Basic Information | |
---|---|
Family ID | F061661 |
Family Type | Metagenome |
Number of Sequences | 131 |
Average Sequence Length | 37 residues |
Representative Sequence | MRYREHYTIQPVTRKWADIALAVAIGVGLAFFFFMGV |
Number of Associated Samples | 76 |
Number of Associated Scaffolds | 130 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | No |
Most common taxonomic group | Viruses |
% of genes with valid RBS motifs | 95.42 % |
% of genes near scaffold ends (potentially truncated) | 6.11 % |
% of genes from short scaffolds (< 2000 bps) | 70.23 % |
Associated GOLD sequencing projects | 66 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.50 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Duplodnaviria (74.809 % of family members) |
NCBI Taxonomy ID | 2731341 |
Taxonomy | All Organisms → Viruses → Duplodnaviria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake (38.168 % of family members) |
Environment Ontology (ENVO) | Unclassified (53.435 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (57.252 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 38.46% β-sheet: 0.00% Coil/Unstructured: 61.54% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.50 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 130 Family Scaffolds |
---|---|---|
PF01381 | HTH_3 | 24.62 |
PF10926 | DUF2800 | 5.38 |
PF00959 | Phage_lysozyme | 3.08 |
PF13481 | AAA_25 | 2.31 |
PF05930 | Phage_AlpA | 1.54 |
PF13392 | HNH_3 | 1.54 |
PF03237 | Terminase_6N | 1.54 |
PF08291 | Peptidase_M15_3 | 0.77 |
PF01011 | PQQ | 0.77 |
PF02592 | Vut_1 | 0.77 |
PF01527 | HTH_Tnp_1 | 0.77 |
PF01022 | HTH_5 | 0.77 |
PF11134 | Phage_stabilise | 0.77 |
COG ID | Name | Functional Category | % Frequency in 130 Family Scaffolds |
---|---|---|---|
COG3311 | DNA-binding transcriptional regulator AlpA | Transcription [K] | 1.54 |
COG1738 | Queuosine precursor transporter YhhQ, DUF165 family | Translation, ribosomal structure and biogenesis [J] | 0.77 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 84.73 % |
Unclassified | root | N/A | 15.27 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300000882|FwDRAFT_10102055 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 948 | Open in IMG/M |
3300005581|Ga0049081_10347258 | Not Available | 504 | Open in IMG/M |
3300006803|Ga0075467_10555994 | Not Available | 588 | Open in IMG/M |
3300006805|Ga0075464_10052325 | All Organisms → Viruses → Predicted Viral | 2255 | Open in IMG/M |
3300006805|Ga0075464_10127036 | All Organisms → Viruses → Predicted Viral | 1485 | Open in IMG/M |
3300006805|Ga0075464_10184373 | Not Available | 1236 | Open in IMG/M |
3300006805|Ga0075464_10313624 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 945 | Open in IMG/M |
3300006805|Ga0075464_10324086 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 929 | Open in IMG/M |
3300006805|Ga0075464_10635239 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 658 | Open in IMG/M |
3300006805|Ga0075464_10753471 | Not Available | 604 | Open in IMG/M |
3300006805|Ga0075464_10754409 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 603 | Open in IMG/M |
3300006805|Ga0075464_10891024 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 555 | Open in IMG/M |
3300006920|Ga0070748_1043614 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1800 | Open in IMG/M |
3300006920|Ga0070748_1114071 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1023 | Open in IMG/M |
3300007548|Ga0102877_1131621 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 709 | Open in IMG/M |
3300007559|Ga0102828_1138452 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 606 | Open in IMG/M |
3300007708|Ga0102859_1148563 | Not Available | 687 | Open in IMG/M |
3300007974|Ga0105747_1267639 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 574 | Open in IMG/M |
3300008055|Ga0108970_10441583 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 614 | Open in IMG/M |
3300009026|Ga0102829_1152984 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 738 | Open in IMG/M |
3300009068|Ga0114973_10002196 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 14318 | Open in IMG/M |
3300009068|Ga0114973_10009269 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 6444 | Open in IMG/M |
3300009068|Ga0114973_10097521 | All Organisms → Viruses → Predicted Viral | 1674 | Open in IMG/M |
3300009151|Ga0114962_10037507 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3276 | Open in IMG/M |
3300009151|Ga0114962_10053222 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2657 | Open in IMG/M |
