| Basic Information | |
|---|---|
| Family ID | F061721 |
| Family Type | Metagenome |
| Number of Sequences | 131 |
| Average Sequence Length | 37 residues |
| Representative Sequence | MGALMSGMLILMVAAFLLVTGIAVMAYRRRKREAGD |
| Number of Associated Samples | 88 |
| Number of Associated Scaffolds | 131 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 88.98 % |
| % of genes near scaffold ends (potentially truncated) | 7.63 % |
| % of genes from short scaffolds (< 2000 bps) | 68.70 % |
| Associated GOLD sequencing projects | 76 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.50 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (92.366 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (37.405 % of family members) |
| Environment Ontology (ENVO) | Unclassified (51.145 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (56.489 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 53.12% β-sheet: 0.00% Coil/Unstructured: 46.88% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.50 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 131 Family Scaffolds |
|---|---|---|
| PF03626 | COX4_pro | 38.93 |
| PF00510 | COX3 | 12.21 |
| PF02566 | OsmC | 9.16 |
| PF02954 | HTH_8 | 5.34 |
| PF00115 | COX1 | 3.05 |
| PF00903 | Glyoxalase | 2.29 |
| PF13633 | Obsolete Pfam Family | 2.29 |
| PF12681 | Glyoxalase_2 | 2.29 |
| PF04892 | VanZ | 1.53 |
| PF14489 | QueF | 1.53 |
| PF06508 | QueC | 1.53 |
| PF01925 | TauE | 0.76 |
| PF00072 | Response_reg | 0.76 |
| PF13426 | PAS_9 | 0.76 |
| PF00034 | Cytochrom_C | 0.76 |
| PF13620 | CarboxypepD_reg | 0.76 |
| PF13533 | Biotin_lipoyl_2 | 0.76 |
| PF01872 | RibD_C | 0.76 |
| PF01648 | ACPS | 0.76 |
| PF13442 | Cytochrome_CBB3 | 0.76 |
| PF01810 | LysE | 0.76 |
| COG ID | Name | Functional Category | % Frequency in 131 Family Scaffolds |
|---|---|---|---|
| COG3125 | Heme/copper-type cytochrome/quinol oxidase, subunit 4 | Energy production and conversion [C] | 38.93 |
| COG1845 | Heme/copper-type cytochrome/quinol oxidase, subunit 3 | Energy production and conversion [C] | 12.21 |
| COG1764 | Organic hydroperoxide reductase OsmC/OhrA | Defense mechanisms [V] | 9.16 |
| COG1765 | Uncharacterized OsmC-related protein | General function prediction only [R] | 9.16 |
| COG0037 | tRNA(Ile)-lysidine synthase TilS/MesJ | Translation, ribosomal structure and biogenesis [J] | 1.53 |
| COG0137 | Argininosuccinate synthase | Amino acid transport and metabolism [E] | 1.53 |
| COG0171 | NH3-dependent NAD+ synthetase | Coenzyme transport and metabolism [H] | 1.53 |
| COG0301 | Adenylyl- and sulfurtransferase ThiI (thiamine and tRNA 4-thiouridine biosynthesis) | Translation, ribosomal structure and biogenesis [J] | 1.53 |
| COG0482 | tRNA U34 2-thiouridine synthase MnmA/TrmU, contains the PP-loop ATPase domain | Translation, ribosomal structure and biogenesis [J] | 1.53 |
| COG0519 | GMP synthase, PP-ATPase domain/subunit | Nucleotide transport and metabolism [F] | 1.53 |
| COG0603 | 7-cyano-7-deazaguanine synthase (queuosine biosynthesis) | Translation, ribosomal structure and biogenesis [J] | 1.53 |
| COG0780 | NADPH-dependent 7-cyano-7-deazaguanine reductase QueF, C-terminal domain, T-fold superfamily | Translation, ribosomal structure and biogenesis [J] | 1.53 |
| COG1606 | ATP-utilizing enzyme, PP-loop superfamily | General function prediction only [R] | 1.53 |
| COG0262 | Dihydrofolate reductase | Coenzyme transport and metabolism [H] | 0.76 |
| COG0730 | Sulfite exporter TauE/SafE/YfcA and related permeases, UPF0721 family | Inorganic ion transport and metabolism [P] | 0.76 |
| COG1985 | Pyrimidine reductase, riboflavin biosynthesis | Coenzyme transport and metabolism [H] | 0.76 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 92.37 % |
| Unclassified | root | N/A | 7.63 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300005540|Ga0066697_10008640 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 5149 | Open in IMG/M |
| 3300005540|Ga0066697_10025595 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 3238 | Open in IMG/M |
| 3300005552|Ga0066701_10004402 | All Organisms → cellular organisms → Bacteria | 5687 | Open in IMG/M |
| 3300005552|Ga0066701_10129959 | All Organisms → cellular organisms → Bacteria | 1500 | Open in IMG/M |
| 3300005554|Ga0066661_10008285 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 5058 | Open in IMG/M |
