceans survey from station TARA_023 - TARA_E500000082EnvironmentalOpen in IMG/M
3300031519Sea-ice brine microbial communities from Beaufort Sea near Barrow, Alaska, United States - SB 0.2EnvironmentalOpen in IMG/M
3300032277Microbial mat bacterial communities from mineral coupon in-situ incubated in ocean water Damariscotta River, Maine, United States - 3-month pyrrhotiteEnvironmentalOpen in IMG/M
3300034374Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_31 (v4)EnvironmentalOpen in IMG/M
3300034375Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_30 (v4)EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
DelMOSum2011_1015678623300000115MarineMTKSQEFWAWVDQCPDGVYVNHDFTDDEDDQKIHVFGFAVPKEIDDD*
DelMOSpr2010_1001027153300000116MarineMTKSQEFWAWIDQCPDGVYVNHDFTDDEDDQKIHVFGFAVPKEIDDD*
DelMOSpr2010_1004319443300000116MarineVTKSQEFWAWIDQCPDGVYVNHDFTDDEDDQKIHVFGFAVPKEIDDD*
DelMOSpr2010_1011540733300000116MarineMTKSKEFWAWIDQCPDGVYVNHDFTDDEDDQKIHVFGFAVPKEDDCDG*
DelMOSpr2010_1014153743300000116MarineMTKSQEFWAWXDQCPDGVYVNHDFTDDXDDQKIHVFGFAVPKEXDDA*
BBAY92_1011994723300000947Macroalgal SurfaceMTKSQEFWAWIDQCPKGVYVNHDFTDDYDDQLIHVFGFAVPKENEDD*
BBAY93_1019819323300000973Macroalgal SurfaceMTKSQEFWAWIDQCPNGVYVNHDSTDDEDEQNIYVFGFAVPKENEDD*
JGI24003J15210_1014713323300001460MarineMMTKSQEFWAWIDQCPNGVYVNHDFTDDEDDQKIHVFGFAVPKEIDNDDNT*
Ga0065861_105990033300004448MarineMTKSQEFWAWVDQCPDGVYVNHDFTDDEDDQKIHVFGFAVPKEIDDAQV*
Ga0070770_1012801623300005078WaterMTKAQEFWAWIDQCPDGVYVNHDFTDDEDTQKIHVFGFAVPKEIDND*
Ga0072334_1039225523300005086WaterMTKSQEFWAWIDQCPDGVYVNHDFTDDEDDQKIHVFGFAVPKENDNDNT*
Ga0075466_111595513300006029AqueousDQCPDGVYVNHDFTDDEDDQKIHVFGFAVPKEIDDAQV*
Ga0075461_1004627463300006637AqueousVTKSQEFWAWIDQCPDGVYVNHDFTDDEDETYIYVFGFAVPKENDDD*
Ga0098038_100438633300006735MarineMTKSQEFWAWIDQCPDGVYVNHDFTDDEDNQKIHVFGFAVPKETNDDNA*
Ga0098042_104118453300006749MarineMTKSQEFWAWIDTCPDGVYVYHDFTDDEDDQKIHVFGFAVPKENDDDDA*
Ga0098054_133241333300006789MarineMTKSQEFWAWIDTCPDGVYVYHDFTDDEDDQKIHVFGF
Ga0070749_1008266683300006802AqueousMTKSQEFWAWIDRCPDGVYVYHDFTDDEDDQKIHVFGFAVPKEIDNDNA*
Ga0070749_1024418733300006802AqueousMTKAQEFWAWINQCPDGVYVNHDFTDDEDTQKIHVFGFAVPKEIDDDV*
Ga0075467_1052681713300006803AqueousMTKAQEFWAWIDQCPDGVYVNHDFTDDEDTQKIHVFGFAVPKENDNGRTTT*
Ga0070754_1023523653300006810AqueousMTKSQEFWAWVDQCPDGVYVNHDFTDDEDDQKIHVFGFAVPKE
Ga0075477_1016390723300006869AqueousMTKAQEFWAWIDKCPDGVYVNHDFTDDEDDQKIHVFGFAVPKEIDDDV*
