NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F061721

Metagenome Family F061721

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F061721
Family Type Metagenome
Number of Sequences 131
Average Sequence Length 37 residues
Representative Sequence MGALMSGMLILMVAAFLLVTGIAVMAYRRRKREAGD
Number of Associated Samples 88
Number of Associated Scaffolds 131

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 88.98 %
% of genes near scaffold ends (potentially truncated) 7.63 %
% of genes from short scaffolds (< 2000 bps) 68.70 %
Associated GOLD sequencing projects 76
AlphaFold2 3D model prediction Yes
3D model pTM-score0.50

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (92.366 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil
(37.405 % of family members)
Environment Ontology (ENVO) Unclassified
(51.145 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(56.489 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Transmembrane (alpha-helical) Signal Peptide: No Secondary Structure distribution: α-helix: 53.12%    β-sheet: 0.00%    Coil/Unstructured: 46.88%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.50
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 131 Family Scaffolds
PF03626COX4_pro 38.93
PF00510COX3 12.21
PF02566OsmC 9.16
PF02954HTH_8 5.34
PF00115COX1 3.05
PF00903Glyoxalase 2.29
PF13633Obsolete Pfam Family 2.29
PF12681Glyoxalase_2 2.29
PF04892VanZ 1.53
PF14489QueF 1.53
PF06508QueC 1.53
PF01925TauE 0.76
PF00072Response_reg 0.76
PF13426PAS_9 0.76
PF00034Cytochrom_C 0.76
PF13620CarboxypepD_reg 0.76
PF13533Biotin_lipoyl_2 0.76
PF01872RibD_C 0.76
PF01648ACPS 0.76
PF13442Cytochrome_CBB3 0.76
PF01810LysE 0.76

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 131 Family Scaffolds
COG3125Heme/copper-type cytochrome/quinol oxidase, subunit 4Energy production and conversion [C] 38.93
COG1845Heme/copper-type cytochrome/quinol oxidase, subunit 3Energy production and conversion [C] 12.21
COG1764Organic hydroperoxide reductase OsmC/OhrADefense mechanisms [V] 9.16
COG1765Uncharacterized OsmC-related proteinGeneral function prediction only [R] 9.16
COG0037tRNA(Ile)-lysidine synthase TilS/MesJTranslation, ribosomal structure and biogenesis [J] 1.53
COG0137Argininosuccinate synthaseAmino acid transport and metabolism [E] 1.53
COG0171NH3-dependent NAD+ synthetaseCoenzyme transport and metabolism [H] 1.53
COG0301Adenylyl- and sulfurtransferase ThiI (thiamine and tRNA 4-thiouridine biosynthesis)Translation, ribosomal structure and biogenesis [J] 1.53
COG0482tRNA U34 2-thiouridine synthase MnmA/TrmU, contains the PP-loop ATPase domainTranslation, ribosomal structure and biogenesis [J] 1.53
COG0519GMP synthase, PP-ATPase domain/subunitNucleotide transport and metabolism [F] 1.53
COG06037-cyano-7-deazaguanine synthase (queuosine biosynthesis)Translation, ribosomal structure and biogenesis [J] 1.53
COG0780NADPH-dependent 7-cyano-7-deazaguanine reductase QueF, C-terminal domain, T-fold superfamilyTranslation, ribosomal structure and biogenesis [J] 1.53
COG1606ATP-utilizing enzyme, PP-loop superfamilyGeneral function prediction only [R] 1.53
COG0262Dihydrofolate reductaseCoenzyme transport and metabolism [H] 0.76
COG0730Sulfite exporter TauE/SafE/YfcA and related permeases, UPF0721 familyInorganic ion transport and metabolism [P] 0.76
COG1985Pyrimidine reductase, riboflavin biosynthesisCoenzyme transport and metabolism [H] 0.76

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms92.37 %
UnclassifiedrootN/A7.63 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300005540|Ga0066697_10008640All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter5149Open in IMG/M
3300005540|Ga0066697_10025595All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter3238Open in IMG/M
3300005552|Ga0066701_10004402All Organisms → cellular organisms → Bacteria5687Open in IMG/M
3300005552|Ga0066701_10129959All Organisms → cellular organisms → Bacteria1500Open in IMG/M
3300005554|Ga0066661_10008285All Organisms → cellular organisms → Bacteria → Proteobacteria5058Open in IMG/M
3300005555|Ga0066692_10677623All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium641Open in IMG/M
3300005555|Ga0066692_10844193Not Available562Open in IMG/M
3300005556|Ga0066707_10015726All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter3886Open in IMG/M
3300005557|Ga0066704_10032733All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter3183Open in IMG/M