| 3300005555|Ga0066692_10677623 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium | 641 | Open in IMG/M |
| 3300005555|Ga0066692_10844193 | Not Available | 562 | Open in IMG/M |
| 3300005556|Ga0066707_10015726 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 3886 | Open in IMG/M |
| 3300005557|Ga0066704_10032733 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 3183 | Open in IMG/M |
| 3300005558|Ga0066698_10032568 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 3176 | Open in IMG/M |
| 3300005558|Ga0066698_10177381 | All Organisms → cellular organisms → Bacteria | 1451 | Open in IMG/M |
| 3300005559|Ga0066700_10440437 | All Organisms → cellular organisms → Bacteria | 915 | Open in IMG/M |
| 3300005560|Ga0066670_10379839 | All Organisms → cellular organisms → Bacteria | 863 | Open in IMG/M |
| 3300005561|Ga0066699_10470313 | All Organisms → cellular organisms → Bacteria | 899 | Open in IMG/M |
| 3300006794|Ga0066658_10002850 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Eubacteriales incertae sedis → Clostridiales Family XVII. Incertae Sedis → Thermaerobacter | 6126 | Open in IMG/M |
| 3300006794|Ga0066658_10939497 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae | 501 | Open in IMG/M |
| 3300006797|Ga0066659_11094083 | All Organisms → cellular organisms → Bacteria | 666 | Open in IMG/M |
| 3300006797|Ga0066659_11206844 | All Organisms → cellular organisms → Bacteria | 632 | Open in IMG/M |
| 3300006797|Ga0066659_11343124 | Not Available | 596 | Open in IMG/M |
| 3300006800|Ga0066660_10320409 | All Organisms → cellular organisms → Bacteria | 1246 | Open in IMG/M |
| 3300006806|Ga0079220_10488870 | All Organisms → cellular organisms → Bacteria | 837 | Open in IMG/M |
| 3300007255|Ga0099791_10629686 | All Organisms → cellular organisms → Bacteria | 525 | Open in IMG/M |
| 3300007258|Ga0099793_10123911 | All Organisms → cellular organisms → Bacteria | 1210 | Open in IMG/M |
| 3300007258|Ga0099793_10392638 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 681 | Open in IMG/M |
| 3300009012|Ga0066710_101047101 | All Organisms → cellular organisms → Bacteria | 1260 | Open in IMG/M |
| 3300009137|Ga0066709_100881510 | All Organisms → cellular organisms → Bacteria | 1302 | Open in IMG/M |
| 3300009137|Ga0066709_103089131 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium 13_1_40CM_4_65_7 | 609 | Open in IMG/M |
| 3300009137|Ga0066709_103516730 | All Organisms → cellular organisms → Bacteria | 568 | Open in IMG/M |
| 3300010304|Ga0134088_10125875 | All Organisms → cellular organisms → Bacteria | 1214 | Open in IMG/M |
| 3300010335|Ga0134063_10068201 | All Organisms → cellular organisms → Bacteria | 1579 | Open in IMG/M |
| 3300010335|Ga0134063_10261107 | All Organisms → cellular organisms → Bacteria | 826 | Open in IMG/M |
| 3300010335|Ga0134063_10283655 | All Organisms → cellular organisms → Bacteria | 794 | Open in IMG/M |
| 3300010336|Ga0134071_10101992 | All Organisms → cellular organisms → Bacteria | 1363 | Open in IMG/M |
| 3300010336|Ga0134071_10104912 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1346 | Open in IMG/M |
| 3300012198|Ga0137364_10008248 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 5800 | Open in IMG/M |
| 3300012198|Ga0137364_10360266 | All Organisms → cellular organisms → Bacteria | 1085 | Open in IMG/M |
| 3300012200|Ga0137382_10292020 | All Organisms → cellular organisms → Bacteria | 1136 | Open in IMG/M |
| 3300012203|Ga0137399_10105072 | All Organisms → cellular organisms → Bacteria | 2192 | Open in IMG/M |
| 3300012203|Ga0137399_10143889 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1897 | Open in IMG/M |
| 3300012203|Ga0137399_10218260 | All Organisms → cellular organisms → Bacteria | 1554 | Open in IMG/M |
| 3300012203|Ga0137399_10573411 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 948 | Open in IMG/M |
| 3300012203|Ga0137399_11741090 | Not Available | 512 | Open in IMG/M |
| 3300012204|Ga0137374_10011514 | All Organisms → cellular organisms → Bacteria | 10347 | Open in IMG/M |
| 3300012206|Ga0137380_10000023 | All Organisms → cellular organisms → Bacteria | 91643 | Open in IMG/M |
| 3300012206|Ga0137380_10106528 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 2562 | Open in IMG/M |
| 3300012206|Ga0137380_10596780 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 966 | Open in IMG/M |
| 3300012206|Ga0137380_10697181 | All Organisms → cellular organisms → Bacteria | 882 | Open in IMG/M |
