NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F061451

Metagenome / Metatranscriptome Family F061451

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F061451
Family Type Metagenome / Metatranscriptome
Number of Sequences 131
Average Sequence Length 155 residues
Representative Sequence YHRLEVTVKRADVKLRYRPGYVAAPDKAVAPSLAEAIANPVALAGIGFTVHLEKVEGGYKASMTIDPRNITLEPKDGKWTGSLQFLVVVGKVEQLTTIPLNFSEATFHQVQDKGLILGARVKTPPGTTGFSLGFRDIPSGMVGTLHVPL
Number of Associated Samples 103
Number of Associated Scaffolds 131

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 5.38 %
% of genes near scaffold ends (potentially truncated) 93.13 %
% of genes from short scaffolds (< 2000 bps) 80.92 %
Associated GOLD sequencing projects 94
AlphaFold2 3D model prediction Yes
3D model pTM-score0.69

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (52.672 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland
(26.718 % of family members)
Environment Ontology (ENVO) Unclassified
(48.092 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(40.458 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 10.73%    β-sheet: 40.11%    Coil/Unstructured: 49.15%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.69
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 131 Family Scaffolds
PF16011CBM9_2 3.82
PF03551PadR 2.29
PF01618MotA_ExbB 2.29
PF12850Metallophos_2 2.29
PF00202Aminotran_3 2.29
PF13677MotB_plug 1.53
PF06452CBM9_1 1.53
PF04932Wzy_C 1.53
PF07635PSCyt1 1.53
PF00579tRNA-synt_1b 1.53
PF01120Alpha_L_fucos 0.76
PF00350Dynamin_N 0.76
PF13551HTH_29 0.76
PF01833TIG 0.76
PF07589PEP-CTERM 0.76
PF00691OmpA 0.76
PF00210Ferritin 0.76
PF07638Sigma70_ECF 0.76
PF00069Pkinase 0.76
PF02687FtsX 0.76
PF02610Arabinose_Isome 0.76
PF07637PSD5 0.76
PF04014MazE_antitoxin 0.76
PF01467CTP_transf_like 0.76
PF00563EAL 0.76
PF08450SGL 0.76
PF02954HTH_8 0.76
PF07978NIPSNAP 0.76
PF08818DUF1801 0.76
PF07609DUF1572 0.76
PF01019G_glu_transpept 0.76
PF09190DALR_2 0.76
PF01869BcrAD_BadFG 0.76
PF02065Melibiase 0.76
PF00873ACR_tran 0.76
PF13561adh_short_C2 0.76

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 131 Family Scaffolds
COG0515Serine/threonine protein kinaseSignal transduction mechanisms [T] 3.05
COG1846DNA-binding transcriptional regulator, MarR familyTranscription [K] 2.29
COG1733DNA-binding transcriptional regulator, HxlR familyTranscription [K] 2.29
COG1695DNA-binding transcriptional regulator, PadR familyTranscription [K] 2.29
COG0180Tryptophanyl-tRNA synthetaseTranslation, ribosomal structure and biogenesis [J] 1.53
COG3307O-antigen ligaseCell wall/membrane/envelope biogenesis [M] 1.53
COG0162Tyrosyl-tRNA synthetaseTranslation, ribosomal structure and biogenesis [J] 1.53
COG1595DNA-directed RNA polymerase specialized sigma subunit, sigma24 familyTranscription [K] 0.76
COG0405Gamma-glutamyltranspeptidaseAmino acid transport and metabolism [E] 0.76
COG0215Cysteinyl-tRNA synthetaseTranslation, ribosomal structure and biogenesis [J] 0.76
COG2160L-arabinose isomeraseCarbohydrate transport and metabolism [G] 0.76
COG2200EAL domain, c-di-GMP-specific phosphodiesterase class I (or its enzymatically inactive variant)Signal transduction mechanisms [T] 0.76
COG3345Alpha-galactosidaseCarbohydrate transport and metabolism [G] 0.76
COG3386Sugar lactone lactonase YvrECarbohydrate transport and metabolism [G] 0.76
COG3391DNA-binding beta-propeller fold protein YncEGeneral function prediction only [R] 0.76
COG3434c-di-GMP phosphodiesterase YuxH/PdeH, contains EAL and HDOD domainsSignal transduction mechanisms [T] 0.76
COG3669Alpha-L-fucosidaseCarbohydrate transport and metabolism [G] 0.76
COG4430Uncharacterized conserved protein YdeI, YjbR/CyaY-like superfamily, DUF1801 familyFunction unknown [S] 0.76
COG4943Redox-sensing c-di-GMP phosphodiesterase, contains CSS-motif and EAL domainsSignal transduction mechanisms [T] 0.76
COG5001Cyclic di-GMP metabolism protein, combines GGDEF and EAL domains with a 6TM membrane domainSignal transduction mechanisms [T] 0.76
COG5646Iron-binding protein Fra/YdhG, frataxin family (Fe-S cluster biosynthesis)Posttranslational modification, protein turnover, chaperones [O] 0.76
COG5649Uncharacterized conserved protein, DUF1801 domainFunction unknown [S] 0.76


