| Basic Information | |
|---|---|
| Family ID | F061694 |
| Family Type | Metagenome |
| Number of Sequences | 131 |
| Average Sequence Length | 42 residues |
| Representative Sequence | QLERRLAARAIEGLPASSIARAVHLLEEFKQRLEEKQIGVVR |
| Number of Associated Samples | 108 |
| Number of Associated Scaffolds | 131 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 98.47 % |
| % of genes from short scaffolds (< 2000 bps) | 88.55 % |
| Associated GOLD sequencing projects | 102 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.55 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (87.023 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (26.718 % of family members) |
| Environment Ontology (ENVO) | Unclassified (47.328 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (54.962 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 40.00% β-sheet: 0.00% Coil/Unstructured: 60.00% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.55 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 131 Family Scaffolds |
|---|---|---|
| PF00224 | PK | 53.44 |
| PF02146 | SIR2 | 22.14 |
| PF02887 | PK_C | 8.40 |
| PF01116 | F_bP_aldolase | 2.29 |
| PF12706 | Lactamase_B_2 | 2.29 |
| PF12146 | Hydrolase_4 | 0.76 |
| PF00753 | Lactamase_B | 0.76 |
| COG ID | Name | Functional Category | % Frequency in 131 Family Scaffolds |
|---|---|---|---|
| COG0469 | Pyruvate kinase | Carbohydrate transport and metabolism [G] | 61.83 |
| COG0846 | NAD-dependent protein deacetylase, SIR2 family | Posttranslational modification, protein turnover, chaperones [O] | 22.14 |
| COG0191 | Fructose/tagatose bisphosphate aldolase | Carbohydrate transport and metabolism [G] | 2.29 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 87.02 % |
| Unclassified | root | N/A | 12.98 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300002562|JGI25382J37095_10027711 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatimonas → Gemmatimonas aurantiaca | 2218 | Open in IMG/M |
| 3300002562|JGI25382J37095_10186327 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 635 | Open in IMG/M |
| 3300005181|Ga0066678_10580878 | All Organisms → cellular organisms → Bacteria | 744 | Open in IMG/M |
| 3300005187|Ga0066675_10844227 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 692 | Open in IMG/M |
| 3300005436|Ga0070713_102219078 | Not Available | 532 | Open in IMG/M |
| 3300005444|Ga0070694_100894810 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 732 | Open in IMG/M |
| 3300005446|Ga0066686_10042644 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatimonas → unclassified Gemmatimonas → Gemmatimonas sp. | 2731 | Open in IMG/M |
| 3300005467|Ga0070706_100055633 | All Organisms → cellular organisms → Bacteria | 3652 | Open in IMG/M |
| 3300005468|Ga0070707_100747650 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 941 | Open in IMG/M |
| 3300005540|Ga0066697_10673831 | All Organisms → cellular organisms → Bacteria | 568 | Open in IMG/M |
| 3300005552|Ga0066701_10236835 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 1127 | Open in IMG/M |
| 3300005553|Ga0066695_10091008 | All Organisms → cellular organisms → Bacteria | 1862 | Open in IMG/M |
| 3300005559|Ga0066700_10941419 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 571 | Open in IMG/M |
| 3300005569|Ga0066705_10724357 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 598 | Open in IMG/M |
| 3300005574|Ga0066694_10563583 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 530 | Open in IMG/M |
| 3300005575|Ga0066702_10691374 | All Organisms → cellular organisms → Bacteria | 608 | Open in IMG/M |
| 3300005576|Ga0066708_10441331 | All Organisms → cellular organisms → Bacteria | 835 | Open in IMG/M |
| 3300005586|Ga0066691_10105178 | Not Available | 1589 | Open in IMG/M |
| 3300006031|Ga0066651_10733568 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 532 | Open in IMG/M |
| 3300006032|Ga0066696_10096881 | All Organisms → cellular organisms → Bacteria | 1764 | Open in IMG/M |
| 3300006797|Ga0066659_10137288 | All Organisms → cellular organisms → Bacteria | 1721 | Open in IMG/M |
| 3300006800|Ga0066660_10755934 | All Organisms → cellular organisms → Bacteria | 793 | Open in IMG/M |
| 3300006804|Ga0079221_10091730 | Not Available | 1471 | Open in IMG/M |
| 3300006844|Ga0075428_100628221 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 1146 | Open in IMG/M |
| 3300006847|Ga0075431_102116428 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 517 | Open in IMG/M |