3300005558|Ga0066698_10032568All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter3176Open in IMG/M
3300005558|Ga0066698_10177381All Organisms → cellular organisms → Bacteria1451Open in IMG/M
3300005559|Ga0066700_10440437All Organisms → cellular organisms → Bacteria915Open in IMG/M
3300005560|Ga0066670_10379839All Organisms → cellular organisms → Bacteria863Open in IMG/M
3300005561|Ga0066699_10470313All Organisms → cellular organisms → Bacteria899Open in IMG/M
3300006794|Ga0066658_10002850All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Eubacteriales incertae sedis → Clostridiales Family XVII. Incertae Sedis → Thermaerobacter6126Open in IMG/M
3300006794|Ga0066658_10939497All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae501Open in IMG/M
3300006797|Ga0066659_11094083All Organisms → cellular organisms → Bacteria666Open in IMG/M
3300006797|Ga0066659_11206844All Organisms → cellular organisms → Bacteria632Open in IMG/M
3300006797|Ga0066659_11343124Not Available596Open in IMG/M
3300006800|Ga0066660_10320409All Organisms → cellular organisms → Bacteria1246Open in IMG/M
3300006806|Ga0079220_10488870All Organisms → cellular organisms → Bacteria837Open in IMG/M
3300007255|Ga0099791_10629686All Organisms → cellular organisms → Bacteria525Open in IMG/M
3300007258|Ga0099793_10123911All Organisms → cellular organisms → Bacteria1210Open in IMG/M
3300007258|Ga0099793_10392638All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes681Open in IMG/M
3300009012|Ga0066710_101047101All Organisms → cellular organisms → Bacteria1260Open in IMG/M
3300009137|Ga0066709_100881510All Organisms → cellular organisms → Bacteria1302Open in IMG/M
3300009137|Ga0066709_103089131All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium 13_1_40CM_4_65_7609Open in IMG/M
3300009137|Ga0066709_103516730All Organisms → cellular organisms → Bacteria568Open in IMG/M
3300010304|Ga0134088_10125875All Organisms → cellular organisms → Bacteria1214Open in IMG/M
3300010335|Ga0134063_10068201All Organisms → cellular organisms → Bacteria1579Open in IMG/M
3300010335|Ga0134063_10261107All Organisms → cellular organisms → Bacteria826Open in IMG/M
3300010335|Ga0134063_10283655All Organisms → cellular organisms → Bacteria794Open in IMG/M
3300010336|Ga0134071_10101992All Organisms → cellular organisms → Bacteria1363Open in IMG/M
3300010336|Ga0134071_10104912All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria1346Open in IMG/M
3300012198|Ga0137364_10008248All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis5800Open in IMG/M
3300012198|Ga0137364_10360266All Organisms → cellular organisms → Bacteria1085Open in IMG/M
3300012200|Ga0137382_10292020All Organisms → cellular organisms → Bacteria1136Open in IMG/M
3300012203|Ga0137399_10105072All Organisms → cellular organisms → Bacteria2192Open in IMG/M
3300012203|Ga0137399_10143889All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes1897Open in IMG/M
3300012203|Ga0137399_10218260All Organisms → cellular organisms → Bacteria1554Open in IMG/M
3300012203|Ga0137399_10573411All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter948Open in IMG/M
3300012203|Ga0137399_11741090Not Available512Open in IMG/M
3300012204|Ga0137374_10011514All Organisms → cellular organisms → Bacteria10347Open in IMG/M
3300012206|Ga0137380_10000023All Organisms → cellular organisms → Bacteria91643Open in IMG/M
3300012206|Ga0137380_10106528All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis2562Open in IMG/M
3300012206|Ga0137380_10596780All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium966Open in IMG/M
3300012206|Ga0137380_10697181All Organisms → cellular organisms → Bacteria882Open in IMG/M
3300012207|Ga0137381_10043983All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis3665Open in IMG/M
3300012209|Ga0137379_10325547All Organisms → cellular organisms → Bacteria1447Open in IMG/M
3300012210|Ga0137378_10427396All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter1228Open in IMG/M
3300012211|Ga0137377_10193134All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis1954Open in IMG/M
3300012285|Ga0137370_10175553All Organisms → cellular organisms → Bacteria → Acidobacteria1249Open in IMG/M
3300012349|Ga0137387_10037595All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes3165Open in IMG/M
