| Basic Information | |
|---|---|
| Family ID | F061629 |
| Family Type | Metagenome |
| Number of Sequences | 131 |
| Average Sequence Length | 52 residues |
| Representative Sequence | PHVYRYYFERAPTVSSGGAAVSYALEEWCDAGDPVEKQSIVPPKQIIK |
| Number of Associated Samples | 108 |
| Number of Associated Scaffolds | 131 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 2.31 % |
| % of genes near scaffold ends (potentially truncated) | 95.42 % |
| % of genes from short scaffolds (< 2000 bps) | 93.13 % |
| Associated GOLD sequencing projects | 103 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.23 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (97.710 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil (13.741 % of family members) |
| Environment Ontology (ENVO) | Unclassified (26.718 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (56.489 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 23.68% Coil/Unstructured: 76.32% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.23 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 131 Family Scaffolds |
|---|---|---|
| PF00486 | Trans_reg_C | 3.82 |
| PF07690 | MFS_1 | 2.29 |
| PF01261 | AP_endonuc_2 | 1.53 |
| PF03162 | Y_phosphatase2 | 0.76 |
| PF12006 | DUF3500 | 0.76 |
| PF12697 | Abhydrolase_6 | 0.76 |
| PF07676 | PD40 | 0.76 |
| PF00216 | Bac_DNA_binding | 0.76 |
| PF14031 | D-ser_dehydrat | 0.76 |
| COG ID | Name | Functional Category | % Frequency in 131 Family Scaffolds |
|---|---|---|---|
| COG0776 | Bacterial nucleoid DNA-binding protein IHF-alpha | Replication, recombination and repair [L] | 0.76 |
| COG2365 | Protein tyrosine/serine phosphatase Oca4 | Signal transduction mechanisms [T] | 0.76 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 97.71 % |
| Unclassified | root | N/A | 2.29 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2189573001|GZR05M101D9EZY | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 504 | Open in IMG/M |
| 2228664022|INPgaii200_c0908431 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 844 | Open in IMG/M |
| 3300000891|JGI10214J12806_11084390 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 1733 | Open in IMG/M |
| 3300000891|JGI10214J12806_11420657 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Vicinamibacteria → Vicinamibacterales → Vicinamibacteraceae → Luteitalea → unclassified Luteitalea → Luteitalea sp. | 518 | Open in IMG/M |
| 3300001991|JGI24743J22301_10043632 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 904 | Open in IMG/M |
| 3300004114|Ga0062593_102262899 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium | 610 | Open in IMG/M |
| 3300004153|Ga0063455_100033133 | All Organisms → cellular organisms → Bacteria | 1580 | Open in IMG/M |
| 3300004157|Ga0062590_100652020 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 937 | Open in IMG/M |
| 3300004479|Ga0062595_100119703 | All Organisms → cellular organisms → Bacteria | 1453 | Open in IMG/M |
| 3300004480|Ga0062592_101854061 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 591 | Open in IMG/M |
| 3300004643|Ga0062591_101339303 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium | 706 | Open in IMG/M |
| 3300004643|Ga0062591_101980529 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium | 600 | Open in IMG/M |
| 3300005093|Ga0062594_100894746 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 837 | Open in IMG/M |
| 3300005293|Ga0065715_10327345 | All Organisms → cellular organisms → Bacteria | 990 | Open in IMG/M |
| 3300005294|Ga0065705_10525425 | All Organisms → cellular organisms → Bacteria | 758 | Open in IMG/M |
| 3300005294|Ga0065705_11126756 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium | 517 | Open in IMG/M |
| 3300005295|Ga0065707_10594582 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium | 694 | Open in IMG/M |
| 3300005332|Ga0066388_104605113 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium | 702 | Open in IMG/M |
| 3300005333|Ga0070677_10418436 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium | 710 | Open in IMG/M |
| 3300005334|Ga0068869_100319253 | All Organisms → cellular organisms → Bacteria | 1259 | Open in IMG/M |
| 3300005340|Ga0070689_100092147 | All Organisms → cellular organisms → Bacteria | 2390 | Open in IMG/M |
| 3300005340|Ga0070689_101353441 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 642 | Open in IMG/M |
| 3300005347|Ga0070668_101770309 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Vicinamibacteria → Vicinamibacterales → Vicinamibacteraceae → Luteitalea → unclassified Luteitalea → Luteitalea sp. | 568 | Open in IMG/M |
| 3300005355|Ga0070671_100045960 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3630 | Open in IMG/M |
| 3300005438|Ga0070701_10456508 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 821 | Open in IMG/M |
| 3300005441|Ga0070700_102013731 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium | 501 | Open in IMG/M |