| 3300006904|Ga0075424_100496358 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 1303 | Open in IMG/M |
| 3300007258|Ga0099793_10081680 | Not Available | 1475 | Open in IMG/M |
| 3300009012|Ga0066710_100232159 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae | 2655 | Open in IMG/M |
| 3300009012|Ga0066710_100785526 | Not Available | 1458 | Open in IMG/M |
| 3300009012|Ga0066710_101609045 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 995 | Open in IMG/M |
| 3300009012|Ga0066710_103144105 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 637 | Open in IMG/M |
| 3300009012|Ga0066710_103537186 | Not Available | 590 | Open in IMG/M |
| 3300009089|Ga0099828_10238460 | Not Available | 1629 | Open in IMG/M |
| 3300009089|Ga0099828_11403981 | All Organisms → cellular organisms → Bacteria | 617 | Open in IMG/M |
| 3300009143|Ga0099792_10987403 | Not Available | 562 | Open in IMG/M |
| 3300009610|Ga0105340_1110596 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 1110 | Open in IMG/M |
| 3300010321|Ga0134067_10320318 | All Organisms → cellular organisms → Bacteria | 603 | Open in IMG/M |
| 3300010322|Ga0134084_10108575 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 894 | Open in IMG/M |
| 3300010323|Ga0134086_10239477 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 688 | Open in IMG/M |
| 3300010325|Ga0134064_10130349 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 853 | Open in IMG/M |
| 3300010333|Ga0134080_10446048 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 606 | Open in IMG/M |
| 3300010396|Ga0134126_12038148 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 627 | Open in IMG/M |
| 3300010403|Ga0134123_11355579 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 749 | Open in IMG/M |
| 3300011270|Ga0137391_10378786 | All Organisms → cellular organisms → Bacteria | 1212 | Open in IMG/M |
| 3300011270|Ga0137391_11506128 | Not Available | 518 | Open in IMG/M |
| 3300011271|Ga0137393_10855545 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 776 | Open in IMG/M |
| 3300011442|Ga0137437_1241123 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 626 | Open in IMG/M |
| 3300012096|Ga0137389_10706626 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 866 | Open in IMG/M |
| 3300012096|Ga0137389_11605598 | All Organisms → cellular organisms → Bacteria | 546 | Open in IMG/M |
| 3300012189|Ga0137388_11037054 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 756 | Open in IMG/M |
| 3300012198|Ga0137364_10590139 | All Organisms → cellular organisms → Bacteria | 837 | Open in IMG/M |
| 3300012199|Ga0137383_10929442 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 635 | Open in IMG/M |
| 3300012200|Ga0137382_10310421 | All Organisms → cellular organisms → Bacteria | 1102 | Open in IMG/M |
| 3300012200|Ga0137382_11016226 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 595 | Open in IMG/M |
| 3300012201|Ga0137365_10243382 | All Organisms → cellular organisms → Bacteria | 1339 | Open in IMG/M |
| 3300012201|Ga0137365_10609238 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 800 | Open in IMG/M |
| 3300012202|Ga0137363_10555780 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 967 | Open in IMG/M |
| 3300012206|Ga0137380_10974680 | All Organisms → cellular organisms → Bacteria | 726 | Open in IMG/M |
| 3300012206|Ga0137380_11392732 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 586 | Open in IMG/M |
| 3300012208|Ga0137376_10200208 | All Organisms → cellular organisms → Bacteria | 1728 | Open in IMG/M |
| 3300012209|Ga0137379_11478250 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 581 | Open in IMG/M |
| 3300012210|Ga0137378_11867028 | All Organisms → cellular organisms → Bacteria | 503 | Open in IMG/M |
| 3300012349|Ga0137387_10161618 | Not Available | 1599 | Open in IMG/M |
| 3300012349|Ga0137387_10449099 | All Organisms → cellular organisms → Bacteria | 935 | Open in IMG/M |
| 3300012355|Ga0137369_10320085 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 1143 | Open in IMG/M |
| 3300012360|Ga0137375_11180581 | Not Available | 588 | Open in IMG/M |
| 3300012582|Ga0137358_10282389 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 1128 | Open in IMG/M |
| 3300012683|Ga0137398_11154807 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 531 | Open in IMG/M |
| 3300012918|Ga0137396_10533933 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 869 | Open in IMG/M |
| 3300012924|Ga0137413_10765811 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 738 | Open in IMG/M |