3300012349|Ga0137387_10190281All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia1472Open in IMG/M
3300012351|Ga0137386_10318489All Organisms → cellular organisms → Bacteria1119Open in IMG/M
3300012351|Ga0137386_10492853All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter883Open in IMG/M
3300012356|Ga0137371_11260743All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes549Open in IMG/M
3300012357|Ga0137384_10392626All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter1146Open in IMG/M
3300012582|Ga0137358_10000080All Organisms → cellular organisms → Bacteria30620Open in IMG/M
3300012683|Ga0137398_10387063All Organisms → cellular organisms → Bacteria951Open in IMG/M
3300012918|Ga0137396_10024143All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis3946Open in IMG/M
3300012922|Ga0137394_10106481All Organisms → cellular organisms → Bacteria2365Open in IMG/M
3300012922|Ga0137394_10253314All Organisms → cellular organisms → Bacteria1505Open in IMG/M
3300012923|Ga0137359_11326829All Organisms → cellular organisms → Bacteria607Open in IMG/M
3300012925|Ga0137419_10027053All Organisms → cellular organisms → Bacteria3455Open in IMG/M
3300012927|Ga0137416_10094295All Organisms → cellular organisms → Bacteria2235Open in IMG/M
3300012929|Ga0137404_10174953All Organisms → cellular organisms → Bacteria1802Open in IMG/M
3300012929|Ga0137404_10417590All Organisms → cellular organisms → Bacteria1185Open in IMG/M
3300012929|Ga0137404_11167571All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes708Open in IMG/M
3300012944|Ga0137410_10249177All Organisms → cellular organisms → Bacteria1391Open in IMG/M
3300012944|Ga0137410_10733294Not Available825Open in IMG/M
3300012975|Ga0134110_10031164All Organisms → cellular organisms → Bacteria2084Open in IMG/M
3300012977|Ga0134087_10029217All Organisms → cellular organisms → Bacteria2073Open in IMG/M
3300014150|Ga0134081_10020743All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis1847Open in IMG/M
3300015052|Ga0137411_1004084All Organisms → cellular organisms → Bacteria525Open in IMG/M
3300015245|Ga0137409_10008671All Organisms → cellular organisms → Bacteria10375Open in IMG/M
3300015245|Ga0137409_11358246All Organisms → cellular organisms → Bacteria554Open in IMG/M
3300015357|Ga0134072_10013164All Organisms → cellular organisms → Bacteria1953Open in IMG/M
3300017656|Ga0134112_10010198All Organisms → cellular organisms → Bacteria3101Open in IMG/M
3300017656|Ga0134112_10063526All Organisms → cellular organisms → Bacteria1354Open in IMG/M
3300018027|Ga0184605_10000294All Organisms → cellular organisms → Bacteria14658Open in IMG/M
3300018071|Ga0184618_10093450All Organisms → cellular organisms → Bacteria1169Open in IMG/M
3300018431|Ga0066655_10356234All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis961Open in IMG/M
3300018433|Ga0066667_10032171All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis2964Open in IMG/M
3300018433|Ga0066667_10034763All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis2881Open in IMG/M
3300018433|Ga0066667_11773432All Organisms → cellular organisms → Bacteria557Open in IMG/M
3300018468|Ga0066662_10298012All Organisms → cellular organisms → Bacteria1353Open in IMG/M
3300018468|Ga0066662_11319553Not Available741Open in IMG/M
3300018468|Ga0066662_11560349All Organisms → cellular organisms → Bacteria688Open in IMG/M
3300018468|Ga0066662_12392619All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes556Open in IMG/M
3300018482|Ga0066669_10025852All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis3379Open in IMG/M
3300018482|Ga0066669_11907531Not Available553Open in IMG/M
3300020170|Ga0179594_10000769All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis7047Open in IMG/M
3300020170|Ga0179594_10341191All Organisms → cellular organisms → Bacteria568Open in IMG/M
3300024330|Ga0137417_1162486All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes2169Open in IMG/M
3300026277|Ga0209350_1015668All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis2377Open in IMG/M
3300026295|Ga0209234_1058414All Organisms → cellular organisms → Bacteria1467Open in IMG/M
3300026296|Ga0209235_1002145All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis10973Open in IMG/M
3300026296|Ga0209235_1087639All Organisms → cellular organisms → Bacteria1372Open in IMG/M
3300026296|Ga0209235_1141848All Organisms → cellular organisms → Bacteria973Open in IMG/M