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms52.67 %
UnclassifiedrootN/A47.33 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300001175|JGI12649J13570_1016861Not Available804Open in IMG/M
3300002245|JGIcombinedJ26739_100621541All Organisms → cellular organisms → Bacteria → Acidobacteria958Open in IMG/M
3300002245|JGIcombinedJ26739_101395613Not Available593Open in IMG/M
3300004471|Ga0068965_1251679Not Available634Open in IMG/M
3300005534|Ga0070735_10795481Not Available557Open in IMG/M
3300005591|Ga0070761_10522358All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium734Open in IMG/M
3300005602|Ga0070762_11100841All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3547Open in IMG/M
3300005610|Ga0070763_10056226All Organisms → cellular organisms → Bacteria1886Open in IMG/M
3300005712|Ga0070764_10857556Not Available567Open in IMG/M
3300009632|Ga0116102_1063543All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium1124Open in IMG/M
3300009636|Ga0116112_1231324Not Available510Open in IMG/M
3300009637|Ga0116118_1185987Not Available657Open in IMG/M
3300009644|Ga0116121_1072757All Organisms → cellular organisms → Bacteria → Acidobacteria1075Open in IMG/M
3300009645|Ga0116106_1205669Not Available626Open in IMG/M
3300009665|Ga0116135_1196767All Organisms → cellular organisms → Bacteria769Open in IMG/M
3300009683|Ga0116224_10164295Not Available1067Open in IMG/M
3300009698|Ga0116216_10060390All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae2334Open in IMG/M
3300009700|Ga0116217_10689844Not Available632Open in IMG/M
3300009764|Ga0116134_1174773All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3752Open in IMG/M
3300009839|Ga0116223_10876265Not Available512Open in IMG/M
3300010341|Ga0074045_10069788All Organisms → cellular organisms → Bacteria2484Open in IMG/M
3300014161|Ga0181529_10646665Not Available549Open in IMG/M
3300014161|Ga0181529_10652525Not Available546Open in IMG/M
3300014167|Ga0181528_10371004All Organisms → cellular organisms → Bacteria → FCB group778Open in IMG/M
3300014169|Ga0181531_10413677All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus829Open in IMG/M
3300014199|Ga0181535_10121004All Organisms → cellular organisms → Bacteria1666Open in IMG/M
3300014199|Ga0181535_10433839Not Available766Open in IMG/M
3300014493|Ga0182016_10054167All Organisms → cellular organisms → Bacteria3096Open in IMG/M
3300014499|Ga0182012_10000345All Organisms → cellular organisms → Bacteria → Acidobacteria52538Open in IMG/M
3300014501|Ga0182024_10680361Not Available1273Open in IMG/M
3300014838|Ga0182030_10538172Not Available1150Open in IMG/M
3300014838|Ga0182030_10691477Not Available959Open in IMG/M
3300016698|Ga0181503_1387410All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes2398Open in IMG/M
3300016730|Ga0181515_1005922Not Available580Open in IMG/M
3300017935|Ga0187848_10302475All Organisms → cellular organisms → Bacteria → FCB group667Open in IMG/M
3300017938|Ga0187854_10073693All Organisms → cellular organisms → Bacteria1645Open in IMG/M
3300017946|Ga0187879_10652810All Organisms → cellular organisms → Bacteria585Open in IMG/M
3300017948|Ga0187847_10059242Not Available2161Open in IMG/M
3300017972|Ga0187781_11303540Not Available536Open in IMG/M
3300017996|Ga0187891_1204082Not Available673Open in IMG/M
3300018005|Ga0187878_1363308Not Available510Open in IMG/M
3300018013|Ga0187873_1054365Not Available1716Open in IMG/M
3300018014|Ga0187860_1346514Not Available566Open in IMG/M
3300018016|Ga0187880_1261591Not Available758Open in IMG/M
3300018017|Ga0187872_10059066All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus2021Open in IMG/M
3300018018|Ga0187886_1135241All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae992Open in IMG/M
3300018024|Ga0187881_10229339All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae782Open in IMG/M
3300018026|Ga0187857_10117218Not Available1284Open in IMG/M