| 3300012925|Ga0137419_10023410 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae | 3654 | Open in IMG/M |
| 3300012925|Ga0137419_11646215 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 547 | Open in IMG/M |
| 3300012971|Ga0126369_11037933 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 908 | Open in IMG/M |
| 3300012972|Ga0134077_10562440 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 512 | Open in IMG/M |
| 3300012976|Ga0134076_10136499 | All Organisms → cellular organisms → Bacteria | 996 | Open in IMG/M |
| 3300012977|Ga0134087_10721532 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 531 | Open in IMG/M |
| 3300014154|Ga0134075_10031710 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatimonas → Gemmatimonas aurantiaca | 2149 | Open in IMG/M |
| 3300014157|Ga0134078_10167845 | All Organisms → cellular organisms → Bacteria | 875 | Open in IMG/M |
| 3300014166|Ga0134079_10095400 | All Organisms → cellular organisms → Bacteria | 1127 | Open in IMG/M |
| 3300017654|Ga0134069_1156495 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 763 | Open in IMG/M |
| 3300017659|Ga0134083_10127369 | All Organisms → cellular organisms → Bacteria | 1019 | Open in IMG/M |
| 3300017659|Ga0134083_10205715 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 814 | Open in IMG/M |
| 3300017973|Ga0187780_10002183 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatimonas | 14767 | Open in IMG/M |
| 3300017997|Ga0184610_1164369 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 733 | Open in IMG/M |
| 3300018433|Ga0066667_10556824 | All Organisms → cellular organisms → Bacteria | 952 | Open in IMG/M |
| 3300018433|Ga0066667_11359343 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 622 | Open in IMG/M |
| 3300018468|Ga0066662_10704040 | All Organisms → cellular organisms → Bacteria | 964 | Open in IMG/M |
| 3300018469|Ga0190270_12285475 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 602 | Open in IMG/M |
| 3300018482|Ga0066669_10780273 | All Organisms → cellular organisms → Bacteria | 845 | Open in IMG/M |
| 3300019882|Ga0193713_1160453 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 597 | Open in IMG/M |
| 3300021081|Ga0210379_10492276 | Not Available | 545 | Open in IMG/M |
| 3300021559|Ga0210409_11197744 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 635 | Open in IMG/M |
| 3300024290|Ga0247667_1098712 | Not Available | 538 | Open in IMG/M |
| 3300025910|Ga0207684_10180839 | Not Available | 1818 | Open in IMG/M |
| 3300025910|Ga0207684_10619884 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 923 | Open in IMG/M |
| 3300026277|Ga0209350_1107466 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 655 | Open in IMG/M |
| 3300026277|Ga0209350_1164439 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 503 | Open in IMG/M |
| 3300026295|Ga0209234_1284208 | All Organisms → cellular organisms → Bacteria | 532 | Open in IMG/M |
| 3300026301|Ga0209238_1021427 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatimonas → Gemmatimonas aurantiaca | 2461 | Open in IMG/M |
| 3300026301|Ga0209238_1060332 | All Organisms → cellular organisms → Bacteria | 1347 | Open in IMG/M |
| 3300026301|Ga0209238_1137512 | All Organisms → cellular organisms → Bacteria | 779 | Open in IMG/M |
| 3300026310|Ga0209239_1021813 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatimonas → Gemmatimonas aurantiaca | 3163 | Open in IMG/M |
| 3300026310|Ga0209239_1362383 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 508 | Open in IMG/M |
| 3300026317|Ga0209154_1278879 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 558 | Open in IMG/M |
| 3300026318|Ga0209471_1007676 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatimonas → Gemmatimonas aurantiaca | 5767 | Open in IMG/M |
| 3300026318|Ga0209471_1173484 | All Organisms → cellular organisms → Bacteria | 862 | Open in IMG/M |
| 3300026323|Ga0209472_1263023 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 550 | Open in IMG/M |
| 3300026324|Ga0209470_1362080 | All Organisms → cellular organisms → Bacteria | 519 | Open in IMG/M |
| 3300026328|Ga0209802_1217151 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 713 | Open in IMG/M |
| 3300026332|Ga0209803_1364629 | All Organisms → cellular organisms → Bacteria | 503 | Open in IMG/M |
| 3300026333|Ga0209158_1299765 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 553 | Open in IMG/M |
| 3300026532|Ga0209160_1008092 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatimonas → Gemmatimonas aurantiaca | 7972 | Open in IMG/M |