3300026301|Ga0209238_1010490All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis3629Open in IMG/M
3300026301|Ga0209238_1274459All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae506Open in IMG/M
3300026309|Ga0209055_1002616All Organisms → cellular organisms → Bacteria11300Open in IMG/M
3300026313|Ga0209761_1110964All Organisms → cellular organisms → Bacteria1351Open in IMG/M
3300026315|Ga0209686_1046128All Organisms → cellular organisms → Bacteria1610Open in IMG/M
3300026325|Ga0209152_10267082All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium636Open in IMG/M
3300026330|Ga0209473_1169809All Organisms → cellular organisms → Bacteria863Open in IMG/M
3300026524|Ga0209690_1002272All Organisms → cellular organisms → Bacteria10969Open in IMG/M
3300026529|Ga0209806_1236723All Organisms → cellular organisms → Bacteria617Open in IMG/M
3300026536|Ga0209058_1079731All Organisms → cellular organisms → Bacteria1722Open in IMG/M
3300026547|Ga0209156_10002719All Organisms → cellular organisms → Bacteria13739Open in IMG/M
3300026552|Ga0209577_10034064All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis4407Open in IMG/M
3300026557|Ga0179587_10421370All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis872Open in IMG/M
3300027383|Ga0209213_1019461All Organisms → cellular organisms → Bacteria1265Open in IMG/M
3300027480|Ga0208993_1022283All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis1116Open in IMG/M
3300027643|Ga0209076_1116036All Organisms → cellular organisms → Bacteria757Open in IMG/M
3300027669|Ga0208981_1073434All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis872Open in IMG/M
3300027681|Ga0208991_1153666All Organisms → cellular organisms → Bacteria → Acidobacteria679Open in IMG/M
3300027748|Ga0209689_1385121All Organisms → cellular organisms → Bacteria536Open in IMG/M
3300028536|Ga0137415_11383931All Organisms → cellular organisms → Bacteria524Open in IMG/M
3300028792|Ga0307504_10206876All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes698Open in IMG/M
3300031152|Ga0307501_10038941All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis1015Open in IMG/M
3300031152|Ga0307501_10049421All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes935Open in IMG/M
3300031720|Ga0307469_11224590All Organisms → cellular organisms → Bacteria → Proteobacteria710Open in IMG/M
3300031720|Ga0307469_12185411All Organisms → cellular organisms → Bacteria539Open in IMG/M
3300032180|Ga0307471_100772370All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes1127Open in IMG/M
3300032180|Ga0307471_101267148All Organisms → cellular organisms → Bacteria900Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil37.40%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil25.19%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil16.79%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil9.16%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil3.05%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil3.05%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil2.29%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment1.53%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil0.76%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil0.76%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300005172Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132EnvironmentalOpen in IMG/M
3300005540Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146EnvironmentalOpen in IMG/M
3300005552Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150EnvironmentalOpen in IMG/M
3300005553Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144EnvironmentalOpen in IMG/M
3300005554Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110EnvironmentalOpen in IMG/M
3300005555Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141EnvironmentalOpen in IMG/M
3300005556Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156EnvironmentalOpen in IMG/M
3300005557Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153EnvironmentalOpen in IMG/M
3300005558Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147EnvironmentalOpen in IMG/M
3300005559Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149EnvironmentalOpen in IMG/M
3300005560Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119EnvironmentalOpen in IMG/M
3300005561Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148EnvironmentalOpen in IMG/M