3300009151|Ga0114962_10167073 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1309 | Open in IMG/M |
3300009151|Ga0114962_10592578 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 576 | Open in IMG/M |
3300009152|Ga0114980_10420243 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 765 | Open in IMG/M |
3300009154|Ga0114963_10478049 | Not Available | 665 | Open in IMG/M |
3300009158|Ga0114977_10003987 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 9435 | Open in IMG/M |
3300009158|Ga0114977_10062358 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2294 | Open in IMG/M |
3300009158|Ga0114977_10100250 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1757 | Open in IMG/M |
3300009160|Ga0114981_10048443 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2389 | Open in IMG/M |
3300009160|Ga0114981_10160057 | All Organisms → Viruses → Predicted Viral | 1240 | Open in IMG/M |
3300009163|Ga0114970_10007887 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 7564 | Open in IMG/M |
3300009163|Ga0114970_10030637 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3579 | Open in IMG/M |
3300009163|Ga0114970_10043835 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2917 | Open in IMG/M |
3300009163|Ga0114970_10095879 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1842 | Open in IMG/M |
3300009163|Ga0114970_10517996 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 649 | Open in IMG/M |
3300009164|Ga0114975_10000376 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 33496 | Open in IMG/M |
3300009164|Ga0114975_10279051 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 929 | Open in IMG/M |
3300009180|Ga0114979_10148283 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1436 | Open in IMG/M |
3300009180|Ga0114979_10155536 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1398 | Open in IMG/M |
3300009180|Ga0114979_10219573 | Not Available | 1146 | Open in IMG/M |
3300009183|Ga0114974_10117625 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1693 | Open in IMG/M |
3300009684|Ga0114958_10436174 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 632 | Open in IMG/M |
3300010157|Ga0114964_10053046 | All Organisms → Viruses → Predicted Viral | 2117 | Open in IMG/M |
3300010160|Ga0114967_10149903 | All Organisms → Viruses → Predicted Viral | 1297 | Open in IMG/M |
3300010334|Ga0136644_10115492 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1658 | Open in IMG/M |
3300010885|Ga0133913_13206477 | All Organisms → Viruses → Predicted Viral | 1081 | Open in IMG/M |
3300011009|Ga0129318_10193292 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 645 | Open in IMG/M |
3300011115|Ga0151514_10082 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 40067 | Open in IMG/M |
3300011115|Ga0151514_10082 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 40067 | Open in IMG/M |
3300011115|Ga0151514_10392 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 19309 | Open in IMG/M |
3300011335|Ga0153698_1669 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 13497 | Open in IMG/M |
3300011335|Ga0153698_1710 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 12952 | Open in IMG/M |
3300013006|Ga0164294_10872116 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 606 | Open in IMG/M |
3300013014|Ga0164295_10922901 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 677 | Open in IMG/M |
3300013372|Ga0177922_10957334 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 644 | Open in IMG/M |
3300017722|Ga0181347_1070999 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1027 | Open in IMG/M |
3300017736|Ga0181365_1050185 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1043 | Open in IMG/M |
3300017777|Ga0181357_1195322 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 725 | Open in IMG/M |
3300017784|Ga0181348_1253492 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 608 | Open in IMG/M |
3300017785|Ga0181355_1101535 | Not Available | 1189 | Open in IMG/M |
3300017785|Ga0181355_1251038 | Not Available | 678 | Open in IMG/M |
3300018416|Ga0181553_10082968 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2020 | Open in IMG/M |
3300019783|Ga0181361_111450 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 691 | Open in IMG/M |
3300019784|Ga0181359_1000233 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 11591 | Open in IMG/M |
3300019784|Ga0181359_1109250 | All Organisms → Viruses → Predicted Viral | 1004 | Open in IMG/M |
3300020141|Ga0211732_1184884 | Not Available | 621 | Open in IMG/M |