| 3300005457|Ga0070662_101416007 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium | 599 | Open in IMG/M |
| 3300005467|Ga0070706_101396569 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium | 641 | Open in IMG/M |
| 3300005547|Ga0070693_100108034 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 1706 | Open in IMG/M |
| 3300005549|Ga0070704_101425228 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 636 | Open in IMG/M |
| 3300005564|Ga0070664_101283795 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium | 691 | Open in IMG/M |
| 3300005577|Ga0068857_102363092 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium | 522 | Open in IMG/M |
| 3300005616|Ga0068852_101275840 | All Organisms → cellular organisms → Bacteria | 756 | Open in IMG/M |
| 3300005718|Ga0068866_11021217 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium | 588 | Open in IMG/M |
| 3300005764|Ga0066903_103595144 | All Organisms → cellular organisms → Bacteria | 835 | Open in IMG/M |
| 3300005843|Ga0068860_102415045 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium | 546 | Open in IMG/M |
| 3300005937|Ga0081455_11033606 | Not Available | 508 | Open in IMG/M |
| 3300005985|Ga0081539_10462287 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium | 525 | Open in IMG/M |
| 3300006845|Ga0075421_100003758 | All Organisms → cellular organisms → Bacteria | 18233 | Open in IMG/M |
| 3300006845|Ga0075421_101409184 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium | 766 | Open in IMG/M |
| 3300006853|Ga0075420_100023882 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 5478 | Open in IMG/M |
| 3300006854|Ga0075425_102603371 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium | 559 | Open in IMG/M |
| 3300006871|Ga0075434_100127868 | All Organisms → cellular organisms → Bacteria | 2558 | Open in IMG/M |
| 3300006881|Ga0068865_100305423 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1275 | Open in IMG/M |
| 3300006881|Ga0068865_102137654 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium | 509 | Open in IMG/M |
| 3300006903|Ga0075426_10836847 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 693 | Open in IMG/M |
| 3300009094|Ga0111539_12242207 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium | 634 | Open in IMG/M |
| 3300009094|Ga0111539_12382980 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium | 614 | Open in IMG/M |
| 3300009156|Ga0111538_11486055 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium | 854 | Open in IMG/M |
| 3300009162|Ga0075423_13073937 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium | 511 | Open in IMG/M |
| 3300009177|Ga0105248_11444949 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium | 778 | Open in IMG/M |
| 3300010359|Ga0126376_11454618 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium | 712 | Open in IMG/M |
| 3300010362|Ga0126377_10029339 | All Organisms → cellular organisms → Bacteria | 4634 | Open in IMG/M |
| 3300010362|Ga0126377_13567593 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium | 503 | Open in IMG/M |
| 3300010371|Ga0134125_11523269 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 728 | Open in IMG/M |
| 3300010397|Ga0134124_11564407 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 689 | Open in IMG/M |
| 3300010399|Ga0134127_11228420 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium | 817 | Open in IMG/M |
| 3300010403|Ga0134123_12514965 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium | 581 | Open in IMG/M |
| 3300011119|Ga0105246_10061535 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2613 | Open in IMG/M |
| 3300012212|Ga0150985_100492328 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1032 | Open in IMG/M |
| 3300012212|Ga0150985_116542115 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 806 | Open in IMG/M |
| 3300012469|Ga0150984_102268951 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 842 | Open in IMG/M |
| 3300012469|Ga0150984_103513240 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1003 | Open in IMG/M |
| 3300012469|Ga0150984_111721318 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 894 | Open in IMG/M |
| 3300012469|Ga0150984_117555858 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 858 | Open in IMG/M |
| 3300012469|Ga0150984_119352917 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1128 | Open in IMG/M |
| 3300012893|Ga0157284_10276569 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Vicinamibacteria → Vicinamibacterales → Vicinamibacteraceae → Luteitalea → unclassified Luteitalea → Luteitalea sp. | 540 | Open in IMG/M |
| 3300012898|Ga0157293_10069074 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 837 | Open in IMG/M |
| 3300012948|Ga0126375_11509258 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium | 575 | Open in IMG/M |
| 3300012951|Ga0164300_10251680 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 897 | Open in IMG/M |
| 3300012955|Ga0164298_10744379 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium | 694 | Open in IMG/M |