| 3300026536|Ga0209058_1335693 | All Organisms → cellular organisms → Bacteria | 522 | Open in IMG/M |
| 3300026540|Ga0209376_1273409 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 701 | Open in IMG/M |
| 3300026542|Ga0209805_1041840 | All Organisms → cellular organisms → Bacteria | 2313 | Open in IMG/M |
| 3300026550|Ga0209474_10025796 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatimonas → Gemmatimonas aurantiaca | 4469 | Open in IMG/M |
| 3300027533|Ga0208185_1042201 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 1109 | Open in IMG/M |
| 3300027775|Ga0209177_10246451 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 658 | Open in IMG/M |
| 3300027775|Ga0209177_10370137 | All Organisms → cellular organisms → Bacteria | 566 | Open in IMG/M |
| 3300027875|Ga0209283_10717639 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 623 | Open in IMG/M |
| 3300027882|Ga0209590_10938167 | All Organisms → cellular organisms → Bacteria | 543 | Open in IMG/M |
| 3300027903|Ga0209488_10542995 | Not Available | 849 | Open in IMG/M |
| 3300027961|Ga0209853_1076974 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 877 | Open in IMG/M |
| 3300028293|Ga0247662_1059593 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 671 | Open in IMG/M |
| 3300031538|Ga0310888_11100990 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 502 | Open in IMG/M |
| 3300031720|Ga0307469_10976102 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 789 | Open in IMG/M |
| 3300031740|Ga0307468_100636844 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 878 | Open in IMG/M |
| 3300032180|Ga0307471_100649103 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 1217 | Open in IMG/M |
| 3300033433|Ga0326726_12456030 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 506 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 26.72% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 22.14% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 14.50% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 10.69% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 5.34% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 2.29% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 2.29% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.29% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.29% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 2.29% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.53% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.53% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.76% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.76% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.76% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.76% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.76% |
| Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 0.76% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.76% |
| Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 0.76% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300002562 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_40cm | Environmental | Open in IMG/M |
| 3300005181 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 | Environmental | Open in IMG/M |
| 3300005187 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 | Environmental | Open in IMG/M |
| 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
| 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Environmental | Open in IMG/M |
| 3300005446 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 | Environmental | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 | Environmental | Open in IMG/M |
| 3300005552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 | Environmental | Open in IMG/M |
| 3300005553 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 | Environmental | Open in IMG/M |
| 3300005559 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 | Environmental | Open in IMG/M |
| 3300005569 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 | Environmental | Open in IMG/M |
| 3300005574 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143 | Environmental | Open in IMG/M |
| 3300005575 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 | Environmental | Open in IMG/M |
| 3300005576 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 | Environmental | Open in IMG/M |
| 3300005586 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 | Environmental | Open in IMG/M |