Ga0075479_1010800153300006870AqueousMTKAQEFWAWIDQCPDGVYVNHDFTDDEDETYIYVFGFAVPKENDDD*
Ga0070750_1038226333300006916AqueousMTKSQEFWAWVDQCPDGVYVNHDFTDDEDDQKIHVFGFAVPKENDDA*
Ga0070748_136126733300006920AqueousQCPDGVYVNHDFTDDEDDQKIHVFGFAVPKEIDDDNT*
Ga0075468_1011622413300007229AqueousQEFWAWVDQCPDGVYVNHDFTDDEDDQKIHVFGFAVPKEIDDAQV*
Ga0075463_1026962733300007236AqueousMTKSQEFWAWIDQCPDGIYVNHDFTDDEDDQKIHVFGFAVPKETNND*
Ga0070747_107063313300007276AqueousFWAWVDQCPDGVYVNHDFTDDEDDQKIHVFGFAVPKEIDDD*
Ga0070747_118840713300007276AqueousFWAWVDQCPDGVYVNHDFTDDEDDQKIHVFGFAVPKEIDDAQV*
Ga0070752_107593913300007345AqueousQEFWAWIDQCPDGVYVNHDFTDDEDDQKIHVFGFAVPKEIDDD*
Ga0070752_115749143300007345AqueousMFGIQRIRRMMMTKSQEFWAWVDQCPDGVYVNHDFTDDEDDQKIHVFGFAVPKENDDA*
Ga0099851_124460823300007538AqueousVTKSQEFWAWIDQCPDSVYVNHDFTDDEDTQKIHVFGFAVPKEIDDD*
Ga0099849_101530423300007539AqueousMTKSQEFWAWIDQCPDGVYVNHDFTDDEDDQKIHVFGFAVPKEIDDA*
Ga0099849_117958613300007539AqueousMTMTKAQEFWAWIDQCPDGVYVNHDFTDDEDDQKIHVFGFAVPKEIDND*
Ga0099849_133907413300007539AqueousMTMTKAQEFWAWIDQCPDGVYVNHDFTDDEDDQKIHVFGFAVPKEIDDD*
Ga0070751_130854823300007640AqueousVTKSQEFWAWIDQCPDGVYVNHDFTDDEDTQKIHVFEFAVPKEIDDDV*
Ga0075480_1020133023300008012AqueousMFGIQRIRRMMMTKSQEFWAWIDQCPDGVYVNHDFTDDEDDQKIHVFGFAVPKEIDDA*
Ga0114905_105871143300008219Deep OceanMMTKSQEFWAWIDQCPDGVYVNHDFTDDEDDQKIYVFGFAVPKEIDDA*
Ga0102963_100531263300009001Pond WaterMTKAQEFWAWIDQCPDGVYVNHDFTDDEDTQKIHVFGFAVPKEIDNG*
Ga0115566_1029220013300009071Pelagic MarineMMTKAQEFWAWIDQCPDGVYVNHDFTDDEDTQKIHVFGFAVPKEIDDA*
Ga0114909_120416033300009414Deep OceanMFGIQRIRRLMMTKSQEFWAWIDQCPDGVYVNHDFTDDEDDQKIYVFGFAVPKEIDDA*
Ga0114908_119150623300009418Deep OceanMMTKSQEFWAWIDQCPDGVYVNHDFTDDEDDQKIYVFGFAVPKEIDDAQV*
Ga0115547_118077223300009426Pelagic MarineMTKAQEFWAWINQCPNGVYAHHDFTDDKDSQKIHVFEFAVPKENDNDKT*
Ga0115547_118077243300009426Pelagic MarineMFGIQRIRRIMMTKSQEFWAWIDQCPDGVYVNHDFTDDEDDQKIHVFGFAVPKENDDD*
Ga0115545_123496123300009433Pelagic MarineMTKSQEFWAWIDQCPDGVYVNHDFTDDEDDQKIHVFGFAVPKENDDD*
Ga0115556_126335923300009437Pelagic MarineMMMTKSQEFWAWINQCPDGVYAHHDFTDDEDDQKIHVFGFAVPKENDDA*
Ga0115554_135213933300009472Pelagic MarineMTKSQEFWAWIDKCPDGVYVYHDFTDDEDDQKIHVFGFTVPKENDND*
Ga0114932_1032270753300009481Deep SubsurfaceMTKSQEFWAWIDQCPDGVYVYHDFTDDEDTQKIHVFGFAVPKEIDDD*
Ga0115568_1037853623300009498Pelagic MarineMTKSQEFWAWIDQCPDGVYVNHDFTDDEDDQKIHVFGFAVPKEIDNDDA*
Ga0115572_1031530423300009507Pelagic MarineMTKSQEFWAWIDQCPDGVYVNHDFTDDEDDQKIYVFGFAVPKEIDDA*