| 3300012207|Ga0137381_10043983 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 3665 | Open in IMG/M |
| 3300012209|Ga0137379_10325547 | All Organisms → cellular organisms → Bacteria | 1447 | Open in IMG/M |
| 3300012210|Ga0137378_10427396 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1228 | Open in IMG/M |
| 3300012211|Ga0137377_10193134 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1954 | Open in IMG/M |
| 3300012285|Ga0137370_10175553 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1249 | Open in IMG/M |
| 3300012349|Ga0137387_10037595 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 3165 | Open in IMG/M |
| 3300012349|Ga0137387_10190281 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 1472 | Open in IMG/M |
| 3300012351|Ga0137386_10318489 | All Organisms → cellular organisms → Bacteria | 1119 | Open in IMG/M |
| 3300012351|Ga0137386_10492853 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 883 | Open in IMG/M |
| 3300012356|Ga0137371_11260743 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 549 | Open in IMG/M |
| 3300012357|Ga0137384_10392626 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1146 | Open in IMG/M |
| 3300012582|Ga0137358_10000080 | All Organisms → cellular organisms → Bacteria | 30620 | Open in IMG/M |
| 3300012683|Ga0137398_10387063 | All Organisms → cellular organisms → Bacteria | 951 | Open in IMG/M |
| 3300012918|Ga0137396_10024143 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 3946 | Open in IMG/M |
| 3300012922|Ga0137394_10106481 | All Organisms → cellular organisms → Bacteria | 2365 | Open in IMG/M |
| 3300012922|Ga0137394_10253314 | All Organisms → cellular organisms → Bacteria | 1505 | Open in IMG/M |
| 3300012923|Ga0137359_11326829 | All Organisms → cellular organisms → Bacteria | 607 | Open in IMG/M |
| 3300012925|Ga0137419_10027053 | All Organisms → cellular organisms → Bacteria | 3455 | Open in IMG/M |
| 3300012927|Ga0137416_10094295 | All Organisms → cellular organisms → Bacteria | 2235 | Open in IMG/M |
| 3300012929|Ga0137404_10174953 | All Organisms → cellular organisms → Bacteria | 1802 | Open in IMG/M |
| 3300012929|Ga0137404_10417590 | All Organisms → cellular organisms → Bacteria | 1185 | Open in IMG/M |
| 3300012929|Ga0137404_11167571 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 708 | Open in IMG/M |
| 3300012944|Ga0137410_10249177 | All Organisms → cellular organisms → Bacteria | 1391 | Open in IMG/M |
| 3300012944|Ga0137410_10733294 | Not Available | 825 | Open in IMG/M |
| 3300012975|Ga0134110_10031164 | All Organisms → cellular organisms → Bacteria | 2084 | Open in IMG/M |
| 3300012977|Ga0134087_10029217 | All Organisms → cellular organisms → Bacteria | 2073 | Open in IMG/M |
| 3300014150|Ga0134081_10020743 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1847 | Open in IMG/M |
| 3300015052|Ga0137411_1004084 | All Organisms → cellular organisms → Bacteria | 525 | Open in IMG/M |
| 3300015245|Ga0137409_10008671 | All Organisms → cellular organisms → Bacteria | 10375 | Open in IMG/M |
| 3300015245|Ga0137409_11358246 | All Organisms → cellular organisms → Bacteria | 554 | Open in IMG/M |
| 3300015357|Ga0134072_10013164 | All Organisms → cellular organisms → Bacteria | 1953 | Open in IMG/M |
| 3300017656|Ga0134112_10010198 | All Organisms → cellular organisms → Bacteria | 3101 | Open in IMG/M |
| 3300017656|Ga0134112_10063526 | All Organisms → cellular organisms → Bacteria | 1354 | Open in IMG/M |
| 3300018027|Ga0184605_10000294 | All Organisms → cellular organisms → Bacteria | 14658 | Open in IMG/M |
| 3300018071|Ga0184618_10093450 | All Organisms → cellular organisms → Bacteria | 1169 | Open in IMG/M |
| 3300018431|Ga0066655_10356234 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 961 | Open in IMG/M |
| 3300018433|Ga0066667_10032171 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 2964 | Open in IMG/M |
| 3300018433|Ga0066667_10034763 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 2881 | Open in IMG/M |
| 3300018433|Ga0066667_11773432 | All Organisms → cellular organisms → Bacteria | 557 | Open in IMG/M |
| 3300018468|Ga0066662_10298012 | All Organisms → cellular organisms → Bacteria | 1353 | Open in IMG/M |
| 3300018468|Ga0066662_11319553 | Not Available | 741 | Open in IMG/M |
| 3300018468|Ga0066662_11560349 | All Organisms → cellular organisms → Bacteria | 688 | Open in IMG/M |