| 3300006031 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100 | Environmental | Open in IMG/M |
| 3300006032 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
| 3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
| 3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
| 3300006847 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Host-Associated | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
| 3300009610 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT700 | Environmental | Open in IMG/M |
| 3300010321 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09212015 | Environmental | Open in IMG/M |
| 3300010322 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010323 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_0_1 metaG | Environmental | Open in IMG/M |
| 3300010333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300011442 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT138_2 | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
| 3300012355 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaG | Environmental | Open in IMG/M |
| 3300012360 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaG | Environmental | Open in IMG/M |
| 3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
| 3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012972 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300012976 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_0_1 metaG | Environmental | Open in IMG/M |
| 3300012977 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300014154 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09212015 | Environmental | Open in IMG/M |
| 3300014157 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300014166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09182015 | Environmental | Open in IMG/M |
| 3300017654 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300017659 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300017973 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MG | Environmental | Open in IMG/M |
| 3300017997 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_coex | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300018469 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300019882 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H3a2 | Environmental | Open in IMG/M |
| 3300021081 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_coex redo | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300024290 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK08 | Environmental | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026277 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_2_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026295 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026301 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026310 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026317 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 (SPAdes) | Environmental | Open in IMG/M |
| 3300026318 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 (SPAdes) | Environmental | Open in IMG/M |
| 3300026323 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 (SPAdes) | Environmental | Open in IMG/M |
| 3300026324 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 (SPAdes) | Environmental | Open in IMG/M |
| 3300026328 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 (SPAdes) | Environmental | Open in IMG/M |
| 3300026332 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 (SPAdes) | Environmental | Open in IMG/M |
| 3300026333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 (SPAdes) | Environmental | Open in IMG/M |
| 3300026532 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 (SPAdes) | Environmental | Open in IMG/M |
| 3300026536 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 (SPAdes) | Environmental | Open in IMG/M |
| 3300026540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 (SPAdes) | Environmental | Open in IMG/M |
| 3300026542 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 (SPAdes) | Environmental | Open in IMG/M |
| 3300026550 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 (SPAdes) | Environmental | Open in IMG/M |
| 3300027533 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT700 (SPAdes) | Environmental | Open in IMG/M |
| 3300027775 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control (SPAdes) | Environmental | Open in IMG/M |