3300006794Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107EnvironmentalOpen in IMG/M
3300006797Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108EnvironmentalOpen in IMG/M
3300006800Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109EnvironmentalOpen in IMG/M
3300006806Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100EnvironmentalOpen in IMG/M
3300007255Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1EnvironmentalOpen in IMG/M
3300007258Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3EnvironmentalOpen in IMG/M
3300009012Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159EnvironmentalOpen in IMG/M
3300009137Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158EnvironmentalOpen in IMG/M
3300010304Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09182015EnvironmentalOpen in IMG/M
3300010335Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015EnvironmentalOpen in IMG/M
3300010336Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09082015EnvironmentalOpen in IMG/M
3300012198Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012200Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaGEnvironmentalOpen in IMG/M
3300012203Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaGEnvironmentalOpen in IMG/M
3300012204Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaGEnvironmentalOpen in IMG/M
3300012206Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaGEnvironmentalOpen in IMG/M
3300012207Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaGEnvironmentalOpen in IMG/M
3300012209Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaGEnvironmentalOpen in IMG/M
3300012210Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaGEnvironmentalOpen in IMG/M
3300012211Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaGEnvironmentalOpen in IMG/M
3300012285Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaGEnvironmentalOpen in IMG/M
3300012349Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaGEnvironmentalOpen in IMG/M
3300012351Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaGEnvironmentalOpen in IMG/M
3300012356Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaGEnvironmentalOpen in IMG/M
3300012357Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaGEnvironmentalOpen in IMG/M
3300012582Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaGEnvironmentalOpen in IMG/M
3300012683Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaGEnvironmentalOpen in IMG/M
3300012918Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaGEnvironmentalOpen in IMG/M
3300012922Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaGEnvironmentalOpen in IMG/M
3300012923Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaGEnvironmentalOpen in IMG/M
3300012925Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012927Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012929Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012944Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012975Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_11112015EnvironmentalOpen in IMG/M
3300012977Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaGEnvironmentalOpen in IMG/M
3300014150Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_5_24_1 metaGEnvironmentalOpen in IMG/M
3300015052Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (PacBio error correction)EnvironmentalOpen in IMG/M
3300015245Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300015357Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_0_1 metaGEnvironmentalOpen in IMG/M
3300017656Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_11112015EnvironmentalOpen in IMG/M
3300018027Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_coexEnvironmentalOpen in IMG/M
3300018071Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_b1EnvironmentalOpen in IMG/M
3300018431Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104EnvironmentalOpen in IMG/M
3300018433Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116EnvironmentalOpen in IMG/M
3300018468Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111EnvironmentalOpen in IMG/M
3300018482Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118EnvironmentalOpen in IMG/M
3300020170Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad1_1_08_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300024330Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (PacBio error correction)EnvironmentalOpen in IMG/M