| 3300018468|Ga0066662_12392619 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 556 | Open in IMG/M |
| 3300018482|Ga0066669_10025852 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 3379 | Open in IMG/M |
| 3300018482|Ga0066669_11907531 | Not Available | 553 | Open in IMG/M |
| 3300020170|Ga0179594_10000769 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 7047 | Open in IMG/M |
| 3300020170|Ga0179594_10341191 | All Organisms → cellular organisms → Bacteria | 568 | Open in IMG/M |
| 3300024330|Ga0137417_1162486 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 2169 | Open in IMG/M |
| 3300026277|Ga0209350_1015668 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 2377 | Open in IMG/M |
| 3300026295|Ga0209234_1058414 | All Organisms → cellular organisms → Bacteria | 1467 | Open in IMG/M |
| 3300026296|Ga0209235_1002145 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 10973 | Open in IMG/M |
| 3300026296|Ga0209235_1087639 | All Organisms → cellular organisms → Bacteria | 1372 | Open in IMG/M |
| 3300026296|Ga0209235_1141848 | All Organisms → cellular organisms → Bacteria | 973 | Open in IMG/M |
| 3300026301|Ga0209238_1010490 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 3629 | Open in IMG/M |
| 3300026301|Ga0209238_1274459 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 506 | Open in IMG/M |
| 3300026309|Ga0209055_1002616 | All Organisms → cellular organisms → Bacteria | 11300 | Open in IMG/M |
| 3300026313|Ga0209761_1110964 | All Organisms → cellular organisms → Bacteria | 1351 | Open in IMG/M |
| 3300026315|Ga0209686_1046128 | All Organisms → cellular organisms → Bacteria | 1610 | Open in IMG/M |
| 3300026325|Ga0209152_10267082 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 636 | Open in IMG/M |
| 3300026330|Ga0209473_1169809 | All Organisms → cellular organisms → Bacteria | 863 | Open in IMG/M |
| 3300026524|Ga0209690_1002272 | All Organisms → cellular organisms → Bacteria | 10969 | Open in IMG/M |
| 3300026529|Ga0209806_1236723 | All Organisms → cellular organisms → Bacteria | 617 | Open in IMG/M |
| 3300026536|Ga0209058_1079731 | All Organisms → cellular organisms → Bacteria | 1722 | Open in IMG/M |
| 3300026547|Ga0209156_10002719 | All Organisms → cellular organisms → Bacteria | 13739 | Open in IMG/M |
| 3300026552|Ga0209577_10034064 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 4407 | Open in IMG/M |
| 3300026557|Ga0179587_10421370 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 872 | Open in IMG/M |
| 3300027383|Ga0209213_1019461 | All Organisms → cellular organisms → Bacteria | 1265 | Open in IMG/M |
| 3300027480|Ga0208993_1022283 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1116 | Open in IMG/M |
| 3300027643|Ga0209076_1116036 | All Organisms → cellular organisms → Bacteria | 757 | Open in IMG/M |
| 3300027669|Ga0208981_1073434 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 872 | Open in IMG/M |
| 3300027681|Ga0208991_1153666 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 679 | Open in IMG/M |
| 3300027748|Ga0209689_1385121 | All Organisms → cellular organisms → Bacteria | 536 | Open in IMG/M |
| 3300028536|Ga0137415_11383931 | All Organisms → cellular organisms → Bacteria | 524 | Open in IMG/M |
| 3300028792|Ga0307504_10206876 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 698 | Open in IMG/M |
| 3300031152|Ga0307501_10038941 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1015 | Open in IMG/M |
| 3300031152|Ga0307501_10049421 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 935 | Open in IMG/M |
| 3300031720|Ga0307469_11224590 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 710 | Open in IMG/M |
| 3300031720|Ga0307469_12185411 | All Organisms → cellular organisms → Bacteria | 539 | Open in IMG/M |
| 3300032180|Ga0307471_100772370 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1127 | Open in IMG/M |
| 3300032180|Ga0307471_101267148 | All Organisms → cellular organisms → Bacteria | 900 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 37.40% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 25.19% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 16.79% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 9.16% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 3.05% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 3.05% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.29% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.53% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.76% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.76% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300005172 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 | Environmental | Open in IMG/M |