| 3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027961 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_30_40 (SPAdes) | Environmental | Open in IMG/M |
| 3300028293 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK03 | Environmental | Open in IMG/M |
| 3300031538 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D1 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300033433 | Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MN | Environmental | Open in IMG/M |
| 3300033814 | Sediment microbial communities from East River floodplain, Colorado, United States - 55_j17 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI25382J37095_100277111 | 3300002562 | Grasslands Soil | GLEVLLRVGQLERRLGARAIEGMPATTISRAVHALEEFKRRLDAKQISVVX* |
| JGI25382J37095_101863272 | 3300002562 | Grasslands Soil | LLRAGQLERRLAARAIEGLPASSIARAVHLLGEFKQRLEEKQIGVVH* |
| Ga0066678_105808782 | 3300005181 | Soil | GQLERRLAARAIEGLPASGIARAVHVLEGFKRRLEERQIGVVR* |
| Ga0066675_108442271 | 3300005187 | Soil | LRAGQLERRLAARAIEGLPASSIARAVHLLAEFKQRLEQKQIGVVH* |
| Ga0070713_1022190782 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | LRASQLERRLAARAIEGLPASSIARAVHLLEEFKRRLEEKQIGVVR* |
| Ga0070694_1008948102 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | EVLLRAGQLERRLAARAIEGLPASSIARAVHLLEEFKLRLEEKQIGVMR* |
| Ga0066686_100426443 | 3300005446 | Soil | GQLERRLAARAIEGLPASSIARAVHLLVAFTQRLEEKQIGVVR* |
| Ga0070706_1000556331 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | LERRLAARAIEGLPASSIARAVHLLEEFKLRLEEKQIGVMR* |
| Ga0070707_1007476502 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | LLRAGQLERRLAARAIEGLPASTIARTVHLLEEFKRRLEEKQIGVVR* |
| Ga0070707_1020063952 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | LRVGQLERRLAARTIEGLPASTIARTVHLLQEFRQRLEQKQLEVVR* |
| Ga0066697_106738311 | 3300005540 | Soil | LEVLLRVGQLERRLAARAIEGLPASGIARAVHLLEGFKRRLEERQIGVVR* |
| Ga0066701_102368351 | 3300005552 | Soil | LLRAGQLERRLAARAIEGLAASSIARAVHLLEEFKQRLEEKQIGVVH* |
| Ga0066695_100910082 | 3300005553 | Soil | LRAGQLERRLAARAIEGLPASSIARAVHLLQEFRQRLEEKQIGVVH* |
| Ga0066700_109414191 | 3300005559 | Soil | QLERRLAARAIEGLPASSIARAVHLLEEFKQRLEEKQIGVVH* |
| Ga0066705_107243572 | 3300005569 | Soil | EVLLRAGQLERRLAARAIEGLPASSIARAVHLLGAFTQRLEEKQIGVVR* |
| Ga0066694_105635832 | 3300005574 | Soil | ARAIEGLPASSIARAVHLLGEFKQRLEEKQIGVVH* |
| Ga0066702_106913741 | 3300005575 | Soil | RAIEGLPASSIARAVHLLQEFKQRLEEKQIGVVR* |
| Ga0066708_104413311 | 3300005576 | Soil | SQLERRLAARAIEGLPASSIARAVHLLQEFKQRLEEKQIGVVR* |
| Ga0066691_101051781 | 3300005586 | Soil | LLRVGQLQRRLAARTIQGLPASAIARAAHLLGEFKRRLEERQIEIVK* |
| Ga0066651_107335682 | 3300006031 | Soil | ERRLAARTIEGLPASALQRAVHLLEEFRQRLQERTIEIVR* |
| Ga0066696_100968811 | 3300006032 | Soil | VGQLERRLAARAIEGMPASGIARAVHVLEGFKRRLEERQIGVVR* |
| Ga0066659_101372883 | 3300006797 | Soil | ARAIEGLPASGIARAVHLLEGFKRRLEERQIGVVR* |
| Ga0066660_107559342 | 3300006800 | Soil | FRRRLAARAIEGLPASGIARAVHVLKGFKRRLEERQIGVVR* |
| Ga0079221_100917302 | 3300006804 | Agricultural Soil | LRAGQLERRLAARAIEGLPASTIARTVHLLEEFKRRLEEKQIGVVH* |
| Ga0075428_1006282212 | 3300006844 | Populus Rhizosphere | RRLAARTLEGLPASSIQRAVHLLEEYRRRLEGRQIEIVR* |
| Ga0075431_1021164281 | 3300006847 | Populus Rhizosphere | LQRRLAARAIEGMPASAILRAINLLEEYAGRLSGKQLEVIR* |
| Ga0075424_1004963581 | 3300006904 | Populus Rhizosphere | EVLLRVGQLERRLAARSIEGMPASALQRAVHLLEEYKRRLEGRQLEVIR* |
| Ga0099793_100816802 | 3300007258 | Vadose Zone Soil | GQLERRLAARAIEGLPASSIARAVHLLEEFKLRLEEKQIGVMR* |
| Ga0066710_1002321591 | 3300009012 | Grasslands Soil | ARTIEGLPASALQRAVHLLEEFRHRLAERTIEIVR |
| Ga0066710_1007855262 | 3300009012 | Grasslands Soil | LLRCGQLERRLAARTIEGLPASALQRAVHLLEEFRHRLAERTIEIVR |
| Ga0066710_1016090452 | 3300009012 | Grasslands Soil | LDVLLRCGQLERRLAARTIEGLPASALQRAVHLLEEFRQRLEVRTIEIVR |
| Ga0066710_1031441051 | 3300009012 | Grasslands Soil | VLLRAGQLERRLAARTIEGMPASALQRALHLLQEFKRRLEGRQIEVIR |
| Ga0066710_1035371862 | 3300009012 | Grasslands Soil | RVGQLERRLAARAIEGMPASSIARAVHVLVGFKRRLEEKQIGVVR |
| Ga0099828_102384601 | 3300009089 | Vadose Zone Soil | QLERRLAARAIEGLPASSIARAVHLLEEFKLRLEEKQIGVVR* |
| Ga0099828_114039812 | 3300009089 | Vadose Zone Soil | LERRLAARAIEGLPASSIARAMHLLQEFKQRLEDKQIGVMR* |
| Ga0099792_109874031 | 3300009143 | Vadose Zone Soil | LAARSIEGMPASALQRAVHLLEEYKRRLEGRQLEVIR* |
| Ga0105340_11105962 | 3300009610 | Soil | LEAVLRVGHLERRLAARAIEGMPASAILRTVHLLQEFKRRLDEKHIGVVP* |
| Ga0134067_103203182 | 3300010321 | Grasslands Soil | RLAARAIEGMPASGIARAVHVLEGFKRRLEERQIGVVR* |
| Ga0134084_101085752 | 3300010322 | Grasslands Soil | LERRLAARAIEGLPASSIARAVHLLQEFRQRLEEKQIGVVH* |