| 3300012985|Ga0164308_10387358 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1139 | Open in IMG/M |
| 3300012985|Ga0164308_11663561 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium | 591 | Open in IMG/M |
| 3300012989|Ga0164305_11793572 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium | 554 | Open in IMG/M |
| 3300013297|Ga0157378_11505623 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 717 | Open in IMG/M |
| 3300014326|Ga0157380_10876852 | All Organisms → cellular organisms → Bacteria | 921 | Open in IMG/M |
| 3300014745|Ga0157377_11207651 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium | 586 | Open in IMG/M |
| 3300015200|Ga0173480_10350711 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 841 | Open in IMG/M |
| 3300015372|Ga0132256_100388806 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1495 | Open in IMG/M |
| 3300015372|Ga0132256_101192332 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 875 | Open in IMG/M |
| 3300015372|Ga0132256_103673080 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 516 | Open in IMG/M |
| 3300015373|Ga0132257_100456494 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1561 | Open in IMG/M |
| 3300015374|Ga0132255_104047505 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium | 622 | Open in IMG/M |
| 3300015374|Ga0132255_104359504 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 600 | Open in IMG/M |
| 3300019362|Ga0173479_10328911 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 709 | Open in IMG/M |
| 3300022889|Ga0247785_1042940 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium | 557 | Open in IMG/M |
| 3300023102|Ga0247754_1183336 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium | 526 | Open in IMG/M |
| 3300023261|Ga0247796_1035499 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 827 | Open in IMG/M |
| 3300025899|Ga0207642_10638802 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium | 666 | Open in IMG/M |
| 3300025901|Ga0207688_10250869 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1072 | Open in IMG/M |
| 3300025901|Ga0207688_11031132 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium | 520 | Open in IMG/M |
| 3300025908|Ga0207643_10895799 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium | 575 | Open in IMG/M |
| 3300025930|Ga0207701_10987502 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium | 702 | Open in IMG/M |
| 3300025932|Ga0207690_10917157 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium | 727 | Open in IMG/M |
| 3300025936|Ga0207670_10923696 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 732 | Open in IMG/M |
| 3300025936|Ga0207670_11037157 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 691 | Open in IMG/M |
| 3300025937|Ga0207669_10845200 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium | 762 | Open in IMG/M |
| 3300025938|Ga0207704_10663987 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 860 | Open in IMG/M |
| 3300025940|Ga0207691_10086573 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2811 | Open in IMG/M |
| 3300025981|Ga0207640_11191711 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium | 677 | Open in IMG/M |
| 3300026023|Ga0207677_11284445 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium | 672 | Open in IMG/M |
| 3300026067|Ga0207678_11599565 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium | 574 | Open in IMG/M |
| 3300026075|Ga0207708_10237978 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1463 | Open in IMG/M |
| 3300026075|Ga0207708_11359826 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 623 | Open in IMG/M |
| 3300026088|Ga0207641_10470795 | All Organisms → cellular organisms → Bacteria | 1217 | Open in IMG/M |
| 3300026089|Ga0207648_10448587 | Not Available | 1174 | Open in IMG/M |
| 3300027857|Ga0209166_10671225 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 523 | Open in IMG/M |
| 3300028381|Ga0268264_12548098 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium | 516 | Open in IMG/M |
| 3300028592|Ga0247822_11419396 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium | 585 | Open in IMG/M |
| 3300028597|Ga0247820_10832976 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium | 650 | Open in IMG/M |
| 3300028799|Ga0307284_10049831 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1468 | Open in IMG/M |
| 3300028889|Ga0247827_11242871 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Vicinamibacteria → Vicinamibacterales → Vicinamibacteraceae → Luteitalea → unclassified Luteitalea → Luteitalea sp. | 518 | Open in IMG/M |
| 3300031538|Ga0310888_10410631 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium | 796 | Open in IMG/M |
| 3300031547|Ga0310887_10225941 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1032 | Open in IMG/M |
| 3300031547|Ga0310887_10520406 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium | 719 | Open in IMG/M |