Ga0115567_1085219233300009508Pelagic MarineMTKSQEFWTWIDQCPDGVYVNHDFTDDEDDQKIHVFGFAV
Ga0114901_104418723300009604Deep OceanMMTKSQEFWAWIDQCPDGVYVNHDFTDDEDDQKIHVFGFAVPKEIDDAQV*
Ga0114906_114578143300009605Deep OceanMTKSQEFWAWIDQCPDGVYVNHDFTDDEDDQKIYVFGFAVPKEIDDAQV*
Ga0098043_116605013300010148MarineMTKSQEFWAWIDQCTDGVYVNHDFTDDEDNQKIHVFGFAVPKETNDDNA*
Ga0129351_110400733300010300Freshwater To Marine Saline GradientMTKSQEFWAWIDQCPDGVYVNHDFTDDEDDQKIHVFGFAVPKEIDDAQV*
Ga0136655_113354523300010316Freshwater To Marine Saline GradientMTKAQEFWAWIDQCPDGVYVNHDFTDDEDDQKIHVFGFAVPKETN*
Ga0129324_1021850153300010368Freshwater To Marine Saline GradientMMTKSQEFWAWVDQCPDGVYVNHDFTDDEDDQKIHVFGFAVPKEIDDD*
Ga0129327_1013179613300013010Freshwater To Marine Saline GradientSQEFWAWVDQCPDGVYVNHDFTDDEDDQKIHVFGFAVPKENDNDNT*
Ga0182051_104073133300016727Salt MarshMTKAQEFWAWINQCPDGVYVNHDFTDHEDDQKIHVFGFAVPKEIDND
Ga0180120_10020836113300017697Freshwater To Marine Saline GradientMTKSQEFWAWIDQCPDGVYVNHDFTDDEDDQKIHVFGFAVPKEI
Ga0180120_1034988113300017697Freshwater To Marine Saline GradientEFWAWVDQCPDGVYVNHDFTDDEDDQKIHVFGFAVPKEIDDD
Ga0180120_1042315533300017697Freshwater To Marine Saline GradientMTKSQEFWAWVDQCPDGVYVNHDFTDDEDDQKIHVFGFAVPKEID
Ga0181412_104233843300017714SeawaterMTKSQEFWAWIDQCPDGVYVNHDFTDDEDDQKIHVFGFAVPKENDND
Ga0181399_100654073300017742SeawaterMTKSQEFWAWIDKCPDGVYVYHDFTDDEDDQKIHVFGFAVPKENDNDDA
Ga0181402_119593113300017743SeawaterMTKSQEFWAWIDQCPDGVYVNHDFTDDEDDQKIHVFGFAVPKENDDA
Ga0181400_112899733300017752SeawaterECPDGVYAHHDFTDDEAKQKVHVFGFAVPKENDDATE
Ga0181382_115986213300017756SeawaterAWIDQCPDGVYVNHDFTDDEDDQKIHVFGFAVPKENDDA
Ga0181420_1004948123300017757SeawaterMTKSQEFWAWIDQCPDGVYVNHDFTDDEDDQKIHVFGFAV
Ga0181422_119113823300017762SeawaterMTKSQEFWAWIDQCPDGVYVNHDFTDDEDDQKIHVFGFAVLKETDNDNT
Ga0187217_123565423300017770SeawaterMSKSQEFWAWIDQCPDGIYVNHDFTDDEDDQKIHVFGFAVPKEETTDD
Ga0181565_1079391323300017818Salt MarshMMQQGKCEKAFWEWIDQCPKGIYVNHDFTDDEDHQKIHVFGFAVPKEDEDE
Ga0181552_1013146463300017824Salt MarshMTKAQEFWAWINQCPDGVYVHHDFTDDEDEQKIHVFGFAVPKENDNDKT
Ga0181600_1035379133300018036Salt MarshMTKAQEFWAWIDQCPDGVYVHHDFTDDEDEQKIHVFGFSVPKENDNDKT
Ga0181601_1027130933300018041Salt MarshMTKAQEFWAWINQCPDGVYVNHDFTDDEDTQKIHVFGFAVPKEIDDDV
Ga0181560_1039108713300018413Salt MarshIIHERRFVMTKAQEFWAWINQCPDGVYVNHDFTDDEDDQKIHVFGFAVPKETDDDV
Ga0181559_1067809843300018415Salt MarshMTKAQEFWAWINQCPDGVYVNHDFTDDEDTQKIHVFGFAVP