3300026277Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_2_20cm (SPAdes)EnvironmentalOpen in IMG/M
3300026295Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_20cm (SPAdes)EnvironmentalOpen in IMG/M
3300026296Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_20cm (SPAdes)EnvironmentalOpen in IMG/M
3300026301Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_20cm (SPAdes)EnvironmentalOpen in IMG/M
3300026309Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 (SPAdes)EnvironmentalOpen in IMG/M
3300026313Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_40cm (SPAdes)EnvironmentalOpen in IMG/M
3300026315Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 (SPAdes)EnvironmentalOpen in IMG/M
3300026325Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 (SPAdes)EnvironmentalOpen in IMG/M
3300026330Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 (SPAdes)EnvironmentalOpen in IMG/M
3300026343Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 (SPAdes)EnvironmentalOpen in IMG/M
3300026524Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 (SPAdes)EnvironmentalOpen in IMG/M
3300026529Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 (SPAdes)EnvironmentalOpen in IMG/M
3300026536Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 (SPAdes)EnvironmentalOpen in IMG/M
3300026547Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 (SPAdes)EnvironmentalOpen in IMG/M
3300026552Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes)EnvironmentalOpen in IMG/M
3300026557Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungalEnvironmentalOpen in IMG/M
3300027383Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM1_M2 (SPAdes)EnvironmentalOpen in IMG/M
3300027480Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM2_M3 (SPAdes)EnvironmentalOpen in IMG/M
3300027643Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 (SPAdes)EnvironmentalOpen in IMG/M
3300027669Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM1_M1 (SPAdes)EnvironmentalOpen in IMG/M
3300027681Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM3_M2 (SPAdes)EnvironmentalOpen in IMG/M
3300027748Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 (SPAdes)EnvironmentalOpen in IMG/M
3300028536Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300028792Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 19_SEnvironmentalOpen in IMG/M
3300031152Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 15_SEnvironmentalOpen in IMG/M
3300031720Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
Ga0066683_1050636923300005172SoilGGGALAVMRAMLTGMLILMVPAFLLVTGIAVMAYRKRGARRSTS*
Ga0066697_1000864073300005540SoilMLTGMLILMVPAFLLVTGIAVMAYRKRGARRSTS*
Ga0066697_1002559553300005540SoilMGGLMSGMLILMVASFLLVSGIAVMAYRRRKREAGD*
Ga0066701_1000440263300005552SoilMGAMLNGMVILIVPAFLLVTGIAVMAYRRRKSRAGD*
Ga0066701_1012995933300005552SoilMGALMSGMLILMVAAFLLVTGIAVMAYRRRKREAGD*
Ga0066701_1041716833300005552SoilMGALMGGMLILMVPAFLLVTGIAVMAYRKRGARRSTS*
Ga0066695_1051055523300005553SoilGGGALAVMRAMLTGMLILMVPAFLLVTGIAVMAYRKRGARRNAS*
Ga0066661_1000828543300005554SoilMGMGALMSGMAILTVAAFLLVTGIAVMAYRRSKRGAPD*
Ga0066692_1067762323300005555SoilMGALMSGMLILMVAAFLLVTGIAVMAYRRRKREAGE*
Ga0066692_1084419323300005555SoilMGAMMSGMVILTVAAGLVVTGIAVMAYRRGRNDPGD*
Ga0066707_1001572653300005556SoilMGGLMSGMLILMVASFLLVTGIAVMAYRRRKREAGD*
Ga0066704_1003273353300005557SoilMGAMLSGMLILMVAAFLLVTGIAVMAYRRSKRGVGD*
Ga0066698_1003256853300005558SoilMDMAALLSGMLILIVPAFLLVTGIALMAYRRRKTGVGH*
Ga0066698_1017738123300005558SoilMGALMSGMLILMVASFLLVTGIAVMAYRRRKREAGE*
Ga0066700_1044043723300005559SoilMAALLSGMLILIVPAFLLVTGIAVMAYRRRNTGPLD*
Ga0066670_1037983933300005560SoilMGALLSGMLILMVAAFLLVTGIAVMAYRRRKRGAGD*
Ga0066699_1047031323300005561SoilMAALMSGMLILMVPAFFIVSGIAVLAYRKRKEREGE*
Ga0066658_1000285073300006794SoilMGMGALMSGMAILTVAAFLLVTGIAVMAYRRSKGGAPD*
Ga0066658_1093949723300006794SoilMAALLSGMLILIVPAFLLVTGIAVMAYRRRKTGPLD*
Ga0066659_1109408323300006797SoilMGALMSGMLILMVAAFLLVTGIALMAYRRRKREAGD*
Ga0066659_1120684413300006797SoilMGALMSGMAILTVAAFLLVTGIAVMAYRRSKRGARD*
Ga0066659_1134312423300006797SoilCMGMGALMSGMAILTVAAFLLVTGIAVMAYRRSKGGAPD*
Ga0066660_1032040923300006800SoilMGALLSGMLILMVAAFLLVTGIAIMAYRRRKRGAGD*
Ga0079220_1048887023300006806Agricultural SoilMNMTAVLSGMLILIVPAFLIVSGITFLAYRRRKLTRRD*