| 3300031562|Ga0310886_10069002 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1668 | Open in IMG/M |
| 3300031562|Ga0310886_10526318 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium | 717 | Open in IMG/M |
| 3300031854|Ga0310904_10228550 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1139 | Open in IMG/M |
| 3300031892|Ga0310893_10119604 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 990 | Open in IMG/M |
| 3300031901|Ga0307406_10400466 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1088 | Open in IMG/M |
| 3300031908|Ga0310900_10085867 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1975 | Open in IMG/M |
| 3300031943|Ga0310885_10109465 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1267 | Open in IMG/M |
| 3300032000|Ga0310903_10279230 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium | 814 | Open in IMG/M |
| 3300032017|Ga0310899_10244873 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium | 812 | Open in IMG/M |
| 3300032075|Ga0310890_11706404 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium | 522 | Open in IMG/M |
| 3300032122|Ga0310895_10135175 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1048 | Open in IMG/M |
| 3300032421|Ga0310812_10353456 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 658 | Open in IMG/M |
| 3300033550|Ga0247829_10964464 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium | 709 | Open in IMG/M |
| 3300033551|Ga0247830_11419325 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium | 555 | Open in IMG/M |
| 3300034150|Ga0364933_192114 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium | 535 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 13.74% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 8.40% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 7.63% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 6.87% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 5.34% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 5.34% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 3.82% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 3.05% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 3.05% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 3.05% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 3.05% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 2.29% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 2.29% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 2.29% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 2.29% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 2.29% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 2.29% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 2.29% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 2.29% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 2.29% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 2.29% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.53% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 1.53% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.53% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.53% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grass Soil | 0.76% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.76% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere | 0.76% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.76% |
| Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 0.76% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.76% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.76% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.76% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.76% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.76% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2189573001 | Grass soil microbial communities from Rothamsted Park, UK - FD2 (NaCl 300g/L 5ml) | Environmental | Open in IMG/M |
| 2228664022 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000891 | Soil microbial communities from Great Prairies - Wisconsin, Continuous corn soil | Environmental | Open in IMG/M |
| 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Host-Associated | Open in IMG/M |
| 3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
| 3300004153 | Grasslands soil microbial communities from Hopland, California, USA (version 2) | Environmental | Open in IMG/M |
| 3300004157 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2 | Environmental | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300004480 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4 | Environmental | Open in IMG/M |
| 3300004643 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3 | Environmental | Open in IMG/M |
| 3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
| 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 | Host-Associated | Open in IMG/M |
| 3300005294 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk Soil | Environmental | Open in IMG/M |
| 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Host-Associated | Open in IMG/M |