3300020205|Ga0211731_10922221 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 776 | Open in IMG/M |
3300021956|Ga0213922_1002492 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 6274 | Open in IMG/M |
3300021962|Ga0222713_10028995 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4495 | Open in IMG/M |
3300021962|Ga0222713_10145562 | Not Available | 1641 | Open in IMG/M |
3300021963|Ga0222712_10001025 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 35812 | Open in IMG/M |
3300021963|Ga0222712_10034617 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3944 | Open in IMG/M |
3300021963|Ga0222712_10130113 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1723 | Open in IMG/M |
3300021963|Ga0222712_10211010 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1264 | Open in IMG/M |
3300021963|Ga0222712_10760756 | Not Available | 538 | Open in IMG/M |
3300022407|Ga0181351_1005219 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4933 | Open in IMG/M |
3300023184|Ga0214919_10831156 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 500 | Open in IMG/M |
3300025595|Ga0208248_1000995 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 8008 | Open in IMG/M |
3300025645|Ga0208643_1076375 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 964 | Open in IMG/M |
3300025732|Ga0208784_1065809 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1102 | Open in IMG/M |
3300025896|Ga0208916_10009419 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3809 | Open in IMG/M |
3300025896|Ga0208916_10020529 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2611 | Open in IMG/M |
3300025896|Ga0208916_10039856 | All Organisms → Viruses → Predicted Viral | 1908 | Open in IMG/M |
3300025896|Ga0208916_10071877 | All Organisms → Viruses → Predicted Viral | 1440 | Open in IMG/M |
3300025896|Ga0208916_10341827 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 652 | Open in IMG/M |
3300027708|Ga0209188_1144934 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 902 | Open in IMG/M |
3300027733|Ga0209297_1001292 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 14576 | Open in IMG/M |
3300027733|Ga0209297_1100651 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1238 | Open in IMG/M |
3300027734|Ga0209087_1008546 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5345 | Open in IMG/M |
3300027736|Ga0209190_1000296 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 36299 | Open in IMG/M |
3300027736|Ga0209190_1000999 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 20184 | Open in IMG/M |
3300027736|Ga0209190_1005413 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 8172 | Open in IMG/M |
3300027736|Ga0209190_1010620 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5499 | Open in IMG/M |
3300027736|Ga0209190_1047026 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2207 | Open in IMG/M |
3300027736|Ga0209190_1054786 | Not Available | 1994 | Open in IMG/M |
3300027736|Ga0209190_1085366 | All Organisms → Viruses → Predicted Viral | 1490 | Open in IMG/M |
3300027749|Ga0209084_1077565 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1513 | Open in IMG/M |
3300027749|Ga0209084_1314384 | Not Available | 585 | Open in IMG/M |
3300027759|Ga0209296_1000389 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 37962 | Open in IMG/M |
3300027759|Ga0209296_1001614 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 17015 | Open in IMG/M |
3300027759|Ga0209296_1354948 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 563 | Open in IMG/M |
3300027763|Ga0209088_10016818 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3840 | Open in IMG/M |
3300027763|Ga0209088_10288751 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 668 | Open in IMG/M |
3300027764|Ga0209134_10260695 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 593 | Open in IMG/M |
3300027973|Ga0209298_10062258 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1702 | Open in IMG/M |
3300028178|Ga0265593_1024721 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1868 | Open in IMG/M |
3300028394|Ga0304730_1146801 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 953 | Open in IMG/M |
3300031707|Ga0315291_10463903 | All Organisms → Viruses → Predicted Viral | 1186 | Open in IMG/M |
3300031707|Ga0315291_10822802 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 805 | Open in IMG/M |
3300031746|Ga0315293_10778880 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 703 | Open in IMG/M |