| 3300005540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 | Environmental | Open in IMG/M |
| 3300005552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 | Environmental | Open in IMG/M |
| 3300005553 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 | Environmental | Open in IMG/M |
| 3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
| 3300005555 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 | Environmental | Open in IMG/M |
| 3300005556 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 | Environmental | Open in IMG/M |
| 3300005557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 | Environmental | Open in IMG/M |
| 3300005558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 | Environmental | Open in IMG/M |
| 3300005559 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 | Environmental | Open in IMG/M |
| 3300005560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119 | Environmental | Open in IMG/M |
| 3300005561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 | Environmental | Open in IMG/M |
| 3300006794 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
| 3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300010304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09182015 | Environmental | Open in IMG/M |
| 3300010335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015 | Environmental | Open in IMG/M |
| 3300010336 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09082015 | Environmental | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012204 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
| 3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
| 3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012975 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_11112015 | Environmental | Open in IMG/M |
| 3300012977 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300014150 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300015052 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015245 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015357 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_0_1 metaG | Environmental | Open in IMG/M |
| 3300017656 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_11112015 | Environmental | Open in IMG/M |
| 3300018027 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_coex | Environmental | Open in IMG/M |
| 3300018071 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_b1 | Environmental | Open in IMG/M |
| 3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300020170 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300024330 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300026277 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_2_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026295 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026296 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026301 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026309 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 (SPAdes) | Environmental | Open in IMG/M |
| 3300026313 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026315 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 (SPAdes) | Environmental | Open in IMG/M |
| 3300026325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 (SPAdes) | Environmental | Open in IMG/M |
| 3300026330 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 (SPAdes) | Environmental | Open in IMG/M |
| 3300026343 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 (SPAdes) | Environmental | Open in IMG/M |
| 3300026524 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 (SPAdes) | Environmental | Open in IMG/M |
| 3300026529 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 (SPAdes) | Environmental | Open in IMG/M |
| 3300026536 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 (SPAdes) | Environmental | Open in IMG/M |
| 3300026547 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 (SPAdes) | Environmental | Open in IMG/M |