| 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Host-Associated | Open in IMG/M |
| 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Environmental | Open in IMG/M |
| 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Environmental | Open in IMG/M |
| 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Environmental | Open in IMG/M |
| 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Environmental | Open in IMG/M |
| 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Environmental | Open in IMG/M |
| 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Host-Associated | Open in IMG/M |
| 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Host-Associated | Open in IMG/M |
| 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
| 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Host-Associated | Open in IMG/M |
| 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Host-Associated | Open in IMG/M |
| 3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
| 3300006853 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4 | Host-Associated | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Host-Associated | Open in IMG/M |
| 3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
| 3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
| 3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
| 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Host-Associated | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
| 3300012893 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S059-202B-1 | Environmental | Open in IMG/M |
| 3300012898 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S194-509B-1 | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012951 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MG | Environmental | Open in IMG/M |
| 3300012955 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MG | Environmental | Open in IMG/M |
| 3300012985 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MG | Environmental | Open in IMG/M |
| 3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Host-Associated | Open in IMG/M |
| 3300015200 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S209-509C-1 (version 2) | Environmental | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300019362 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S104-311B-1 (version 2) | Environmental | Open in IMG/M |
| 3300022889 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S096-311B-4 | Environmental | Open in IMG/M |
| 3300023102 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S184-509B-5 | Environmental | Open in IMG/M |
| 3300023261 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S166-409R-6 | Environmental | Open in IMG/M |
| 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025930 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) | Environmental | Open in IMG/M |
| 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027857 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028592 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Cellulose_Day30 | Environmental | Open in IMG/M |
| 3300028597 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Glucose_Day14 | Environmental | Open in IMG/M |
| 3300028799 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_123 | Environmental | Open in IMG/M |
| 3300028889 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day2 | Environmental | Open in IMG/M |
| 3300031538 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D1 | Environmental | Open in IMG/M |
| 3300031547 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D4 | Environmental | Open in IMG/M |
| 3300031562 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D3 | Environmental | Open in IMG/M |
| 3300031854 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D1 | Environmental | Open in IMG/M |
| 3300031892 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D2 | Environmental | Open in IMG/M |
| 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Host-Associated | Open in IMG/M |
| 3300031908 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D1 | Environmental | Open in IMG/M |
| 3300031943 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D2 | Environmental | Open in IMG/M |
| 3300032000 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D3 | Environmental | Open in IMG/M |
| 3300032017 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D4 | Environmental | Open in IMG/M |
| 3300032075 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D3 | Environmental | Open in IMG/M |
| 3300032122 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D4 | Environmental | Open in IMG/M |
| 3300032421 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NN3 | Environmental | Open in IMG/M |
| 3300033550 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day4 | Environmental | Open in IMG/M |
| 3300033551 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day5 | Environmental | Open in IMG/M |