3300031772|Ga0315288_10556477 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1117 | Open in IMG/M |
3300031834|Ga0315290_11351366 | Not Available | 585 | Open in IMG/M |
3300031834|Ga0315290_11634354 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 519 | Open in IMG/M |
3300031999|Ga0315274_10515864 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1346 | Open in IMG/M |
3300031999|Ga0315274_10922161 | Not Available | 906 | Open in IMG/M |
3300032046|Ga0315289_10065389 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4444 | Open in IMG/M |
3300032053|Ga0315284_11200643 | Not Available | 833 | Open in IMG/M |
3300032053|Ga0315284_11368471 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 762 | Open in IMG/M |
3300032092|Ga0315905_10743123 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 863 | Open in IMG/M |
3300032173|Ga0315268_10259342 | All Organisms → Viruses → Predicted Viral | 1675 | Open in IMG/M |
3300032173|Ga0315268_10912785 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 882 | Open in IMG/M |
3300032173|Ga0315268_12002710 | Not Available | 593 | Open in IMG/M |
3300032177|Ga0315276_12178557 | Not Available | 562 | Open in IMG/M |
3300032275|Ga0315270_10431434 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 843 | Open in IMG/M |
3300032397|Ga0315287_11443691 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 781 | Open in IMG/M |
3300032516|Ga0315273_11469338 | Not Available | 840 | Open in IMG/M |
3300033233|Ga0334722_10868893 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 637 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 38.17% |
Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 14.50% |
Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 14.50% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 8.40% |
Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 5.34% |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 4.58% |
Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 3.05% |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 2.29% |
Freshwater | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater | 1.53% |
Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 0.76% |
Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 0.76% |
Freshwater And Marine | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater And Marine | 0.76% |
Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 0.76% |
Freshwater | Environmental → Aquatic → Freshwater → Creek → Unclassified → Freshwater | 0.76% |
Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 0.76% |
Estuary Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water | 0.76% |
Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 0.76% |
Saline Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Water | 0.76% |
Estuary | Host-Associated → Plants → Leaf → Unclassified → Unclassified → Estuary | 0.76% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300000882 | Freshwater microbial communities from the Columbia River | Environmental | Open in IMG/M |
3300005581 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF | Environmental | Open in IMG/M |
3300006803 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_>0.8_DNA | Environmental | Open in IMG/M |
3300006805 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA | Environmental | Open in IMG/M |
3300006920 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 | Environmental | Open in IMG/M |
3300007548 | Estuarine microbial communities from the Columbia River estuary - metaG 1548B-3 | Environmental | Open in IMG/M |
3300007559 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.541 | Environmental | Open in IMG/M |
3300007708 | Estuarine microbial communities from the Columbia River estuary - metaG 1371B-02 | Environmental | Open in IMG/M |
3300007974 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460C_0.2um | Environmental | Open in IMG/M |
3300008055 | Metatranscriptomes of the Eelgrass leaves and roots. Combined Assembly of Gp0128390, Gp0128391, Gp0128392, and Gp0128393 | Host-Associated | Open in IMG/M |
3300009026 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.575 | Environmental | Open in IMG/M |
3300009068 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_MF_MetaG | Environmental | Open in IMG/M |
3300009151 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_MF_MetaG | Environmental | Open in IMG/M |
3300009152 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaG | Environmental | Open in IMG/M |