| 3300026552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes) | Environmental | Open in IMG/M |
| 3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300027383 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM1_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027480 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM2_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027643 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027669 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM1_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027681 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM3_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027748 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 (SPAdes) | Environmental | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300028792 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 19_S | Environmental | Open in IMG/M |
| 3300031152 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 15_S | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| Ga0066683_105063692 | 3300005172 | Soil | GGGALAVMRAMLTGMLILMVPAFLLVTGIAVMAYRKRGARRSTS* |
| Ga0066697_100086407 | 3300005540 | Soil | MLTGMLILMVPAFLLVTGIAVMAYRKRGARRSTS* |
| Ga0066697_100255955 | 3300005540 | Soil | MGGLMSGMLILMVASFLLVSGIAVMAYRRRKREAGD* |
| Ga0066701_100044026 | 3300005552 | Soil | MGAMLNGMVILIVPAFLLVTGIAVMAYRRRKSRAGD* |
| Ga0066701_101299593 | 3300005552 | Soil | MGALMSGMLILMVAAFLLVTGIAVMAYRRRKREAGD* |
| Ga0066701_104171683 | 3300005552 | Soil | MGALMGGMLILMVPAFLLVTGIAVMAYRKRGARRSTS* |
| Ga0066695_105105552 | 3300005553 | Soil | GGGALAVMRAMLTGMLILMVPAFLLVTGIAVMAYRKRGARRNAS* |
| Ga0066661_100082854 | 3300005554 | Soil | MGMGALMSGMAILTVAAFLLVTGIAVMAYRRSKRGAPD* |
| Ga0066692_106776232 | 3300005555 | Soil | MGALMSGMLILMVAAFLLVTGIAVMAYRRRKREAGE* |
| Ga0066692_108441932 | 3300005555 | Soil | MGAMMSGMVILTVAAGLVVTGIAVMAYRRGRNDPGD* |
| Ga0066707_100157265 | 3300005556 | Soil | MGGLMSGMLILMVASFLLVTGIAVMAYRRRKREAGD* |
| Ga0066704_100327335 | 3300005557 | Soil | MGAMLSGMLILMVAAFLLVTGIAVMAYRRSKRGVGD* |
| Ga0066698_100325685 | 3300005558 | Soil | MDMAALLSGMLILIVPAFLLVTGIALMAYRRRKTGVGH* |
| Ga0066698_101773812 | 3300005558 | Soil | MGALMSGMLILMVASFLLVTGIAVMAYRRRKREAGE* |
| Ga0066700_104404372 | 3300005559 | Soil | MAALLSGMLILIVPAFLLVTGIAVMAYRRRNTGPLD* |
| Ga0066670_103798393 | 3300005560 | Soil | MGALLSGMLILMVAAFLLVTGIAVMAYRRRKRGAGD* |
| Ga0066699_104703132 | 3300005561 | Soil | MAALMSGMLILMVPAFFIVSGIAVLAYRKRKEREGE* |
| Ga0066658_100028507 | 3300006794 | Soil | MGMGALMSGMAILTVAAFLLVTGIAVMAYRRSKGGAPD* |
| Ga0066658_109394972 | 3300006794 | Soil | MAALLSGMLILIVPAFLLVTGIAVMAYRRRKTGPLD* |
| Ga0066659_110940832 | 3300006797 | Soil | MGALMSGMLILMVAAFLLVTGIALMAYRRRKREAGD* |
| Ga0066659_112068441 | 3300006797 | Soil | MGALMSGMAILTVAAFLLVTGIAVMAYRRSKRGARD* |
| Ga0066659_113431242 | 3300006797 | Soil | CMGMGALMSGMAILTVAAFLLVTGIAVMAYRRSKGGAPD* |
| Ga0066660_103204092 | 3300006800 | Soil | MGALLSGMLILMVAAFLLVTGIAIMAYRRRKRGAGD* |
| Ga0079220_104888702 | 3300006806 | Agricultural Soil | MNMTAVLSGMLILIVPAFLIVSGITFLAYRRRKLTRRD* |
| Ga0099791_106296862 | 3300007255 | Vadose Zone Soil | MGALMGGMLILMVAAFLLVTGIAVMAYRRRKTRSED* |
| Ga0099793_101239112 | 3300007258 | Vadose Zone Soil | MGALMSGMLILMVAAFLLVTGVAVMAYRRRKTGPQD* |
| Ga0099793_103926382 | 3300007258 | Vadose Zone Soil | MGAMMGGMLILMVAAFLLVTGVAVMAYRRHKTRSED* |
| Ga0066710_1010471012 | 3300009012 | Grasslands Soil | MAALMSGMLILMVPAFFIVSGIAVLAYRKRKEREGE |
| Ga0066709_1008815103 | 3300009137 | Grasslands Soil | MGALMSGMLILMVAAFLLVTGIAVMAYRKRKTRSED* |
| Ga0066709_1030891311 | 3300009137 | Grasslands Soil | MLTGMLILMVPAFLLVTGIAVMAYRKRGARRNAS* |
| Ga0066709_1035167302 | 3300009137 | Grasslands Soil | MDMAALLSGMLILIVPAFLLVTGIALMAYRRRKTEPLD* |
| Ga0134088_101258753 | 3300010304 | Grasslands Soil | MGALMSGMLILMVAAFLLVTGIAVMAFRRRKREAGD* |
| Ga0134063_100682014 | 3300010335 | Grasslands Soil | MGMGALMSGMAILTVAAFLLVTGIAVMAYRRSKRGARD* |
| Ga0134063_102611073 | 3300010335 | Grasslands Soil | MDMAALLSGMLILIVPAFLLVTGIAVLAYRRRKTEPLD* |
| Ga0134063_102836552 | 3300010335 | Grasslands Soil | MGALMSGMLILMVAAFLLVSGIAVMAYRRRKREAGD* |
| Ga0134071_101019923 | 3300010336 | Grasslands Soil | MGALMSGMLILMVAAFLLVTGIAVMAYRRRKRESGD* |
| Ga0134071_101049123 | 3300010336 | Grasslands Soil | MDMAALLSGMLILIVPAFLLVTGIALMAYRRRKTGVRD* |
| Ga0137364_100082483 | 3300012198 | Vadose Zone Soil | MDMAALLSGMLILIVPAFLLVTGIAVMAYRRRKTEPLD* |