| 3300034150 | Sediment microbial communities from East River floodplain, Colorado, United States - 25_j17 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| FD2_07058570 | 2189573001 | Grass Soil | YEQPHTYRYIFDRSPGDPPYALEEWCDASDPIEKQSIVPPKQIIK |
| INPgaii200_09084313 | 2228664022 | Soil | FERAPAVKSNGALVSYALEEWCDAGDPIEKQSIVPPKQTIKK |
| JGI10214J12806_110843901 | 3300000891 | Soil | TWDDPAIYEQPHTYRYLFDRAPGNPPYALEEWCDASDPIEKQSIVPPKQIIK* |
| JGI10214J12806_114206572 | 3300000891 | Soil | TGNYTWEAPAIYEQPHTYRYIFDRAPGDPPYALEEWCDASDPIEKQSIVPPKQIKG* |
| JGI24743J22301_100436323 | 3300001991 | Corn, Switchgrass And Miscanthus Rhizosphere | RAPTVNSGGKPVSYALEEWCDAGDPVEKQSIVPPKQIIK* |
| Ga0062593_1022628991 | 3300004114 | Soil | PKVYQKPHVYRYYFERAPTVESKGTKVSYALEEWCDAGDPIEKQSIIPPKQIIK* |
| Ga0063455_1000331334 | 3300004153 | Soil | PTIYEAPHVYRYYFERAPTVSSGGSAISYALEEWCDAGDPVEKQSIVPPKQIIKKK* |
| Ga0062590_1006520201 | 3300004157 | Soil | IYQAPHVYRYQFERAPTVSSGGAPVSYALEEWCDAGDPVEKQSIVPPKQIIK* |
| Ga0062595_1001197031 | 3300004479 | Soil | YTWDDPAIYEQPHTYRYIFDRAPGDPAYALEEWCDASDPIEKQSIVPPKQIIKRRP* |
| Ga0062592_1018540612 | 3300004480 | Soil | TYRYIFDRSPGNPPYALEEWCDASDPIEKQSIVPPKQIIK* |
| Ga0062591_1013393032 | 3300004643 | Soil | VYRYYFERAPSMNSGGKPVSYALEEWCDAGDPVEKQSIIPPKQTIKK* |
| Ga0062591_1019805292 | 3300004643 | Soil | YQKPHQYRYYFERAPTVSSGGSPVSYALEEWCDAGDPVEKQSIVPPKQIIK* |
| Ga0062594_1008947463 | 3300005093 | Soil | QRLTITYTWNDPKIYQAPHVYRYQFERAPTVSSGGAPVSYALEEWCDAGDPVEKQSIVPPKQIIK* |
| Ga0065715_103273453 | 3300005293 | Miscanthus Rhizosphere | YRYYFDRAPAVESRGTRISYALEEWCDAGDPIEKQSIVPPKQIIK* |
| Ga0065705_105254251 | 3300005294 | Switchgrass Rhizosphere | YYFERAPSMNSGGKPVSYALEEWCDAGDPVEKQSIIPPKQTIKK* |
| Ga0065705_111267562 | 3300005294 | Switchgrass Rhizosphere | HVYRYYFDRSPTLDSGGTPVSYALEEWCDAGDPIEKQSIVPPKQIIK* |
| Ga0065707_105945821 | 3300005295 | Switchgrass Rhizosphere | RLTVTYTWDDPKVYQKPHVYRYYFERAPAIESRGTKVSYALEEWCDAGDPIEKQSIVPPKQIIK* |
| Ga0066388_1046051132 | 3300005332 | Tropical Forest Soil | YRYYFDRAPTMNSGGTPVSYALEEWCDAGDPIEKQSIIPPKQIIK* |
| Ga0070677_104184361 | 3300005333 | Miscanthus Rhizosphere | TITYTWNDPKIYQAPHVYRYQFERAPTVSSGGAPVSYALEEWCDAGDPVEKQSIVPPKQIIK* |
| Ga0068869_1003192533 | 3300005334 | Miscanthus Rhizosphere | KKLTITYTWEDSKIYQQPHTYSYVFDRVPNAYAFEDWCDASDPIEKQSIVPPPQR* |
| Ga0070689_1000921475 | 3300005340 | Switchgrass Rhizosphere | QPHTYRYIFDRAPGDPAYALEEWCDASDPIEKQSIVPPKQIKGGGN* |
| Ga0070689_1013534411 | 3300005340 | Switchgrass Rhizosphere | DGKTMTLTYTWNDPVIYEQPHTYRYIFDRSPGDPPYALEEWCDASDPIEKQSIVPPKQIIK* |
| Ga0070668_1017703092 | 3300005347 | Switchgrass Rhizosphere | DGKTMTVNYTWEDPAIYEQPHTYRYIFDRAPGDPPYALEEWCDASDPIEKQSIVPPKQIKG* |
| Ga0070671_1000459601 | 3300005355 | Switchgrass Rhizosphere | LTVTYTWNDPKVYQKPHEYRYYFERAPTVNSGGKPVSYALEEWCDAGDPVEKQSIVPPKQIIK* |
| Ga0070701_104565081 | 3300005438 | Corn, Switchgrass And Miscanthus Rhizosphere | LTITYTWNDPKIYQAPHVYRYQFERAPTVSSGGAPVSYALEEWCDAGDPVEKQSIVPPKQIIK* |
| Ga0070700_1020137311 | 3300005441 | Corn, Switchgrass And Miscanthus Rhizosphere | QKPHVYRYYFDRAPMVESRGTKVSYALEEWCDAGDPVEKQSIIPPKQIIK* |
| Ga0070662_1014160071 | 3300005457 | Corn Rhizosphere | TVTYTWNDPKIYAAPHVYRYYFERAPTVSSGGAPVSYALEEWCDAGDPVEKQSIVPPKQIIK* |
| Ga0070706_1013965691 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | HVYRYYFERAPTVSSGGAAVSYALEEWCDAGDPVEKQSIVPPKQIIK* |
| Ga0070693_1001080344 | 3300005547 | Corn, Switchgrass And Miscanthus Rhizosphere | TYRYLFDRAPGNPPYALEEWCDASDPIEKQSIVPPKQIIK* |
| Ga0070704_1014252282 | 3300005549 | Corn, Switchgrass And Miscanthus Rhizosphere | MTITYTWDDPAIYEQPHTYRYLFDRAPGNPPYALEEWCDASDPIEKQSIVPPKQIIK* |
| Ga0070664_1012837953 | 3300005564 | Corn Rhizosphere | AVKSNGALVSYALEEWCDAGDPIEKQSIVPPKQTIKK* |
| Ga0068857_1023630922 | 3300005577 | Corn Rhizosphere | KPHVYRLYFERAPAVKSNGALVSYALEEWCDAGDPIEKQSIVPPKQTIKK* |
| Ga0068852_1012758403 | 3300005616 | Corn Rhizosphere | YYFERAPTVNSGGKPVSYALEEWCDAGDPVEKQSIVPPKQIIK* |
| Ga0068866_110212171 | 3300005718 | Miscanthus Rhizosphere | YRLYFERAPAVKSNGALVSYALEEWCDAGDPIEKQSIVPPKQTIKK* |
| Ga0066903_1035951443 | 3300005764 | Tropical Forest Soil | YQKPHVYKYFFDRAPTIDVAGKAVSYALEEWCDAGDPIEKQSIIPPKQIDIK* |
| Ga0068860_1024150451 | 3300005843 | Switchgrass Rhizosphere | RFTIVYTWDDPKIYQKPHVYRLYFERAPSVTSNGAPVSYALEEWCDAGDPIEKQSIVPPKQTIKK* |
| Ga0081455_110336061 | 3300005937 | Tabebuia Heterophylla Rhizosphere | ALSQETSPDGKTMTVTYTWDDAALYEQPHTYRYFFDRAPGNPPYAMEEWCDASDPVEKQSIVPPKQIIK* |
| Ga0081539_104622872 | 3300005985 | Tabebuia Heterophylla Rhizosphere | DPKIYQKPHVYRLYFERAPAVSSKGVPVSYALEEWCDAGDPIEKQSIVPPKQTIRK* |
| Ga0075421_10000375820 | 3300006845 | Populus Rhizosphere | YRYYFDRSPMLDSAGTPVSYALEEWCDAGDPIEKQSIVPPKQIIK* |
| Ga0075421_1014091843 | 3300006845 | Populus Rhizosphere | KLYQKPHVYRYYFDRSPMLESAGTRVSYALEEWCDAGDPIEKQSIVPPKQTIK* |
| Ga0075420_1000238829 | 3300006853 | Populus Rhizosphere | YTWDDPKVYQKPHVYRYYFDRSPMLDSAGTPVSYALEEWCDAGDPIEKQSIVPPKQIIK* |