3300009154 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_EF_MetaG | Environmental | Open in IMG/M |
3300009158 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG | Environmental | Open in IMG/M |
3300009160 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_MF_MetaG | Environmental | Open in IMG/M |
3300009163 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140205_XF_MetaG | Environmental | Open in IMG/M |
3300009164 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaG | Environmental | Open in IMG/M |
3300009180 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaG | Environmental | Open in IMG/M |
3300009183 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG | Environmental | Open in IMG/M |
3300009684 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130208_EF_MetaG | Environmental | Open in IMG/M |
3300010157 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_MF_MetaG | Environmental | Open in IMG/M |
3300010160 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130628_MF_MetaG | Environmental | Open in IMG/M |
3300010334 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_EF_MetaG (v2) | Environmental | Open in IMG/M |
3300010885 | northern Canada Lakes Co-assembly | Environmental | Open in IMG/M |
3300011009 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_0.1_0.8_DNA | Environmental | Open in IMG/M |
3300011115 | Freshwater viral communities from Lake Soyang, Gangwon-do, South Korea - SYL_2016May | Environmental | Open in IMG/M |
3300011335 | Lotic viral community from Han River, Hwacheon, Gangwon-do, South Korea - Guman | Environmental | Open in IMG/M |
3300013006 | Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - GEODES005 metaG | Environmental | Open in IMG/M |
3300013014 | Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - GEODES006 metaG | Environmental | Open in IMG/M |
3300013372 | Freshwater microbial communities from Lake Erie, Ontario, Canada. Combined Assembly of 10 SPs | Environmental | Open in IMG/M |
3300017722 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.N | Environmental | Open in IMG/M |
3300017736 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.D.N | Environmental | Open in IMG/M |
3300017777 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.D.N | Environmental | Open in IMG/M |
3300017784 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.D.N | Environmental | Open in IMG/M |
3300017785 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.D.N | Environmental | Open in IMG/M |
3300018416 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011502XT metaG (megahit assembly) | Environmental | Open in IMG/M |
3300019783 | Freshwater viral communities from Lake Michigan, USA - Sp13.ND.MM110.S.N | Environmental | Open in IMG/M |
3300019784 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D | Environmental | Open in IMG/M |
3300020141 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_104 megahit1 | Environmental | Open in IMG/M |
3300020205 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_103 megahit1 | Environmental | Open in IMG/M |
3300021956 | Freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 29-17 MG | Environmental | Open in IMG/M |
3300021962 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649D | Environmental | Open in IMG/M |
3300021963 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_657D | Environmental | Open in IMG/M |
3300022407 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.S.D | Environmental | Open in IMG/M |
3300023184 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1503 | Environmental | Open in IMG/M |
3300025595 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - MA5M (SPAdes) | Environmental | Open in IMG/M |
3300025645 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 (SPAdes) | Environmental | Open in IMG/M |
3300025732 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
3300025896 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
3300027708 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027733 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027734 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027736 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140205_XF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027749 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027759 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027763 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027764 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MLB.SN (SPAdes) | Environmental | Open in IMG/M |