Ga0181553_10012968133300018416Salt MarshMTKAQEFWAWIDQCPDGVYVHHDFTDDEDEQKIHVFGFAVPKENDNDKT
Ga0181553_1027736033300018416Salt MarshMTKAQEFWAWINQCPDGVYVNHDFTDDEDDQKIHVFGFAVPKETDDDV
Ga0181553_1066924623300018416Salt MarshMTKAQEFWAWINECPDGVYVNHDFTDDEDTQKIHVFGFAVPKENDDD
Ga0181558_1043546523300018417Salt MarshMTKAQEFWAWINQCPDGVYVNHDFTDDEDDQKIHVFGFAVPKEIDND
Ga0181563_1071733223300018420Salt MarshMTKEQEFWAWINQCPDGVYVNHDFTDDEDTQKIHVFGFAVPKET
Ga0181593_1066145613300018423Salt MarshMMQQGKCEKAFWEWIEQCPEGIYVNHDFTDDEDHQKIHVFGFAVPKEAEDE
Ga0181591_1058966523300018424Salt MarshMTKAQEFWAWINQCPDGVYVNHDFTDDEDTQKIHVFGFAVPKENDDD
Ga0181568_1106694713300018428Salt MarshMMQQGKCEKAFWKWIDQCPKGIYVNHDFTDDEDHQKIHVFGFAVPKEAEDE
Ga0181564_1049369523300018876Salt MarshMTKAQEFWAWINQCPDGVYAHHDFTDDEDTQKIHVFGFAVPKENDDD
Ga0181602_1033274313300020173Salt MarshFVMTKAQEFWAWINQCPDGVYVNHDFTDDEDTQKIHVFGFAVPKENDNAD
Ga0211654_1000268123300020247MarineMTKSQEFWAWINQCPDGVYVNHDFTDDEDNQKIHVFGFAVPKENDNDDT
Ga0211658_108101413300020274MarineCPDGVYVNHDFTDDEDNQKIHVFGFAVPKENDNDDT
Ga0211510_103039043300020336MarineMTKAQEFWAWIDQCPDGVYVNHDFTDDEDTQKIHVFGFAVPKENDNDDA
Ga0211511_103861573300020349MarineMTKAQEFWAWIDQCPDGVYINHDFTDDEDDQKIHV
Ga0211678_1029319323300020388MarineMMTKSQEFWAWIDQCPDGVYVNHDFTDDEDDQKIHVFGFAVPKETDNDNT
Ga0222718_1043266713300021958Estuarine WaterMTKAQEFWAWIDQCPDGVYVNHDFTDDEDTQKIHVFGFAVPKKNDNA
Ga0222716_1018574113300021959Estuarine WaterMTKAQEFWAWIDQCPDGVYVNHDFTDDEDTQKIHVFGFAVPKEIDND
Ga0222715_1006540053300021960Estuarine WaterMTKAQEFWAWINQCPDGVYVNHDFTDDEDTQKIHVFGFAVPKEIDND
Ga0222719_1023593813300021964Estuarine WaterMTKAQEFWAWIDQCPDGVYVNHDFTDDEDTQKIHVFGFAVPKEIDNG
Ga0196883_102335223300022050AqueousMTKAQEFWAWIDKCPDGVYVNHDFTDDEDDQKIHVFGFAVPKETNND
Ga0196889_106466723300022072AqueousMTKSQEFWAWVDQCPDGVYVNHDFTDDEDDQKIHVFGFAVPKEIDDAQV
Ga0224906_103373593300022074SeawaterMTKSQEFWAWIDQCPDGVYVNHDFTDDEDDQKIHVFGFAVPKEIEDD
Ga0212022_105064123300022164AqueousVTKSQEFWAWIDQCPDGVYVNHDFTDDEDDQKIHVFGFAVPKEIDDD
Ga0196887_107829513300022178AqueousKSQEFWAWVDQCPDGVYVNHDFTDDEDDQKIHVFGFAVPKENDNDNT
Ga0196887_111241333300022178AqueousMTKSQEFWAWVDQCPDGVYVNHDFTDDEDDQKIHVFGFAVPK
Ga0196887_112443713300022178AqueousLRCGIQRIRRLMMTKSQEFWAWVDQCPDGVYVNHDFTDDEDDQKIHVFGFAVPKEIDDAQ
Ga0255775_122223013300022907Salt MarshMTKAQEFWAWINECPDGVYVNHDFTDDEDDQKIHVFGFAVPKETDDDV
Ga0255753_129735023300022926Salt MarshMTKAQEFWAWINQCPDGVYVNHDFTDDEDTQKIHVFGFAVPKENDNAD