| Ga0075425_1026033712 | 3300006854 | Populus Rhizosphere | PHVYRYYFERAPTVSSGGAAVSYALEEWCDAGDPVEKQSIVPPKQIIK* |
| Ga0075434_1001278681 | 3300006871 | Populus Rhizosphere | SPATRLIERFQVAPDGRTMTLTYTWDDPAIYEQPHTYRYIFDRAPGDPAYALEEWCDASDPIEKQSIVPPKQIKGGGN* |
| Ga0068865_1003054234 | 3300006881 | Miscanthus Rhizosphere | FERAPAVKSNGALVSYALEEWCDAGDPIEKQSIVPPKQTIKK* |
| Ga0068865_1021376541 | 3300006881 | Miscanthus Rhizosphere | TYTWNDPKIYQAPHVYRYQFERAPTVSSGGAPVSYALEEWCDAGDPVEKQSIVPPKQIIK |
| Ga0075426_108368471 | 3300006903 | Populus Rhizosphere | TSNGALVSYALEEWCDAGDPIEKQSIVPPKQTIRK* |
| Ga0111539_122422072 | 3300009094 | Populus Rhizosphere | PTVTSGGLPVSYALEEWCDAGDPVEKQSIVPPKQIIK* |
| Ga0111539_123829802 | 3300009094 | Populus Rhizosphere | IYQKPHVYRYYFERAPTVSSHGAEVSYALEEWCDAGDPIEKQSIVPPKQIIK* |
| Ga0111538_114860551 | 3300009156 | Populus Rhizosphere | VYQKPHVYRYYFERAPTVESKGTKVSYALEEWCDAGDPIEKQSIIPPKQIIK* |
| Ga0075423_130739372 | 3300009162 | Populus Rhizosphere | YFERSPAVKSNGALVSYALEEWCDAGDPIEKQSIVPPKQTIKK* |
| Ga0105248_114449491 | 3300009177 | Switchgrass Rhizosphere | TWEDPKIYQKPHAYRLYFERAPAVKSNGALVSYALEEWCDAGDPIEKQSIVPPKQTIKK* |
| Ga0126376_114546182 | 3300010359 | Tropical Forest Soil | VYRLYFERAPAVSSKGALVSYALEEWCDAGDPIEKQSIVPPKQTIKK* |
| Ga0126377_100293391 | 3300010362 | Tropical Forest Soil | IYEQPHTYRYLFDRAPGNPPYALEEWCDASDPIEKQSIVPPKQIIK* |
| Ga0126377_135675931 | 3300010362 | Tropical Forest Soil | APAVKSNGALVSYALEEWCDAGDPIEKQSIVPPKQTIKK* |
| Ga0134125_115232691 | 3300010371 | Terrestrial Soil | PKIYQAPHVYRYQFERAPTVSSGGAPVSYALEEWCDAGDPVEKQSIVPPKQIIK* |
| Ga0134124_115644071 | 3300010397 | Terrestrial Soil | MTLTYTWDDPALYEQPHTYHYIFDRAPGNPPYAMEEWCDASDPIEKQSIVPPKQIVK* |
| Ga0134127_112284203 | 3300010399 | Terrestrial Soil | YRYYFERAPTVSAGGSPVSYALEEWCDAGDPVEKQSIVPPKQIIK* |
| Ga0134123_125149652 | 3300010403 | Terrestrial Soil | YRYYCERAPTVSSAGAPVSYALEEWCDAGDPVEKQSIVPPKQIIK* |
| Ga0105246_100615351 | 3300011119 | Miscanthus Rhizosphere | TQLVERFQVAPDGQTMTVTYTWDDPAIYEQPHTYRYLFDRAPGNPPYALEEWCDASDPIEKQSIVPPKQIIK* |
| Ga0150985_1004923283 | 3300012212 | Avena Fatua Rhizosphere | VDSGGAPVSYALEEWCDAGDPIEKQSIVPPKQIIK* |
| Ga0150985_1105432481 | 3300012212 | Avena Fatua Rhizosphere | KPHSYHYVFDRAPGDPAYALEEWCDASDPIEKQSIVPPKQIKGGGK* |
| Ga0150985_1165421153 | 3300012212 | Avena Fatua Rhizosphere | VNSGGKPVSYALEEWCDAGDPIEKQSIVPPKQIIK* |
| Ga0150984_1022689511 | 3300012469 | Avena Fatua Rhizosphere | KIYQKPHVYQYFFDRAPTVDVAGKSISYALEEWCDAGDPIEKQSIVPPKQVEIK* |
| Ga0150984_1035132401 | 3300012469 | Avena Fatua Rhizosphere | GQRLTVTYTWNDPKVYQKPHEYRYYFERAPTVNSGGQPVSYALEEWCDAGDPVEKQSIVPPKQIIK* |
| Ga0150984_1117213183 | 3300012469 | Avena Fatua Rhizosphere | HVYSYYFERAPTVSSGGSPVSYALEEWCDSGDPVEKQSIVPPKQIIK* |
| Ga0150984_1175558583 | 3300012469 | Avena Fatua Rhizosphere | TYTWNDPKIYEAPHVYRYYFERAPTVSSGGSAISYALEEWCDAGDPVEKQSIVPPKQIIK |
| Ga0150984_1193529174 | 3300012469 | Avena Fatua Rhizosphere | IYQKPHEYRYYFERAPKIESKAGKFSYALEEWCDAGDPIEQQSIVPPKQIIK* |
| Ga0157284_102765692 | 3300012893 | Soil | LTYTWDDSAIYEQAHTYRYIFDRAPGDPAYALEEWCDASDPIEKQSIVPPKQIIK* |
| Ga0157293_100690743 | 3300012898 | Soil | ITYTWNDPKIYQKPHVYRYYFERAPTVNSGGAAVSYALEEWCDAGDPVERQSIVPPKQIIK* |
| Ga0126375_115092581 | 3300012948 | Tropical Forest Soil | QKPHVYRLYFERSPAVKSNGALVSYAMEEWCDAGDPIEKQSIVPPKQTIKK* |
| Ga0164300_102516803 | 3300012951 | Soil | ITYTWNDPKIYQTPHVYRYYFERAPTVNSGGAPVSYALEEWCDAGDPVEKQSIVPPKQIIK* |
| Ga0164298_107443791 | 3300012955 | Soil | NDPKIYEAPHVYRYYFERAPTVSSGGSPVSYALEEWCDAGDPVEKQSIVPPKQIIK* |
| Ga0164308_103873584 | 3300012985 | Soil | APTVTSHGAAVSYALEEWCDAGDPVEKQSIVPPKQIIK* |
| Ga0164308_116635611 | 3300012985 | Soil | VSSGGSPVSYALEEWCDAGDPVEKQSIVPPKQIIKKK* |
| Ga0164305_117935722 | 3300012989 | Soil | YTWNDPKIYEAPHVYRYYFERAPTVSSGGSPVSYALEEWCDAGDPVEKQSIVPPKQIIK* |
| Ga0157378_115056231 | 3300013297 | Miscanthus Rhizosphere | EHFQVAPDGKTMTLTYTWNDPVIYEQPHTYRYIFDRSPGDPPYALEEWCDASDPIEKQSIVPPKQIIK* |
| Ga0157380_108768521 | 3300014326 | Switchgrass Rhizosphere | QVAADGKTMTLTYTWDDSAIYEQAHTYRYIFDRAPGDPAYALEEWCDASDPIEKQSIVPPKQIIK* |
| Ga0157377_112076511 | 3300014745 | Miscanthus Rhizosphere | RLYFERAPAVKSNGALVSYALEEWCDAGDPIEKQSIVPPKQTIKK* |
| Ga0173480_103507111 | 3300015200 | Soil | ERAPMVESRGAKVSYALEEWCDAGDPVEKQSIIPPKQIIK* |
| Ga0132256_1003888061 | 3300015372 | Arabidopsis Rhizosphere | WEDPKLYQKPHVYRYYFDRSPMLDSAGAKVSYALEEWCDAGDPIEKQSIIPPKQIIK* |
| Ga0132256_1011923321 | 3300015372 | Arabidopsis Rhizosphere | TYTWDDPKIYQTPHVYRYYFERAPTVSSGGSPVSYALEEWCDAGDPVEKQSIVPPKQIIK |
| Ga0132256_1036730801 | 3300015372 | Arabidopsis Rhizosphere | DPAIYEQPHTYRYIFDRAPGDPAYALEEWCDASDPIEKQSIVPPKQIKGGGN* |
| Ga0132257_1004564941 | 3300015373 | Arabidopsis Rhizosphere | PAVKSNGALVSYALEEWCDAGDPIEKQSIVPPKQTIKK* |
| Ga0132255_1040475052 | 3300015374 | Arabidopsis Rhizosphere | FERAPTVSSGGAAVSYALEEWCDAGDPVEKQSIVPPKQIIK* |
| Ga0132255_1043595042 | 3300015374 | Arabidopsis Rhizosphere | LVERFQVAPDGQSMTISDTWDDPAIYEQPHTYRYLFDRAPGNPPYALEEWCDASDPIEKQSIVPPKQIIK* |