3300027973 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300028178 | Saline water microbial communities from Sakinaw Lake, British Columbia, Canada - sak_2011_5_24_36m | Environmental | Open in IMG/M |
3300028394 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130628_MF_MetaG (v2) | Environmental | Open in IMG/M |
3300031707 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G12_20 | Environmental | Open in IMG/M |
3300031746 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_20 | Environmental | Open in IMG/M |
3300031772 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_20 | Environmental | Open in IMG/M |
3300031834 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G12_0 | Environmental | Open in IMG/M |
3300031999 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_20 | Environmental | Open in IMG/M |
3300032046 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_40 | Environmental | Open in IMG/M |
3300032053 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_16 | Environmental | Open in IMG/M |
3300032092 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA121 | Environmental | Open in IMG/M |
3300032173 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C1_top | Environmental | Open in IMG/M |
3300032177 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G05_0 | Environmental | Open in IMG/M |
3300032275 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C1_bottom | Environmental | Open in IMG/M |
3300032397 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_0 | Environmental | Open in IMG/M |
3300032516 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_0 | Environmental | Open in IMG/M |
3300033233 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C3_bottom | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
FwDRAFT_101020552 | 3300000882 | Freshwater And Marine | MRYREHYTIQPTARKWADIALAIAIGVGLAFFFFMGV* |
Ga0049081_103472581 | 3300005581 | Freshwater Lentic | MRYREHYTIQPVTRKWADIALAVAIGLGLATLFFLGA* |
Ga0075467_105559942 | 3300006803 | Aqueous | MRYREHYTIQPTARKWADIALAVAIGVGLAFFFLMGV* |
Ga0075464_100523251 | 3300006805 | Aqueous | MRYREHYTIQPVTRKWADIALALTIGVGLAFFFFMGV* |
Ga0075464_101270367 | 3300006805 | Aqueous | MRYREHYIIQPVTRKWADIALAVAIGLGLATLFFFGV* |
Ga0075464_101843733 | 3300006805 | Aqueous | MRYREHYTIQPVTRKWADIALAVAIGVGLAFFFLMGA* |
Ga0075464_103136243 | 3300006805 | Aqueous | MRYREHYTIQPVTRKWADITLAVAIGVGLAFFFLMGV* |
Ga0075464_103240865 | 3300006805 | Aqueous | FRRSIMRYREHYTIQPTARKWADIALAIAIGVGLAFFFFMGV* |
Ga0075464_106352392 | 3300006805 | Aqueous | MRYREHYTIQPTTRKWAEIALAVAIGLGLATLFFFGV* |
Ga0075464_107534711 | 3300006805 | Aqueous | MRYREHYTIQPTARKWADIALALVIGVGLAFFFFMGV* |
Ga0075464_107544093 | 3300006805 | Aqueous | MRYREHYTIQPITRKWAEIALAVAIGLGLATLFFLGA* |
Ga0075464_108910243 | 3300006805 | Aqueous | MREHYTIQPVTRKWAEIALAVAIGLGLATLFFIGA* |
Ga0070748_10436144 | 3300006920 | Aqueous | MRYREHYTIQPTVRKWLDVALATAIGVGLALLLVYGV* |
Ga0070748_11140711 | 3300006920 | Aqueous | MRYREHYTIQPVTRKWADIALAVAIGVGLAFFFFMGA* |
Ga0102877_11316212 | 3300007548 | Estuarine | MRYREHYTIQPTIRKWADIALAVAIGLGLATLFFLGV* |
Ga0102828_11384521 | 3300007559 | Estuarine | MRYREHYTIQPVTRKWAEIALAVAIGVGLAFFFFMGV* |
Ga0102859_11485631 | 3300007708 | Estuarine | MRYREHYTIQPAIRKWANIALAVAIGVGLAFFFFMG |
Ga0105747_12676392 | 3300007974 | Estuary Water | MREHYTIQPTTRKWADIALAVAIGLGLATLFFLGV* |
Ga0108970_104415832 | 3300008055 | Estuary | MRYREHYTIQPAARKWADIALALAIGVGLAFFLFMGV* |
Ga0102829_11529842 | 3300009026 | Estuarine | MRYREHYTIQPTTRKWAEIALAVAIGVGLAFFFFMGV* |
Ga0114973_1000219610 | 3300009068 | Freshwater Lake | MRYREHYTIQPVTRKWADIAMAVAIGLGLATLFFLGV* |
Ga0114973_100092695 | 3300009068 | Freshwater Lake | MRYREHYTIQPVTRKWAEIALAVAIGLGLATLFFLGA* |
Ga0114973_100975218 | 3300009068 | Freshwater Lake | MRYREHYTIQPTARKWADIALAVSIGVGLAFFFLMGV* |
Ga0114962_100375076 | 3300009151 | Freshwater Lake | MREHYTIQPVTRKWADIALAVAIGVGLAFFLFMGA* |
Ga0114962_100532223 | 3300009151 | Freshwater Lake | MRYREHYTIQPVYRKWADIALAVAIGLGLATLFFFGV* |
Ga0114962_101670734 | 3300009151 | Freshwater Lake | MRYREHYTIQPIARKWADIALAVAIGVGLAFFFLMGV* |
Ga0114962_105925781 | 3300009151 | Freshwater Lake | MRYREHYTIQPVYRKWADIALAVAIGLGLATLFFLGA* |
Ga0114980_104202433 | 3300009152 | Freshwater Lake | MRYREHYTIQPVTRKWADIALAIAIGIVMAFFLFMGA* |
Ga0114963_104780491 | 3300009154 | Freshwater Lake | MRYREHYTIQPVTRKWAEIVLAMAIGLGLATFFFFG |
Ga0114977_1000398710 | 3300009158 | Freshwater Lake | MRYREHYTIQPVTRKWADIALALAIGVGLAFFFFMGV* |
Ga0114977_100623583 | 3300009158 | Freshwater Lake | MRYSEHYTIQPTIRKWAEIALAVAIGLGLATLFFFGV* |