| Ga0134086_102394771 | 3300010323 | Grasslands Soil | GDARRGQSLERRLAARAIEGLPASSIARAVHLLAEFKQRLEQKQIGVVH* |
| Ga0134064_101303491 | 3300010325 | Grasslands Soil | AARAIEGLPASSIARAVHLLGAFTQRLEEKQIGVVR* |
| Ga0134080_104460481 | 3300010333 | Grasslands Soil | QLERRLAARTIEGLPASALQRAVHLLEEFRQRLEVRTIEIVR* |
| Ga0134126_120381481 | 3300010396 | Terrestrial Soil | AGQLERRLAARAIEGLPASSIARAVHLLEEFKLRLEEKQIGVVR* |
| Ga0134123_113555792 | 3300010403 | Terrestrial Soil | ERRLAARNIEGMPASAIARAVHLLQEFRGRLEQKQLEVVR* |
| Ga0137391_103787861 | 3300011270 | Vadose Zone Soil | ARAIEGLPASSIARAMHLLQEFKQRLEDKQIGVMR* |
| Ga0137391_115061281 | 3300011270 | Vadose Zone Soil | ARSIEGLPASTLQRTVHLLEEYKRRLEGRQLEVIR* |
| Ga0137393_108555452 | 3300011271 | Vadose Zone Soil | LERRLAARAIEGLPASSIARAVHLLEEFKLRLEEKQIGVVR* |
| Ga0137437_12411231 | 3300011442 | Soil | AARAIEGMPASAILRTVHLLQEFKRRLDEKHIGVVP* |
| Ga0137389_107066261 | 3300012096 | Vadose Zone Soil | QLERRLAARAIEGMPATSISRTVHAVQEFKRRLDEKQISVVH* |
| Ga0137389_116055981 | 3300012096 | Vadose Zone Soil | LRAGQLERRLAARAIEGLPASSIARAVHLLEEFKQRLEEKQIGVVR* |
| Ga0137388_110370541 | 3300012189 | Vadose Zone Soil | LEVLLRAGQLERRLAARAIEGLPASSIARAVHLLEEFKQRLEEKQIGVVR* |
| Ga0137364_105901392 | 3300012198 | Vadose Zone Soil | GQLERRLAARAIEGMPASGIARAVHVLEGFKRRLEERQIGAVR* |
| Ga0137383_109294422 | 3300012199 | Vadose Zone Soil | RRLAARAIEGLPASSIARAVHLLEEFKQRLEEKQIGVVR* |
| Ga0137382_103104211 | 3300012200 | Vadose Zone Soil | QLERRLAARAVEGLPASGIARAVHVLKGFKRRLEERQIGVVR* |
| Ga0137382_110162262 | 3300012200 | Vadose Zone Soil | RLAARTIEGMPASAIARAVHLLQEFRQRLEQKLLEVVR* |
| Ga0137365_102433823 | 3300012201 | Vadose Zone Soil | ERRLAARAIEGLPASSIARTVDLLQEFKQRLEDKQIGVVR* |
| Ga0137365_106092382 | 3300012201 | Vadose Zone Soil | AARAIEGLPASSIARAVHLLQEFKQRLEEKQIGVVH* |
| Ga0137363_105557801 | 3300012202 | Vadose Zone Soil | DVLLRAGQLERRLAARAIEGLPASSIARAVHLLQEFRQRLEEKQIGVVH* |
| Ga0137380_109746801 | 3300012206 | Vadose Zone Soil | LERRLAARAVEGLPASSIARAVHLLQEFKQRLEEKQIGVVR* |
| Ga0137380_113927322 | 3300012206 | Vadose Zone Soil | AARAIEGLPASSIARAVHLLEEFKQRLEEKQIGVVH* |
| Ga0137376_102002081 | 3300012208 | Vadose Zone Soil | ARAIEGMPASGIARAVHVLEGFKRRLEERQIGVVR* |
| Ga0137379_114782502 | 3300012209 | Vadose Zone Soil | RRLAARTIEGLPASSITRTVALLQELKRRLEGRQIAVVP* |
| Ga0137378_118670282 | 3300012210 | Vadose Zone Soil | EVLLRAGQLERRLAARAIEGLPASSIARAVHLLEEFKQRLEEKQIGVVH* |
| Ga0137387_101616182 | 3300012349 | Vadose Zone Soil | TRMTFAPASSIARAVHLLEEFKQRLEQKQIGVVH* |
| Ga0137387_104490992 | 3300012349 | Vadose Zone Soil | LRAGQLERRLAARAIEGLPASSIARTVHLLQEFRRRLEEKQIGVVH* |
| Ga0137369_103200851 | 3300012355 | Vadose Zone Soil | QLERRLAARAIEGLPASSIARAVHLLEEFKQRLEEKQIGVVR* |
| Ga0137375_111805812 | 3300012360 | Vadose Zone Soil | AARAIEGLPASSIARTVRLLQEFRQRLEEKQIGVVH* |
| Ga0137358_102823892 | 3300012582 | Vadose Zone Soil | LRAGQLERRLAARAIEGLPASSIARAVHLLEEFRQRLEAKQIGVVH* |
| Ga0137398_111548072 | 3300012683 | Vadose Zone Soil | RLAARAIEGLPASSIARAVHLLEEFKQRLEEKQIGVVR* |
| Ga0137396_105339331 | 3300012918 | Vadose Zone Soil | AARAIEGLPASSIARAVHLLEEFKLRLEEKQIGVMR* |
| Ga0137413_107658112 | 3300012924 | Vadose Zone Soil | LKAGQLERRLAARTIEGLPASSITRTVALLQELKRRLEGRQIAVVP* |
| Ga0137419_100234104 | 3300012925 | Vadose Zone Soil | LRAGQLERRLAARAIEGLPASSIARAVHLLEEFKLRLEEKQIGVMR* |
| Ga0137419_116462151 | 3300012925 | Vadose Zone Soil | RLAARAIEGLPASSIARAVHLLEEFKLRLEEKQIGVVR* |
| Ga0126369_110379331 | 3300012971 | Tropical Forest Soil | RLAARSIEGMPASALQRTVHLLEEYKRRLEGRQLEVIR* |
| Ga0134077_105624402 | 3300012972 | Grasslands Soil | LAARAIEGLPASSIARAVHLLEEFKQRLEQKQIGVVH* |
| Ga0134076_101364992 | 3300012976 | Grasslands Soil | LAARAIEGMPASSIARAVHVLDEFKRRLEEKQIGVVR* |
| Ga0134087_107215321 | 3300012977 | Grasslands Soil | GQLERRLAARAIEGPPASSIARAVHLLEEFKQRLEEKQIGVVH* |
| Ga0134075_100317101 | 3300014154 | Grasslands Soil | AGQRERRLAARAIEGMPASGLARAVSLLHAFKRRLDEKQIQVVT* |
| Ga0134078_101678452 | 3300014157 | Grasslands Soil | MYGARAIEGLPASSIARTVHLLQEFKQRLEEKQIGVVR* |
| Ga0134079_100954003 | 3300014166 | Grasslands Soil | RRLAARAIEGLPASSIARAVHLLQEFKQRLEENHIGVVR* |
| Ga0134069_11564951 | 3300017654 | Grasslands Soil | ARAIEGMPATTISRGVHTLQEFKRRLDEKQISVVH |
| Ga0134083_101273693 | 3300017659 | Grasslands Soil | RLAARAIEGLPASGIARAVHVLEGFRRRLEERQIGVVR |
| Ga0134083_102057152 | 3300017659 | Grasslands Soil | GQLERRLAARAIEGLPASSIARAVHLLGEFTQRLAEKQIGVVQ |
| Ga0187780_1000218315 | 3300017973 | Tropical Peatland | VGQLERRLAARAIEGMPASGVARAVHVLEEFTQRLLEKQISVVP |