| Ga0137364_103602663 | 3300012198 | Vadose Zone Soil | MSMTALMSGMLILMVPAFLIVSGIAVMAYRRRKQGVEE* |
| Ga0137382_102920204 | 3300012200 | Vadose Zone Soil | MGALMSGMLILMVASFLFVSGIAVMAYRRRKREAGD* |
| Ga0137399_101050723 | 3300012203 | Vadose Zone Soil | MSALLSGMLILMVAAFLLVTGIAVMAYRKRETRSED* |
| Ga0137399_101438893 | 3300012203 | Vadose Zone Soil | MGALMSGMLILMVAAFLLVTGIALMAYRRRKRWAGE* |
| Ga0137399_102182604 | 3300012203 | Vadose Zone Soil | MGALMSGMLILMVAAFLLVTGIALMAYRRGKTGSED* |
| Ga0137399_105734111 | 3300012203 | Vadose Zone Soil | MGALMSSMLILIVPAFLTVTGITILAYRKRKRGPED* |
| Ga0137399_117410902 | 3300012203 | Vadose Zone Soil | MGALMSGMLILMVAAFLLVTGIAVMAYRRRKPRSED* |
| Ga0137374_100115148 | 3300012204 | Vadose Zone Soil | MSMGALMSGMVILMVPAFCIVTGIAVLAYRRRNHGEERPKR* |
| Ga0137380_100000232 | 3300012206 | Vadose Zone Soil | MGALMSGMLILMVAAFCIVSGIAVMAYRRRKHGVED* |
| Ga0137380_101065285 | 3300012206 | Vadose Zone Soil | MGALMSGMLILMAAAFLLVTGIAVMAYRRRKREAGD* |
| Ga0137380_105967801 | 3300012206 | Vadose Zone Soil | RVSMGALMSGMLILMVAAFLLVSGIAVMAYRRRKREAGD* |
| Ga0137380_106971813 | 3300012206 | Vadose Zone Soil | MDMAALLSGMLILIVPAFLLVTGIALMAYRRRKTGPLD* |
| Ga0137381_100439835 | 3300012207 | Vadose Zone Soil | MGALMSGMLILMVAAFLLVSGIAVMAYRRRKRGAGD* |
| Ga0137379_103255472 | 3300012209 | Vadose Zone Soil | MGALLGGMVILMVAAFLIVTGIAVMAYRKRNRGSAS* |
| Ga0137378_104273963 | 3300012210 | Vadose Zone Soil | MGALMSGMLILMVAAFLLVTGIAVMAYRKRKREAGD* |
| Ga0137377_101931344 | 3300012211 | Vadose Zone Soil | MGALMSGMLILMVAAFLLVTGIAVMAYRRRKTRSED* |
| Ga0137370_101755533 | 3300012285 | Vadose Zone Soil | MSMAALMSGMLILMVPAFLIVSGIAVMAYRRRKARVGE* |
| Ga0137387_100375954 | 3300012349 | Vadose Zone Soil | MGALMSGVLILMVAAFFLVTGIAVMAYRKRKTGAGD* |
| Ga0137387_101902814 | 3300012349 | Vadose Zone Soil | MAALLSEILILIVPAFLLVTGIAVMAYRRRKTGPLD* |
| Ga0137386_103184892 | 3300012351 | Vadose Zone Soil | MGALLGGMVILMVTAFLIVTGIAVMAYRKRNRDPPDKRASCVIQ* |
| Ga0137386_104928533 | 3300012351 | Vadose Zone Soil | MDMAALLSGMLILIVPAFLLVTGIALMAYRRRKTGPLD |
| Ga0137371_112607432 | 3300012356 | Vadose Zone Soil | MGALMSGMLILMVAAFLLVTGIAVMTYRRRKHGAGD* |
| Ga0137384_103926263 | 3300012357 | Vadose Zone Soil | MGALLGGMVILMVAAFLIVTGIAVMAYRKRNRGSAG* |
| Ga0137358_1000008030 | 3300012582 | Vadose Zone Soil | MAALMGGMLILMVAAFLLVTGIAVMAYRRRKTRSED* |
| Ga0137398_103870631 | 3300012683 | Vadose Zone Soil | ALMSGMLILMVVAFLLVTGVAVMAYRRRKTGPQD* |
| Ga0137396_100241432 | 3300012918 | Vadose Zone Soil | MGALMSGMLILMVAAFLLVTGIAVMAYRRRKRWAGE* |
| Ga0137394_101064812 | 3300012922 | Vadose Zone Soil | MGALMSGMLILMVAAFLLVMGIALMAYRRRKRWAGE* |
| Ga0137394_102533143 | 3300012922 | Vadose Zone Soil | MAALLSGMLILIVPAFLLVTGIAVMAYRKRKTRSED* |
| Ga0137359_113268292 | 3300012923 | Vadose Zone Soil | MSMGALMGGMLILMVAAFLLVAGVAVMAYRRRKTGHQD* |
| Ga0137419_100270533 | 3300012925 | Vadose Zone Soil | MSMGALMGGMLILMVAAFLLVAGVAVMAYRRRKTGPQD* |
| Ga0137416_100942953 | 3300012927 | Vadose Zone Soil | MAALLSGMLILIVPAFLLVTGIALMAYRRRKTRSGE* |
| Ga0137404_101749532 | 3300012929 | Vadose Zone Soil | MAALLSGMLILIVPAFLLVTGIAVMAYRRRKTEPLD* |
| Ga0137404_104175903 | 3300012929 | Vadose Zone Soil | MGALMSGMLILMVAAFLLVTGIAVMAYRRRKTRPED* |
| Ga0137404_111675712 | 3300012929 | Vadose Zone Soil | MGALMGGMLILMVAAFLLVTGIAVMAYRRRKTPSED* |
| Ga0137410_102491773 | 3300012944 | Vadose Zone Soil | MAALLSGMLILIVPAFLLVTGIAVMAYRKRKTGSED* |
| Ga0137410_107332941 | 3300012944 | Vadose Zone Soil | MGTLMSGMVILMVAAFLLVTGIAVMAYRRRKTRPED* |
| Ga0134110_100311643 | 3300012975 | Grasslands Soil | MGALLSGMLILMVAAFLLVTGIAVMAYRRRKHGAGD* |
| Ga0134087_100292175 | 3300012977 | Grasslands Soil | MGALMSGMAILTVAAFLLVTGIAVMAYRRSKGGAPD* |
| Ga0134081_100207434 | 3300014150 | Grasslands Soil | MGGLMSGMLILMVASFLLVSGIAVMAYRRRKREPGD* |
| Ga0137411_10040842 | 3300015052 | Vadose Zone Soil | MGTLMSGMVILMVAAFLLVTGIALMAYRRRKTGSED* |
| Ga0137409_100086716 | 3300015245 | Vadose Zone Soil | MGALMSGMLILMVAAFLLVTGIAVMAYRRRKTGSED* |
| Ga0137409_113582462 | 3300015245 | Vadose Zone Soil | MGTLMSGMLILMVAAFLLVTGIALMAYRRRKTGSED* |
| Ga0134072_100131642 | 3300015357 | Grasslands Soil | MGALMSGMAILTVAAFLLVTGIALMAYRRSKRGARD* |
| Ga0134112_100101983 | 3300017656 | Grasslands Soil | MRALLTGMLILMVPAFLIVAGVAVMAYRKRKPRAED |
| Ga0134112_100635262 | 3300017656 | Grasslands Soil | MGALMSGMLILMVAAFLLVTGIAVMAFRRRKREAGD |