Ga0114977_101002505 | 3300009158 | Freshwater Lake | MRYREHYTIQPVTRKWAEIALALAIGVGLAFFLFMGV* |
Ga0114981_100484433 | 3300009160 | Freshwater Lake | MRYREHYTIQPAIRKWADIALAIAIGIVMAFFLFMGA* |
Ga0114981_101600572 | 3300009160 | Freshwater Lake | MRYREHYTIQPVIRKWADIALAVAIGLGLATLFFFGV* |
Ga0114970_1000788711 | 3300009163 | Freshwater Lake | MREHYTIQPTIRKWADIALAVAIGLGLATLFFFGV* |
Ga0114970_100306377 | 3300009163 | Freshwater Lake | MRYREHYTIQPTARKWADLALALAIGVGLAFFFFMGV* |
Ga0114970_100438356 | 3300009163 | Freshwater Lake | MRYREHYTIQPTTRKWADIALAVAIGVGLAFFFLMGV* |
Ga0114970_100958793 | 3300009163 | Freshwater Lake | MRYREHYTIQPAIRKWADIALAVLIGIVMAFFLFMGA* |
Ga0114970_105179962 | 3300009163 | Freshwater Lake | MRYREHYTIQPAIRKWADIALAVAIGVGLAFFFFMGV* |
Ga0114975_1000037616 | 3300009164 | Freshwater Lake | MRYREHYTIQPAIRKWADIALAIAIGVGLAFFFLMGV* |
Ga0114975_102790512 | 3300009164 | Freshwater Lake | MRYREHYTIQPVTRKWADLALALAIGVGLAFFFLMGV* |
Ga0114979_101482832 | 3300009180 | Freshwater Lake | VRYREHYTIQPAIRKWADIALAIAIGIVMAFFLFMGA* |
Ga0114979_101555363 | 3300009180 | Freshwater Lake | MRYREHYTIQPTARKWADIALAIAIGIVMAFFLFMGV* |
Ga0114979_102195733 | 3300009180 | Freshwater Lake | MRYREHYTIQPTTRKWADIALAIAIGVGLAFFFLMGA* |
Ga0114974_101176254 | 3300009183 | Freshwater Lake | MRYREHYTIQPVTRKWADLALALAIGIGLAFFFFMGV* |
Ga0114958_104361742 | 3300009684 | Freshwater Lake | MRYREHYTIQPTAQKWLDVALATAISVGLALLLVYGV* |
Ga0114964_100530465 | 3300010157 | Freshwater Lake | MRYREHYTIQPTARKWLDVALAMAIGVGFALLLVYGV* |
Ga0114967_101499032 | 3300010160 | Freshwater Lake | MRYREHYTIQPTARKWADIALATAIGIGLALLLVYGV* |
Ga0136644_101154924 | 3300010334 | Freshwater Lake | MRYREHYTIQPAIRKWADIALAVAIGLGLATLFFFGV* |
Ga0133913_132064771 | 3300010885 | Freshwater Lake | MREHYTIQPTIRKWSEIALAVAIGLGLATLFFLGV* |
Ga0129318_101932922 | 3300011009 | Freshwater To Marine Saline Gradient | MRYREHYTIQPIARKWADLALALAIGVGLAFFFFMGV* |
Ga0151514_1008210 | 3300011115 | Freshwater | MRYREHYTIQPVTRKWADIALAVAIGVGLAFFFFIGV* |
Ga0151514_1008259 | 3300011115 | Freshwater | MRYREHYTIQPVTRKWADIALAVAIGVGLAFFFFMGV* |
Ga0151514_103927 | 3300011115 | Freshwater | MRYREHYTIQPTARKWLDIALATAIGVGLALLLVYKV* |
Ga0153698_166912 | 3300011335 | Freshwater | MRYREHYTIQPIIRKWAEIALAVAIGVGLAILFFMGA* |
Ga0153698_17104 | 3300011335 | Freshwater | MREHYTIQPTTRKWADIALAVAIGVGLAFFFFMGV* |
Ga0164294_108721162 | 3300013006 | Freshwater | MRYREHYTIQPTIRKWADIALAVAIGLGLATLFFLGA* |
Ga0164295_109229012 | 3300013014 | Freshwater | MRYREHYTIQPTIRKWADIALAVAIGLGLATLFFFGV* |
Ga0177922_109573341 | 3300013372 | Freshwater | MRYREHYTIQPVTRKWADIGLAVAIGLGLATLFFLGV* |
Ga0181347_10709994 | 3300017722 | Freshwater Lake | MREHYTIQPVTRKWADIALAVAIGLGLATFFFLGV |
Ga0181365_10501854 | 3300017736 | Freshwater Lake | MRYREHYTIQPVTRKWADIALAVAIGLGLATLFFLGA |
Ga0181357_11953222 | 3300017777 | Freshwater Lake | MREHYTIQPVTRKWADIALAVAIGLGLATLFFLGV |
Ga0181348_12534922 | 3300017784 | Freshwater Lake | MRYREHYTIQPVTRKWADIALAVAIGLGLATLFFLG |
Ga0181355_11015353 | 3300017785 | Freshwater Lake | MREHYTIQPVTRKWADIALAIAIGVGLAFFFFMGV |
Ga0181355_12510382 | 3300017785 | Freshwater Lake | MRYREHYTIQPVYRKWADIALAVTIGIGLAFFFFMGA |
Ga0181553_100829684 | 3300018416 | Salt Marsh | MRYREHYTIQPTSRKWADIALAIAIGVALAFFFFMGV |
Ga0181361_1114501 | 3300019783 | Freshwater Lake | YREHYTIQPTIRKWADIALAVAIGLGLATLFFLGA |
Ga0181359_100023313 | 3300019784 | Freshwater Lake | MRYREHYTIQPTIRKWADIALAVAIGLGLATLFFLGA |
Ga0181359_11092504 | 3300019784 | Freshwater Lake | MREHYTIQPTARKWADIALAITIGIGLAFFFFMGA |
Ga0211732_11848841 | 3300020141 | Freshwater | MRYREHYTIQPVTRKWADIALAVAIGVGLAFFLFMGV |
Ga0211731_109222212 | 3300020205 | Freshwater | MREHYTIQPVIRKWADIALAVAIGVGLAFFFFMGA |
Ga0213922_10024925 | 3300021956 | Freshwater | MRYREHYTIQPATRRWAEIALAVAIGLGLAVLFFFGA |
Ga0222713_1002899510 | 3300021962 | Estuarine Water | MRYREHYTIQPTARKWADIALAVAIGVGLAFFFFMGA |
Ga0222713_101455624 | 3300021962 | Estuarine Water | MRYREHYTIQPVTRKWADIALAVAIGVGLATLFFLGA |
Ga0222712_1000102534 | 3300021963 | Estuarine Water | MRYREHYTIQPVTRKWAEIALALAIGVGLAFFLFMGV |
Ga0222712_1003461713 | 3300021963 | Estuarine Water | MRYREHYTIQPAARKWADIALALAIGVGLAFFLFMGV |
Ga0222712_101301134 | 3300021963 | Estuarine Water | MRYREHYTIQPVTRKWADLALALVIGVGLAFFFFMGV |
Ga0222712_102110105 | 3300021963 | Estuarine Water | MRYREHYTIQPTTRKWADIALAIAIGVGLAFFFLMGV |
Ga0222712_107607561 | 3300021963 | Estuarine Water | MRYREHYTIQPTIRKWADVALAVAIGFGLAILFFFGV |
Ga0181351_10052195 | 3300022407 | Freshwater Lake | MRYREHYTIQPVYRKWADIALAVAIGVGLAFFFFMGA |