Ga0099791_1062968623300007255Vadose Zone SoilMGALMGGMLILMVAAFLLVTGIAVMAYRRRKTRSED*
Ga0099793_1012391123300007258Vadose Zone SoilMGALMSGMLILMVAAFLLVTGVAVMAYRRRKTGPQD*
Ga0099793_1039263823300007258Vadose Zone SoilMGAMMGGMLILMVAAFLLVTGVAVMAYRRHKTRSED*
Ga0066710_10104710123300009012Grasslands SoilMAALMSGMLILMVPAFFIVSGIAVLAYRKRKEREGE
Ga0066709_10088151033300009137Grasslands SoilMGALMSGMLILMVAAFLLVTGIAVMAYRKRKTRSED*
Ga0066709_10308913113300009137Grasslands SoilMLTGMLILMVPAFLLVTGIAVMAYRKRGARRNAS*
Ga0066709_10351673023300009137Grasslands SoilMDMAALLSGMLILIVPAFLLVTGIALMAYRRRKTEPLD*
Ga0134088_1012587533300010304Grasslands SoilMGALMSGMLILMVAAFLLVTGIAVMAFRRRKREAGD*
Ga0134063_1006820143300010335Grasslands SoilMGMGALMSGMAILTVAAFLLVTGIAVMAYRRSKRGARD*
Ga0134063_1026110733300010335Grasslands SoilMDMAALLSGMLILIVPAFLLVTGIAVLAYRRRKTEPLD*
Ga0134063_1028365523300010335Grasslands SoilMGALMSGMLILMVAAFLLVSGIAVMAYRRRKREAGD*
Ga0134071_1010199233300010336Grasslands SoilMGALMSGMLILMVAAFLLVTGIAVMAYRRRKRESGD*
Ga0134071_1010491233300010336Grasslands SoilMDMAALLSGMLILIVPAFLLVTGIALMAYRRRKTGVRD*
Ga0137364_1000824833300012198Vadose Zone SoilMDMAALLSGMLILIVPAFLLVTGIAVMAYRRRKTEPLD*
Ga0137364_1036026633300012198Vadose Zone SoilMSMTALMSGMLILMVPAFLIVSGIAVMAYRRRKQGVEE*
Ga0137382_1029202043300012200Vadose Zone SoilMGALMSGMLILMVASFLFVSGIAVMAYRRRKREAGD*
Ga0137399_1010507233300012203Vadose Zone SoilMSALLSGMLILMVAAFLLVTGIAVMAYRKRETRSED*
Ga0137399_1014388933300012203Vadose Zone SoilMGALMSGMLILMVAAFLLVTGIALMAYRRRKRWAGE*
Ga0137399_1021826043300012203Vadose Zone SoilMGALMSGMLILMVAAFLLVTGIALMAYRRGKTGSED*
Ga0137399_1057341113300012203Vadose Zone SoilMGALMSSMLILIVPAFLTVTGITILAYRKRKRGPED*
Ga0137399_1174109023300012203Vadose Zone SoilMGALMSGMLILMVAAFLLVTGIAVMAYRRRKPRSED*
Ga0137374_1001151483300012204Vadose Zone SoilMSMGALMSGMVILMVPAFCIVTGIAVLAYRRRNHGEERPKR*
Ga0137380_1000002323300012206Vadose Zone SoilMGALMSGMLILMVAAFCIVSGIAVMAYRRRKHGVED*
Ga0137380_1010652853300012206Vadose Zone SoilMGALMSGMLILMAAAFLLVTGIAVMAYRRRKREAGD*
Ga0137380_1059678013300012206Vadose Zone SoilRVSMGALMSGMLILMVAAFLLVSGIAVMAYRRRKREAGD*
Ga0137380_1069718133300012206Vadose Zone SoilMDMAALLSGMLILIVPAFLLVTGIALMAYRRRKTGPLD*
Ga0137381_1004398353300012207Vadose Zone SoilMGALMSGMLILMVAAFLLVSGIAVMAYRRRKRGAGD*
Ga0137379_1032554723300012209Vadose Zone SoilMGALLGGMVILMVAAFLIVTGIAVMAYRKRNRGSAS*
Ga0137378_1042739633300012210Vadose Zone SoilMGALMSGMLILMVAAFLLVTGIAVMAYRKRKREAGD*
Ga0137377_1019313443300012211Vadose Zone SoilMGALMSGMLILMVAAFLLVTGIAVMAYRRRKTRSED*
Ga0137370_1017555333300012285Vadose Zone SoilMSMAALMSGMLILMVPAFLIVSGIAVMAYRRRKARVGE*
Ga0137387_1003759543300012349Vadose Zone SoilMGALMSGVLILMVAAFFLVTGIAVMAYRKRKTGAGD*
Ga0137387_1019028143300012349Vadose Zone SoilMAALLSEILILIVPAFLLVTGIAVMAYRRRKTGPLD*
Ga0137386_1031848923300012351Vadose Zone SoilMGALLGGMVILMVTAFLIVTGIAVMAYRKRNRDPPDKRASCVIQ*
Ga0137386_1049285333300012351Vadose Zone SoilMDMAALLSGMLILIVPAFLLVTGIALMAYRRRKTGPLD
Ga0137371_1126074323300012356Vadose Zone SoilMGALMSGMLILMVAAFLLVTGIAVMTYRRRKHGAGD*
Ga0137384_1039262633300012357Vadose Zone SoilMGALLGGMVILMVAAFLIVTGIAVMAYRKRNRGSAG*
Ga0137358_10000080303300012582Vadose Zone SoilMAALMGGMLILMVAAFLLVTGIAVMAYRRRKTRSED*
Ga0137398_1038706313300012683Vadose Zone SoilALMSGMLILMVVAFLLVTGVAVMAYRRRKTGPQD*
Ga0137396_1002414323300012918Vadose Zone SoilMGALMSGMLILMVAAFLLVTGIAVMAYRRRKRWAGE*
Ga0137394_1010648123300012922Vadose Zone SoilMGALMSGMLILMVAAFLLVMGIALMAYRRRKRWAGE*
Ga0137394_1025331433300012922Vadose Zone SoilMAALLSGMLILIVPAFLLVTGIAVMAYRKRKTRSED*
Ga0137359_1132682923300012923Vadose Zone SoilMSMGALMGGMLILMVAAFLLVAGVAVMAYRRRKTGHQD*
Ga0137419_1002705333300012925Vadose Zone SoilMSMGALMGGMLILMVAAFLLVAGVAVMAYRRRKTGPQD*
Ga0137416_1009429533300012927Vadose Zone SoilMAALLSGMLILIVPAFLLVTGIALMAYRRRKTRSGE*
Ga0137404_1017495323300012929Vadose Zone SoilMAALLSGMLILIVPAFLLVTGIAVMAYRRRKTEPLD*
Ga0137404_1041759033300012929Vadose Zone SoilMGALMSGMLILMVAAFLLVTGIAVMAYRRRKTRPED*
Ga0137404_1116757123300012929Vadose Zone SoilMGALMGGMLILMVAAFLLVTGIAVMAYRRRKTPSED*
Ga0137410_1024917733300012944Vadose Zone SoilMAALLSGMLILIVPAFLLVTGIAVMAYRKRKTGSED*
Ga0137410_1073329413300012944Vadose Zone SoilMGTLMSGMVILMVAAFLLVTGIAVMAYRRRKTRPED*
Ga0134110_1003116433300012975Grasslands SoilMGALLSGMLILMVAAFLLVTGIAVMAYRRRKHGAGD*
Ga0134087_1002921753300012977Grasslands SoilMGALMSGMAILTVAAFLLVTGIAVMAYRRSKGGAPD*