| Ga0184610_11643691 | 3300017997 | Groundwater Sediment | GRRVAARIIEEMPASAIQRAAHVLQEYKRRLEGRQIEVVR |
| Ga0066667_105568242 | 3300018433 | Grasslands Soil | AARAIEGLPASSVARAVHLLQVFKQRLEEKQIGVVR |
| Ga0066667_113593432 | 3300018433 | Grasslands Soil | RASQLERRLAARAIEGLPASSIARAVHLLEEFRQRLEEKQIGVVH |
| Ga0066662_107040401 | 3300018468 | Grasslands Soil | QLERRLAARAIEGLPASGIARAVHVLEGFKRRLEERQIGVVR |
| Ga0190270_122854752 | 3300018469 | Soil | VGQLERRLAARAIDGLPASAILRTVHLLQEFKRRLDEKHIGVVP |
| Ga0066669_107802731 | 3300018482 | Grasslands Soil | RLAARAIEGLPASGIARAVHVLKGFKRRLEERQIGVVR |
| Ga0193713_11604532 | 3300019882 | Soil | VVLRVGHLERRLAARAIEGMPASAIMRTVHILQQFKRRLDEKHIGVVP |
| Ga0210379_104922761 | 3300021081 | Groundwater Sediment | RRLAARIIEGLPATGIQRAVHLLEEYKRRLEGRQLEVVR |
| Ga0210409_111977442 | 3300021559 | Soil | LERRLAARAIEGLPASTITRAVRVLEEFGRRLEGKQISVLP |
| Ga0247667_10987122 | 3300024290 | Soil | ERRLAARAIEGMPASTLQRTVHLLEELKRRLEGRQLEVIR |
| Ga0207684_101808392 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | RAGQLERRLAARAIEGLPASSIARAVHLLEEFKLRLEEKQIGVVR |
| Ga0207684_106198841 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | LRAGQLERRLAARAIEGLPASSIARAVHLLEEFKLRLEEKQIGVMR |
| Ga0209350_11074662 | 3300026277 | Grasslands Soil | ARAIEGLPASSIARAVHLLQEFKRRLEEKQIGVVH |
| Ga0209350_11644392 | 3300026277 | Grasslands Soil | GARAIEGMPATTISRAVHALEEFKRRLDAKQISVVH |
| Ga0209234_12842081 | 3300026295 | Grasslands Soil | AARAIEGLPASGIARAVHVLKGFKRRLEERQIGVVR |
| Ga0209238_10214273 | 3300026301 | Grasslands Soil | LAARTIEGLPASALQRAVHLLEEFRQRLQERTIEIVR |
| Ga0209238_10603321 | 3300026301 | Grasslands Soil | LDGLLRASQLERRLAARAIEGLPASSIARTVHLLQEFKQRLEEKQIGVVR |
| Ga0209238_11375122 | 3300026301 | Grasslands Soil | VLLRVGQLERRLAARAIEGMPASGIARAVHVLEGFKRRLEERQIGVVR |
| Ga0209239_10218134 | 3300026310 | Grasslands Soil | ARAIEGMPATTISRAVHALEEFKRRLDAKQISVVH |
| Ga0209239_13623832 | 3300026310 | Grasslands Soil | ARTIEGLPASALQRAVHLLEEFRQRLQERTIEIVR |
| Ga0209154_12788791 | 3300026317 | Soil | RLAARAIEGLPASSIARAVHLLEEFKQRLEEKQIGVVH |
| Ga0209471_10076761 | 3300026318 | Soil | RRLAARAIEGMPATTMGRAVHTLQEFKRRLDEKQISVVH |
| Ga0209471_11734842 | 3300026318 | Soil | ERRLAARAIEGLPASSIARTVHLLQEFKQRLEEKQIGVVR |
| Ga0209472_12630231 | 3300026323 | Soil | ARAIEGLPASSIARAVHLLQEFRQRLEEKQIGVVH |
| Ga0209470_13620801 | 3300026324 | Soil | GQLERRLAARAIEGLPASSIARAVHLLEEFKQRLEAKQIGVVH |
| Ga0209802_12171511 | 3300026328 | Soil | LAARAIEGLPASSIARAVHLLQEFKRRLEEKQIGVVH |
| Ga0209803_13646291 | 3300026332 | Soil | RLAARAIEGLPASSIARAVHLLEEFKLRLEEKQIGVVR |
| Ga0209158_12997652 | 3300026333 | Soil | LLRVGQLERRLAARAIEGMPATTMGRAVHTLQEFKRRLDEKQISVVH |
| Ga0209160_10080929 | 3300026532 | Soil | EVLLRVGQLERRLAARAIEGMPATTISRGVHTLQEFKRRLDEKQISVVH |
| Ga0209058_13356931 | 3300026536 | Soil | RAGQLERRLAARAIEGLPASSIARAVHLLEEFKQRLEEKQIGVVH |
| Ga0209376_12734091 | 3300026540 | Soil | AGQLERRLAARAIEGLAASSIARAVHLLEEFKQRLEQKQIGVVH |
| Ga0209805_10418403 | 3300026542 | Soil | RLAARAIEGLPASGIARAVHLLEGFKRRLEERQIGVVR |
| Ga0209474_100257961 | 3300026550 | Soil | GLLRASQLERRLAARAIEGLPASSIARTVHLLQEFKQRLEEKQIGVVR |
| Ga0208185_10422011 | 3300027533 | Soil | LEAVLRVGHLERRLAARAIEGMPASAILRTVHLLQEFKRRLDEKHIGVVP |
| Ga0209177_102464512 | 3300027775 | Agricultural Soil | ARAIEGLPASTIARTVHLLEEFKRRLEEKQIGVVH |
| Ga0209177_103701372 | 3300027775 | Agricultural Soil | LERRLAARAIEGLPASSIARTVHLLQEFKQRLEEKQIGVVR |
| Ga0209283_107176391 | 3300027875 | Vadose Zone Soil | ERRLAARAIEGLPASSIARAVHLLEEFKLRLEEKQIGVVR |
| Ga0209590_109381672 | 3300027882 | Vadose Zone Soil | ERRLAARAIEGLPATAITRAVHTLEEFRRRLEEKQISIVH |
| Ga0209488_105429951 | 3300027903 | Vadose Zone Soil | IERRLAARSIEGMPASALQRAVHLLEEYKRRLEGRQLEVIR |
| Ga0209853_10769742 | 3300027961 | Groundwater Sand | LAARIIEGLPATGIQRAVHLLEEYKRRLEGRQLEVVR |
| Ga0247662_10595932 | 3300028293 | Soil | ARSIEGMPASTLQRTVHLLEELKRRLEGRQLEVIR |
| Ga0310888_111009901 | 3300031538 | Soil | VGHLERRLAARAIEGMPASAILRTVHLLQQFKRQLAEKHIAVVP |
| Ga0307469_109761022 | 3300031720 | Hardwood Forest Soil | RLAARAIEGLPASSIARAVHLLEAFKLRLEEKQIGVMR |
| Ga0307468_1006368441 | 3300031740 | Hardwood Forest Soil | GQLERRLAARAIEGLPASAIVRSVHLLQQFKLRLDEKHIGVVP |
| Ga0307471_1006491032 | 3300032180 | Hardwood Forest Soil | QLERRLAARAIEGLPASSIARAVHLLEEFKLRLEEKQIGVVR |
| Ga0326726_124560301 | 3300033433 | Peat Soil | VGQLERRLAARTIEGIPASALQRAVHLLEDYRRRLQGRHLEVVR |
| Ga0364930_0051937_1264_1392 | 3300033814 | Sediment | QLERRLGARTIEGMPASAIARAVHLLQEFRQRLEQKQLEVVR |
| ⦗Top⦘ |