Ga0214919_108311561 | 3300023184 | Freshwater | MRYREHYTIQPTARKWADIALAIAIGGGLAFFLFMGV |
Ga0208248_10009956 | 3300025595 | Freshwater | MRYREHYTIQPVTRKWAEIVLAMAIGLGLATLFFFGA |
Ga0208643_10763751 | 3300025645 | Aqueous | MRYREHYTIQPTVRKWLDVALATAIGVGLALLLVYGV |
Ga0208784_10658092 | 3300025732 | Aqueous | MRYREHYTIQPTTLKWADLALALAIGVGLAFFLFMGV |
Ga0208916_100094196 | 3300025896 | Aqueous | MRYREHYTIQPVTRKWADLALALAIGVGLAFFFFMGV |
Ga0208916_100205293 | 3300025896 | Aqueous | MRYREHYTIQPVTRKWADIALAVAIGVGLAFFFFMGA |
Ga0208916_100398561 | 3300025896 | Aqueous | MRYREHYIIQPVTRKWADIALAVAIGLGLATLFFFGV |
Ga0208916_100718771 | 3300025896 | Aqueous | MRYREHYTIQPVTRKWADIALALTIGVGLAFFFFMGV |
Ga0208916_103418274 | 3300025896 | Aqueous | MRYREHYTIQPTARKWADIALAIAIGVGLAFFFFMGV |
Ga0209188_11449343 | 3300027708 | Freshwater Lake | MRYREHYTIQPVYRKWADIALAVAIGLGLATLFFFGV |
Ga0209297_100129217 | 3300027733 | Freshwater Lake | MRYREHYTIQPVTRKWADIALALAIGVGLAFFFFMGV |
Ga0209297_11006514 | 3300027733 | Freshwater Lake | MRYSEHYTIQPTIRKWAEIALAVAIGLGLATLFFFGV |
Ga0209087_100854613 | 3300027734 | Freshwater Lake | MRYREHYTIQPAIRKWADIALAIAIGVGLAFFFLMGV |
Ga0209190_100029624 | 3300027736 | Freshwater Lake | MRYREHYTIQPVTRKWADIAMAVAIGLGLATLFFLGV |
Ga0209190_100099915 | 3300027736 | Freshwater Lake | MRYREHYTIQPTARKWADIALAVSIGVGLAFFFLMGV |
Ga0209190_100541311 | 3300027736 | Freshwater Lake | MRYREHYTIQPVTRKWAEIALAVAIGLGLATLFFLGA |
Ga0209190_10106206 | 3300027736 | Freshwater Lake | MRYREHYTIQPAIRKWADIALAVLIGIVMAFFLFMGA |
Ga0209190_10470262 | 3300027736 | Freshwater Lake | MREHYTIQPTIRKWADIALAVAIGLGLATLFFFGV |
Ga0209190_10547865 | 3300027736 | Freshwater Lake | MRYREHYTIQPTVRKWLDVALATAIGVGLALLLFYGV |
Ga0209190_10853664 | 3300027736 | Freshwater Lake | MRYREHYTIQPTARKWADLALALAIGVGLAFFFFMGV |
Ga0209084_10775652 | 3300027749 | Freshwater Lake | MREHYTIQPVTRKWADIALAVAIGVGLAFFLFMGA |
Ga0209084_13143842 | 3300027749 | Freshwater Lake | MRYREHYTIQPIARKWADIALAVAIGVGLAFFFLMGV |
Ga0209296_10003897 | 3300027759 | Freshwater Lake | MRYREHYTIQPTAQKWLDVALATAIGVSFALLLVYGV |
Ga0209296_10016147 | 3300027759 | Freshwater Lake | MRYREHYTIQPVTRKWADLALALAIGIGLAFFFFMGV |
Ga0209296_13549482 | 3300027759 | Freshwater Lake | VRYREHYTIQPAIRKWADIALAIAIGIVMAFFLFMGA |
Ga0209088_100168188 | 3300027763 | Freshwater Lake | MRYREHYTIQPAIRKWADIALAIAIGIVMAFFLFMGA |
Ga0209088_102887513 | 3300027763 | Freshwater Lake | MRYREHYTIQPTARKWADIALAIAIGIVMAFFLFMGV |
Ga0209134_102606952 | 3300027764 | Freshwater Lake | MRYREHYTIQPVTRKWADIALAVAIGLGLATLFFLGV |
Ga0209298_100622585 | 3300027973 | Freshwater Lake | MRYREHYTIQPVTRKWADIALAIAIGIVMAFFLFMGA |
Ga0265593_10247215 | 3300028178 | Saline Water | MRYREHYTIQPVIRKWADIALAVVIGVGLAFFFFMGV |
Ga0304730_11468011 | 3300028394 | Freshwater Lake | MRYREHYTIQPTARKWADIALATAIGIGLALLLVYGV |
Ga0315291_104639035 | 3300031707 | Sediment | MRYREHYTIQPTARKWADIVLAVAIGVGLAFFFFMGV |
Ga0315291_108228021 | 3300031707 | Sediment | VRYREHYTIQPTARKWADIALAVAIGVGLAFFFFMGV |
Ga0315293_107788802 | 3300031746 | Sediment | MRYREHYTIQKTIRKWADIALAVAIGVGLAFFFFMGV |
Ga0315288_105564774 | 3300031772 | Sediment | MRYREHYTIQPVYRKWAEIALAVAIGLGLATLFFFGV |
Ga0315290_113513662 | 3300031834 | Sediment | MRYREHYTIQPAIRKWADIALAVAIGVGLAFFFFMGV |
Ga0315290_116343542 | 3300031834 | Sediment | MRYREHYTIQPVIRKWADIALAIAIGVGLAFFFFMGA |
Ga0315274_105158643 | 3300031999 | Sediment | VRYREHYTIQPTARKWADIALAVAIGVGLAFFFFMGA |
Ga0315274_109221614 | 3300031999 | Sediment | MRYREHYTIQPTARKWADIALAVAIGVGLAFFFFMGV |
Ga0315289_100653891 | 3300032046 | Sediment | MRYREHYTIQPVIRKWADIALAVAIGVGLAFFFFMGA |
Ga0315284_112006431 | 3300032053 | Sediment | MRYREHYTIQKTIRKWADIALAVAIGVGLAVLFFIGV |
Ga0315284_113684712 | 3300032053 | Sediment | MRYREHYTIQPIARKWADIALAVAIGVGLAFFFFMGV |
Ga0315905_107431233 | 3300032092 | Freshwater | MRYREHYTIQPVTRKWADIGLAVAIGLGLATLFFLGV |
Ga0315268_102593422 | 3300032173 | Sediment | MRYREHYTIQPAIRKWADLALAVAIGVGLAFLFFMGA |
Ga0315268_109127853 | 3300032173 | Sediment | MRYREHYTIQPVTRKWAEIALAVAIGLGLATLFFLG |
Ga0315268_120027102 | 3300032173 | Sediment | MREHYTIQPVYRKWADIALAIAIGVGLAFFFFMGV |
Ga0315276_121785573 | 3300032177 | Sediment | YGPIFRRSIMRYREHYTIQKTIRKWADIALAVAIGVGLAFFFFMGV |
Ga0315270_104314343 | 3300032275 | Sediment | MRYREHYTIQPVTRKWAEIALAVAIGLGLATLFFLGV |
Ga0315287_114436913 | 3300032397 | Sediment | MRDREHYTIQKTIRKWADIALAVAIGVGLAFFFFMGA |
Ga0315273_114693382 | 3300032516 | Sediment | MRYREHYTIQKTIRKWADIALAVAIGVGLAFFFFMGA |
Ga0334722_108688932 | 3300033233 | Sediment | MRYREHYTIQKTIRKWADIVLAVAIGVGLAFFFFMGA |
⦗Top⦘ |