| Ga0184605_1000029411 | 3300018027 | Groundwater Sediment | MAAVLSGMLILIVPAFLLVTGIAVMAYRKRKRGAGD |
| Ga0184618_100934503 | 3300018071 | Groundwater Sediment | MAAALSGMLILIVPAFLLVTGIAVMAYRKRKRGAGD |
| Ga0066655_103562341 | 3300018431 | Grasslands Soil | MGALMSGMLILMVASFLLVTGIAVMAYRRRKREAGD |
| Ga0066667_100321715 | 3300018433 | Grasslands Soil | MGGLMSGMLILMVASFLLVTGIAVMAYRRRKREAGD |
| Ga0066667_100347635 | 3300018433 | Grasslands Soil | MDMAALLSGMLILIVPAFLLVTGIALMAYRRRKTEPLD |
| Ga0066667_117734321 | 3300018433 | Grasslands Soil | MSMAALMSGMLILMVPAFLIVSGIAVMAYRRRKARVGE |
| Ga0066662_102980123 | 3300018468 | Grasslands Soil | MGAMLSGMLILMVAAFLLVTGIAVMAYRRSKRGVGD |
| Ga0066662_113195532 | 3300018468 | Grasslands Soil | MGAMMSGMVILTVAAGLVVTGIAVMAYRRGRNDPGD |
| Ga0066662_115603493 | 3300018468 | Grasslands Soil | MGALMSGMLILMVAAFLLVTGIAVMAYRRRKRESGD |
| Ga0066662_123926192 | 3300018468 | Grasslands Soil | MGAMLNGMVILIVPAFLLVTGIAVMAYRRRKSRAGD |
| Ga0066669_100258521 | 3300018482 | Grasslands Soil | MGALMSGMAILTVAAFLLVTGIAVMAYRRSKRGARD |
| Ga0066669_119075312 | 3300018482 | Grasslands Soil | MGALMSGMAILTVSAFLLVTGIAVMAYRRSKRGARD |
| Ga0179594_100007695 | 3300020170 | Vadose Zone Soil | MGALMSGMLILMVAAFLLVTGIAVMAYRRRKTRSED |
| Ga0179594_103411912 | 3300020170 | Vadose Zone Soil | MGALMSGMLILMVAAFLLVTGVAVMAYRRRKTGPQD |
| Ga0137417_11624862 | 3300024330 | Vadose Zone Soil | MGAMMGGMLILMVAAFLLVTGVAVMAYRRHKTRSED |
| Ga0209350_10156685 | 3300026277 | Grasslands Soil | MGGLMSGMLILMVASFLLVSGIAVMAYRRRKREAGD |
| Ga0209234_10584142 | 3300026295 | Grasslands Soil | MGALMSGMAILTVAAFLLVTGIAVMAYRRSKRGAPD |
| Ga0209235_100214510 | 3300026296 | Grasslands Soil | MDMAALLSGMLILIVPAFLLVTGIALMAYRRRKTGVGH |
| Ga0209235_10876393 | 3300026296 | Grasslands Soil | MGALMSGMVILMVAAFLLVTGIAVMAYRRRKREAGE |
| Ga0209235_11418482 | 3300026296 | Grasslands Soil | MGALMSGMLILMVAAFLLVTGIAVMAYRRRKREAGD |
| Ga0209238_10104901 | 3300026301 | Grasslands Soil | VDMAALLSGMLILIVPAFLLVTGIAVMAYRRRKTGPL |
| Ga0209238_12744592 | 3300026301 | Grasslands Soil | MGALMSGMLILMVAAFLLVTGIALMAYRRRKREAGD |
| Ga0209055_10026168 | 3300026309 | Soil | MGMGALMSGMAILTVAAFLLVTGIAVMAYRRSKRGAPD |
| Ga0209761_11109644 | 3300026313 | Grasslands Soil | MQAMMTGMLILMVPAFLLVTGIAVMAYRKRGASRSAS |
| Ga0209686_10461284 | 3300026315 | Soil | MGMGALMSGMAILTVAAFLLVTGIAVMAYRRSKGGAPD |
| Ga0209152_102670822 | 3300026325 | Soil | MAALLSGMLILIVPAFLLVTGIAVMAYRRRKTGPLD |
| Ga0209473_11698092 | 3300026330 | Soil | MGALLSGMLILMVAAFLLVTGIAVMAYRRRKRGAGD |
| Ga0209159_10894921 | 3300026343 | Soil | SGGGGALAVMRAMLTGMLILMVPAFLLVTGIAVMAYRKRGARRNAS |
| Ga0209690_100227215 | 3300026524 | Soil | MGALMGGMLILMVPAFLLVTGIAVMAYRKRGARRSTS |
| Ga0209806_12367232 | 3300026529 | Soil | MGAMMSGMVILTVAAGLVVTGIAVMAYRRGRKDPGD |
| Ga0209058_10797313 | 3300026536 | Soil | MGALMSGMLILMVASFLLVTGIAVMAYRRRKREAGE |
| Ga0209156_100027199 | 3300026547 | Soil | MGALLSGMLILMVAAFLLVTGIAVMAYRRRKHGAGD |
| Ga0209577_100340646 | 3300026552 | Soil | MGALLSGMLILMVAAFLLVTGIAIMAYRRRKRGAGD |
| Ga0179587_104213701 | 3300026557 | Vadose Zone Soil | MSMGALMGGMLILMVAAFLLVAGVAVMAYRRRKTGPQD |
| Ga0209213_10194612 | 3300027383 | Forest Soil | MSALLSGMLILMVAAFLLVTGIAVMAYRKRETRSED |
| Ga0208993_10222831 | 3300027480 | Forest Soil | MGALLSGMLILIVPAFLLVTGIAVMAYRKRKTGPED |
| Ga0209076_11160362 | 3300027643 | Vadose Zone Soil | MGALMGGMLILMVAAFLLVTGIAVMAYRRRKTRSED |
| Ga0208981_10734343 | 3300027669 | Forest Soil | VDMSALLSGMLILMVAAFLLVTGIAVMAYRKRETR |
| Ga0208991_11536663 | 3300027681 | Forest Soil | MSALLSGMLILMVAAFLLVTGIAVMAYRKRKTRSED |
| Ga0209689_13851211 | 3300027748 | Soil | MAALLSGMLILIVPAFLLVTGIAVMAYRRRNTGPLD |
| Ga0137415_113839312 | 3300028536 | Vadose Zone Soil | MAALLSGMLILIVPAFLLVTGIALMAYRRRKTRSGE |
| Ga0307504_102068762 | 3300028792 | Soil | GLEGSQVSMGALMSGMLILMVAAFLLVTGIAVMAYRRRKTPSED |
| Ga0307501_100389413 | 3300031152 | Soil | MGTFLSGMLILIIPAFLLVTGIAVMAYRRRKTGAED |
| Ga0307501_100494211 | 3300031152 | Soil | VDMGTFLSGMLILIIPAFLLVTGIAVMAYRRRKTGAED |
| Ga0307469_112245901 | 3300031720 | Hardwood Forest Soil | ARRDLRVSMGALMGGMLILTVVAFFLVAGIAVITYRKRKTGSGD |
| Ga0307469_121854112 | 3300031720 | Hardwood Forest Soil | MSMRTVMSGMLILMVAAFLLVSGIALMAYRKRKTGSDD |
| Ga0307471_1007723703 | 3300032180 | Hardwood Forest Soil | MSMRTVMSGMLILMVAAFLLVTGIALMAYRKRKTGSED |
| Ga0307471_1012671483 | 3300032180 | Hardwood Forest Soil | MGAFMSGMAILTVAAGLVVTGIAVMAYHRSKRGAGD |
| ⦗Top⦘ |