Ga0134081_1002074343300014150Grasslands SoilMGGLMSGMLILMVASFLLVSGIAVMAYRRRKREPGD*
Ga0137411_100408423300015052Vadose Zone SoilMGTLMSGMVILMVAAFLLVTGIALMAYRRRKTGSED*
Ga0137409_1000867163300015245Vadose Zone SoilMGALMSGMLILMVAAFLLVTGIAVMAYRRRKTGSED*
Ga0137409_1135824623300015245Vadose Zone SoilMGTLMSGMLILMVAAFLLVTGIALMAYRRRKTGSED*
Ga0134072_1001316423300015357Grasslands SoilMGALMSGMAILTVAAFLLVTGIALMAYRRSKRGARD*
Ga0134112_1001019833300017656Grasslands SoilMRALLTGMLILMVPAFLIVAGVAVMAYRKRKPRAED
Ga0134112_1006352623300017656Grasslands SoilMGALMSGMLILMVAAFLLVTGIAVMAFRRRKREAGD
Ga0184605_10000294113300018027Groundwater SedimentMAAVLSGMLILIVPAFLLVTGIAVMAYRKRKRGAGD
Ga0184618_1009345033300018071Groundwater SedimentMAAALSGMLILIVPAFLLVTGIAVMAYRKRKRGAGD
Ga0066655_1035623413300018431Grasslands SoilMGALMSGMLILMVASFLLVTGIAVMAYRRRKREAGD
Ga0066667_1003217153300018433Grasslands SoilMGGLMSGMLILMVASFLLVTGIAVMAYRRRKREAGD
Ga0066667_1003476353300018433Grasslands SoilMDMAALLSGMLILIVPAFLLVTGIALMAYRRRKTEPLD
Ga0066667_1177343213300018433Grasslands SoilMSMAALMSGMLILMVPAFLIVSGIAVMAYRRRKARVGE
Ga0066662_1029801233300018468Grasslands SoilMGAMLSGMLILMVAAFLLVTGIAVMAYRRSKRGVGD
Ga0066662_1131955323300018468Grasslands SoilMGAMMSGMVILTVAAGLVVTGIAVMAYRRGRNDPGD
Ga0066662_1156034933300018468Grasslands SoilMGALMSGMLILMVAAFLLVTGIAVMAYRRRKRESGD
Ga0066662_1239261923300018468Grasslands SoilMGAMLNGMVILIVPAFLLVTGIAVMAYRRRKSRAGD
Ga0066669_1002585213300018482Grasslands SoilMGALMSGMAILTVAAFLLVTGIAVMAYRRSKRGARD
Ga0066669_1190753123300018482Grasslands SoilMGALMSGMAILTVSAFLLVTGIAVMAYRRSKRGARD
Ga0179594_1000076953300020170Vadose Zone SoilMGALMSGMLILMVAAFLLVTGIAVMAYRRRKTRSED
Ga0179594_1034119123300020170Vadose Zone SoilMGALMSGMLILMVAAFLLVTGVAVMAYRRRKTGPQD
Ga0137417_116248623300024330Vadose Zone SoilMGAMMGGMLILMVAAFLLVTGVAVMAYRRHKTRSED
Ga0209350_101566853300026277Grasslands SoilMGGLMSGMLILMVASFLLVSGIAVMAYRRRKREAGD
Ga0209234_105841423300026295Grasslands SoilMGALMSGMAILTVAAFLLVTGIAVMAYRRSKRGAPD
Ga0209235_1002145103300026296Grasslands SoilMDMAALLSGMLILIVPAFLLVTGIALMAYRRRKTGVGH
Ga0209235_108763933300026296Grasslands SoilMGALMSGMVILMVAAFLLVTGIAVMAYRRRKREAGE
Ga0209235_114184823300026296Grasslands SoilMGALMSGMLILMVAAFLLVTGIAVMAYRRRKREAGD
Ga0209238_101049013300026301Grasslands SoilVDMAALLSGMLILIVPAFLLVTGIAVMAYRRRKTGPL
Ga0209238_127445923300026301Grasslands SoilMGALMSGMLILMVAAFLLVTGIALMAYRRRKREAGD
Ga0209055_100261683300026309SoilMGMGALMSGMAILTVAAFLLVTGIAVMAYRRSKRGAPD
Ga0209761_111096443300026313Grasslands SoilMQAMMTGMLILMVPAFLLVTGIAVMAYRKRGASRSAS
Ga0209686_104612843300026315SoilMGMGALMSGMAILTVAAFLLVTGIAVMAYRRSKGGAPD
Ga0209152_1026708223300026325SoilMAALLSGMLILIVPAFLLVTGIAVMAYRRRKTGPLD
Ga0209473_116980923300026330SoilMGALLSGMLILMVAAFLLVTGIAVMAYRRRKRGAGD
Ga0209159_108949213300026343SoilSGGGGALAVMRAMLTGMLILMVPAFLLVTGIAVMAYRKRGARRNAS
Ga0209690_1002272153300026524SoilMGALMGGMLILMVPAFLLVTGIAVMAYRKRGARRSTS
Ga0209806_123672323300026529SoilMGAMMSGMVILTVAAGLVVTGIAVMAYRRGRKDPGD
Ga0209058_107973133300026536SoilMGALMSGMLILMVASFLLVTGIAVMAYRRRKREAGE
Ga0209156_1000271993300026547SoilMGALLSGMLILMVAAFLLVTGIAVMAYRRRKHGAGD
Ga0209577_1003406463300026552SoilMGALLSGMLILMVAAFLLVTGIAIMAYRRRKRGAGD
Ga0179587_1042137013300026557Vadose Zone SoilMSMGALMGGMLILMVAAFLLVAGVAVMAYRRRKTGPQD
Ga0209213_101946123300027383Forest SoilMSALLSGMLILMVAAFLLVTGIAVMAYRKRETRSED
Ga0208993_102228313300027480Forest SoilMGALLSGMLILIVPAFLLVTGIAVMAYRKRKTGPED
Ga0209076_111603623300027643Vadose Zone SoilMGALMGGMLILMVAAFLLVTGIAVMAYRRRKTRSED
Ga0208981_107343433300027669Forest SoilVDMSALLSGMLILMVAAFLLVTGIAVMAYRKRETR
Ga0208991_115366633300027681Forest SoilMSALLSGMLILMVAAFLLVTGIAVMAYRKRKTRSED
Ga0209689_138512113300027748SoilMAALLSGMLILIVPAFLLVTGIAVMAYRRRNTGPLD
Ga0137415_1138393123300028536Vadose Zone SoilMAALLSGMLILIVPAFLLVTGIALMAYRRRKTRSGE
Ga0307504_1020687623300028792SoilGLEGSQVSMGALMSGMLILMVAAFLLVTGIAVMAYRRRKTPSED
Ga0307501_1003894133300031152SoilMGTFLSGMLILIIPAFLLVTGIAVMAYRRRKTGAED
Ga0307501_1004942113300031152SoilVDMGTFLSGMLILIIPAFLLVTGIAVMAYRRRKTGAED
Ga0307469_1122459013300031720Hardwood Forest SoilARRDLRVSMGALMGGMLILTVVAFFLVAGIAVITYRKRKTGSGD
Ga0307469_1218541123300031720Hardwood Forest SoilMSMRTVMSGMLILMVAAFLLVSGIALMAYRKRKTGSDD
Ga0307471_10077237033300032180Hardwood Forest SoilMSMRTVMSGMLILMVAAFLLVTGIALMAYRKRKTGSED
Ga0307471_10126714833300032180Hardwood Forest SoilMGAFMSGMAILTVAAGLVVTGIAVMAYHRSKRGAGD

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.