| Ga0173479_103289111 | 3300019362 | Soil | AATHLVERFQVAPDGKTMTVTYTWNDPAIYEQPHTYRYIFDRSPGDPPYALEEWCDASDPIEKQSIVPPKQIIK |
| Ga0247785_10429401 | 3300022889 | Soil | ERAPMVESRGAKVSYALEEWCDAGDPVEKQSIIPPKQIIK |
| Ga0247754_11833361 | 3300023102 | Soil | YQKPHVYRYYFERAPMVESRGAKVSYALEEWCDAGDPVEKQSIIPPKQIIK |
| Ga0247796_10354993 | 3300023261 | Soil | VESRGAKVSYALEEWCDAGDPVEKQSIIPPKQIIK |
| Ga0207642_106388021 | 3300025899 | Miscanthus Rhizosphere | DPKIYQAPHVYRYQFERAPTVSSGGAPVSYALEEWCDAGDPVEKQSIVPPKQIIK |
| Ga0207688_102508693 | 3300025901 | Corn, Switchgrass And Miscanthus Rhizosphere | TWDDPKVYQKPHVYRYYFERAPMVESRGAKVSYALEEWCDAGDPVEKQSIIPPKQIIK |
| Ga0207688_110311322 | 3300025901 | Corn, Switchgrass And Miscanthus Rhizosphere | QKPHVYRLYFERAPAVKSNGALVSYALEEWCDAGDPIEKQSIVPPKQTIKK |
| Ga0207643_108957992 | 3300025908 | Miscanthus Rhizosphere | VYRYYFDRSPMLESAGTPVSYALEEWCDAGDPIEKQSIIPPKQTIK |
| Ga0207701_109875021 | 3300025930 | Corn, Switchgrass And Miscanthus Rhizosphere | RSPTLDSGGTPVSYALEEWCDAGDPIEKQSIVPPKQIIK |
| Ga0207690_109171572 | 3300025932 | Corn Rhizosphere | VSSGGAAVSYALEEWCDAGDPVEKQSIVPPKQIIK |
| Ga0207670_109236961 | 3300025936 | Switchgrass Rhizosphere | EQPHTYRYIFDRAPGDPAYALEEWCDASDPIEKQSIVPPKQIKGGGN |
| Ga0207670_110371572 | 3300025936 | Switchgrass Rhizosphere | KTMTLTYTWNDPVIYEQPHTYRYIFDRSPGDPPYALEEWCDASDPIEKQSIVPPKQIIK |
| Ga0207669_108452003 | 3300025937 | Miscanthus Rhizosphere | FERAPTVSSGGSSVSYALEEWCDAGDPVEKQSIVPPKQIIK |
| Ga0207704_106639871 | 3300025938 | Miscanthus Rhizosphere | HFERAPAVKSNGALVSYALEEWCDAGDPIEKQSIVPPKQTIKK |
| Ga0207691_100865736 | 3300025940 | Miscanthus Rhizosphere | YRYYFERAPTVNSGGKPVSYALEEWCDAGDPVEKQSIVPPKQIIK |
| Ga0207640_111917111 | 3300025981 | Corn Rhizosphere | PKLYQKPHVYRYYFDRSPMLESAGAKVSYALEEWCDAGDPIEKQSIIPPKQVIK |
| Ga0207677_112844451 | 3300026023 | Miscanthus Rhizosphere | GRRLTIVYTWEDPKIYQKPHVYRLYFERAPVVKSNGALVSYALEEWCDAGDPIEKQSIVPPKQTIKK |
| Ga0207678_115995652 | 3300026067 | Corn Rhizosphere | KSNGALVSYALEEWCDAGDPIEKQSIVPPKQIIKKK |
| Ga0207708_102379781 | 3300026075 | Corn, Switchgrass And Miscanthus Rhizosphere | YTWDDPKIYQKPHVYRLYFERAPSVTSNGAPVSYALEEWCDAGDPIEKQSIVPPKQTIKK |
| Ga0207708_113598262 | 3300026075 | Corn, Switchgrass And Miscanthus Rhizosphere | MTLTYTWNDPAIYEQPHTYRYIFDRSPGDPPYALEEWCDASDPIEKQSIVPPKQIIK |
| Ga0207641_104707952 | 3300026088 | Switchgrass Rhizosphere | VEDPKIYQKPHVYRLYFERAPAVKSNGALVSYALEEWCDAGDPIEKQSIVPPKQTIKK |
| Ga0207648_104485871 | 3300026089 | Miscanthus Rhizosphere | QRLTIVYTWEDPKIYQKPHVYRLYFERAPAVKSNGALVSYALEEWCDAGDPIEKQSIVPPKQTIKK |
| Ga0209166_106712251 | 3300027857 | Surface Soil | ITYTWNDPKIYQAPHVYRYYFERAPTVSSGGAQVSYALEEWCDAGDPIEKQSIVPPKQII |
| Ga0268264_125480982 | 3300028381 | Switchgrass Rhizosphere | RLTVTYTWDDPKVYQKPHVYRYYFERAPMVESRGAKVSYALEEWCDAGDPVEKQSIIPPKQIIK |
| Ga0247822_114193961 | 3300028592 | Soil | YYFDRSPMLESAGTPVSYALEEWCDAGDPIEKQSIVPPKQTIK |
| Ga0247820_108329762 | 3300028597 | Soil | YTWTDPKVYQKPHQYRYYFERAPTVSSGGSPVSYALEEWCDAGDPVEKQSIVPPKQIIK |
| Ga0307284_100498311 | 3300028799 | Soil | PTVSSGGSPVSYALEEWCDAGDPVEKQSIVPPKQIIK |
| Ga0247827_112428712 | 3300028889 | Soil | AHTYRYIFDRAPGDPAYALEEWCDASDPIEKQSIVPPKQIIK |
| Ga0310888_104106313 | 3300031538 | Soil | VYRYYFDRAPTVNSGGTAMSYALEEWCDAGDPIEKQSIVPPKQIIK |
| Ga0310887_102259411 | 3300031547 | Soil | DDPKVYQKPHVYRYYFDRAPTVNSGGTAMSYALEEWCDAGDPIEKQSIVPPKQIIK |
| Ga0310887_105204061 | 3300031547 | Soil | LAITYTWNDPKLYQTPHVYRYYFERAPTVSAGGSPVSYALEEWCDAGDPLEKQSIVPPKQIIK |
| Ga0310886_100690024 | 3300031562 | Soil | LTITYTWNDPKIYQKPHVYRYYFERAPTVNSGGAAVSYALEEWCDAGDPVEKQSIVPPKQIIK |
| Ga0310886_105263181 | 3300031562 | Soil | AGAKISYALEEWCDAGDPVEKQSIVPPKQIKQQPR |
| Ga0310904_102285503 | 3300031854 | Soil | DPKLYQKPHVYRYYFDRSPMLESAGTPVSYALEEWCDAGDPIEKQSIVPPKQTIK |
| Ga0310893_101196041 | 3300031892 | Soil | KIYQKPHVYRYYFERAPTVSSGGAAVSYALEEWCDAGDPLEKQSIVPPKQIIK |
| Ga0307406_104004663 | 3300031901 | Rhizosphere | ERSPTIDSAGTPVSYALEEWCDAGDPVEKQSIVPPRQIIK |
| Ga0310900_100858671 | 3300031908 | Soil | ITYTWDDPKLYQKPHVYRYYFDRSPMLESAGTPVSYALEEWCDAGDPIEKQSIVPPKQTI |
| Ga0310885_101094654 | 3300031943 | Soil | WTDPKIYQKPHVYRYYFERAPTVNSGGAAVSYALEEWCDAGDPVEKQSIVPPKQIIK |
| Ga0310903_102792301 | 3300032000 | Soil | WNDPKIYQAPHVYRYQFERAPTVSSGGAPVSYALEEWCDAGDPLEKQSIVPPKQIIK |
| Ga0310899_102448733 | 3300032017 | Soil | KPHVYRYYFDRAPTVNSGGTAMSYALEEWCDAGDPIEKQSIVPPKQIIK |
| Ga0310890_117064042 | 3300032075 | Soil | RLTVTYTWEDPKVYQKPHVYRYYFDRAPMVESKGTKVSYALEEWCDAGDPVEKQSIIPPKQIIK |
| Ga0310895_101351753 | 3300032122 | Soil | DPKIYQKPHVYRYYFERAPTVNSGGAAVSYALEEWCDAGDPVEKQSIVPPKQIIK |
| Ga0310812_103534562 | 3300032421 | Soil | GQSMTISYTWDDPAIYEQPHTYRYLFDRAPGNPPYALEEWCDASDPIEKQSIVPPKQIIK |
| Ga0247829_109644641 | 3300033550 | Soil | TYTWDDPKIYQKPHVYRYYFERSPLIESRGAKISYALEEWCDAGDPVEKQSIVPPKQIK |
| Ga0247830_114193251 | 3300033551 | Soil | HVYRYYFDRSPMLDSAGTPVSYALEEWCDAGDPIEKQSIVPPKQIIK |
| Ga0364933_192114_383_523 | 3300034150 | Sediment | VYRYYFERAPTVSSGGAAVSYALEEWCDAGDPVEKQSIVPPKQIIK |
| ⦗Top⦘ |