Ga0255758_1027257133300022928Salt MarshMTKAQEFWAWINQCPDGVYVNHDFTDDEDDQKIHVFGFAVPK
Ga0255752_1005406043300022929Salt MarshMTKAQEFWAWINQCPDGVYVNHDFTDDEDDQKIHVFGFAVPKEIDNDV
Ga0255752_1008557933300022929Salt MarshMTKAQEFWAWINQCPDGVYVNHDFTDDEDTQKIHVFGFAVPKETDDDV
Ga0255752_1021608763300022929Salt MarshMTKAQEFWAWINECPDGVYVNHDFTDDEDTQKIHVFGF
(restricted) Ga0255040_1007104933300024059SeawaterMTKSQEFWAWIDQCPDGVYVHHDFTDDDDNQKIHVFGFAVPKENDDD
(restricted) Ga0255039_1003696283300024062SeawaterMTKSQEFWAWIDQCPDGVYVNHDFTDDEDDQKIYVFGFAVPKENDDD
Ga0208159_101863823300025101MarineMTKSQEFWAWIDTCPDGVYVYHDFTDDEDDQKIHVFGFAVPKENDDDDA
Ga0209535_105752333300025120MarineMSKSQEFWAWIDQCPDGIYVNHDFTDDEDDQKIHVFGFAVPKEETTND
Ga0209336_1014873313300025137MarineYLLRRQPMSKSQEFWAWIDQCPDGIYVNHDFTDDEDDQKIHVFGFAVPKEETTND
Ga0208449_108894833300025280Deep OceanMTKSQEFWAWIDKCPDGVYVNHDFTDDEDDQKIYVFGFAVPKEIDDAQV
Ga0208030_112763733300025282Deep OceanMTKSQEFWAWIDQCPDGVYVNHDFTDDEDDQKIYVFGFAVPKEIDDAQV
Ga0208303_104409233300025543AqueousVTKSQEFWAWIDQCPDGVYVNHDFTDDEDDQKIHVFGFAVPKEIDDAQV
Ga0208004_110869033300025630AqueousVTKSQEFWAWIDQCPDGVYVNHDFTDDEDETYIYVFGFAVPKENDDD
Ga0208134_110030953300025652AqueousFWAWVDQCPDGVYVNHDFTDDEDDQKIHVFGFAVPKEIDDD
Ga0208898_110865733300025671AqueousVTKSQEFWAWIDQCPDGVYVNHDFTDDEDDQKIHVFGFAVPKEIDNDNA
Ga0208162_1019817103300025674AqueousMTKSQEFWAWIDQCPDGVYVNHDFTDDEDDQKIHVFGFAVPKEIDDA
Ga0208162_102291823300025674AqueousMTKAQEFWAWIDQCPDGVYVNHDFTDDEDDQKIHVFGFAVPKEIDDD
Ga0208767_117762923300025769AqueousMTKSQEFWAWVDQCPDGVYVNHDFTDDEDDQKIHVFGFAVPKEIDDA
Ga0209193_101824553300025816Pelagic MarineMTKSQEFWAWIDQCPDGVYAHHDFTDDEDTQKIHVFGFAVPKEIDND
Ga0209666_102477933300025870MarineMTKSQEFWAWIDQCPDGVYVNHDFTDDEDDQKIHVFGFAVPKENDNV
(restricted) Ga0233413_1042526013300027996SeawaterDQCPDGVYVNHDFTDDEDNQKIHVFGFAVPKENDND
Ga0183755_1000211363300029448MarineMTKSQEFWAWVDQCPDGVYINHDFTDDEDDQKIHVFGFAVPKEIDND
Ga0183755_106935123300029448MarineMTKSQEFWAWIDQCPDGVYVYHDFTDDEDTQKIHVFGFAVPKEIDDD
Ga0307488_1076555033300031519Sackhole BrineMTKSQEFWEWIDKCPDGVYVYHDFTDDEDDQKIHVFGFTVPKENED
Ga0316202_1030963333300032277Microbial MatMTKSQEFWAWVDQCPDGVYVNHDFTDDEDDQKIHVFGFAVPKENDDA
Ga0348335_113799_137_2833300034374AqueousMTKAQEFWAWINQCPDGVYVNHDFTDDEDTQKIHVFGFAVPKENDNDV
Ga0348336_006071_573_7163300034375AqueousMTKSQEFWAWIDQCPDGVYVNHDFTDDEDDQKIHVFGFAVPKEIDDD
Ga0348336_129711_524_6673300034375AqueousMTKSQEFWAWIDQCPDGIYVNHDFTDDEDDQKIHVFGFAVPKEIDND

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.