3300018033|Ga0187867_10057722All Organisms → cellular organisms → Bacteria2317Open in IMG/M
3300018033|Ga0187867_10092399All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus1769Open in IMG/M
3300018033|Ga0187867_10490932Not Available676Open in IMG/M
3300018035|Ga0187875_10038951All Organisms → cellular organisms → Bacteria2813Open in IMG/M
3300018035|Ga0187875_10745631Not Available513Open in IMG/M
3300018037|Ga0187883_10717550All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus522Open in IMG/M
3300018038|Ga0187855_10734537Not Available575Open in IMG/M
3300018038|Ga0187855_10902028Not Available516Open in IMG/M
3300018040|Ga0187862_10245220All Organisms → cellular organisms → Bacteria1153Open in IMG/M
3300018040|Ga0187862_10435569All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium798Open in IMG/M
3300018042|Ga0187871_10025295All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus3778Open in IMG/M
3300018043|Ga0187887_10221859All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium1122Open in IMG/M
3300018043|Ga0187887_10254528Not Available1040Open in IMG/M
3300018044|Ga0187890_10244097Not Available1012Open in IMG/M
3300018044|Ga0187890_10693673Not Available575Open in IMG/M
3300018046|Ga0187851_10081312All Organisms → cellular organisms → Bacteria2042Open in IMG/M
3300018047|Ga0187859_10909415Not Available507Open in IMG/M
3300018057|Ga0187858_10395434All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3860Open in IMG/M
3300018057|Ga0187858_10931935Not Available510Open in IMG/M
3300018062|Ga0187784_10736740Not Available788Open in IMG/M
3300018086|Ga0187769_11490044Not Available512Open in IMG/M
3300019787|Ga0182031_1125056Not Available887Open in IMG/M
3300020580|Ga0210403_11407732Not Available528Open in IMG/M
3300021407|Ga0210383_10539928All Organisms → cellular organisms → Bacteria → Proteobacteria1006Open in IMG/M
3300021474|Ga0210390_11230987Not Available603Open in IMG/M
3300023088|Ga0224555_1130567Not Available748Open in IMG/M
3300025453|Ga0208455_1082005Not Available636Open in IMG/M
3300025473|Ga0208190_1037730All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes1055Open in IMG/M
3300027652|Ga0209007_1035289All Organisms → cellular organisms → Bacteria1282Open in IMG/M
3300027853|Ga0209274_10702818Not Available522Open in IMG/M
3300027855|Ga0209693_10194820All Organisms → cellular organisms → Bacteria → Acidobacteria998Open in IMG/M
3300027867|Ga0209167_10001821All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus12084Open in IMG/M
3300027889|Ga0209380_10360898All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium853Open in IMG/M
3300028866|Ga0302278_10481060All Organisms → cellular organisms → Bacteria → Acidobacteria531Open in IMG/M
3300028866|Ga0302278_10483125Not Available529Open in IMG/M
3300028873|Ga0302197_10117639All Organisms → cellular organisms → Bacteria1317Open in IMG/M
3300029883|Ga0311327_10307559All Organisms → cellular organisms → Bacteria1028Open in IMG/M
3300029907|Ga0311329_10568458All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Bryocella → Bryocella elongata757Open in IMG/M
3300029911|Ga0311361_10062767All Organisms → cellular organisms → Bacteria5756Open in IMG/M
3300029913|Ga0311362_10111902All Organisms → cellular organisms → Bacteria3542Open in IMG/M
3300029913|Ga0311362_10612273All Organisms → cellular organisms → Bacteria → Acidobacteria964Open in IMG/M
3300029914|Ga0311359_10097979All Organisms → cellular organisms → Bacteria → Acidobacteria2852Open in IMG/M
3300029914|Ga0311359_11021357All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus556Open in IMG/M
3300029915|Ga0311358_10224850All Organisms → cellular organisms → Bacteria1673Open in IMG/M
3300029939|Ga0311328_10338240All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1101Open in IMG/M
3300029954|Ga0311331_10797277All Organisms → cellular organisms → Bacteria → Acidobacteria852Open in IMG/M
3300029955|Ga0311342_10673311Not Available822Open in IMG/M
3300029999|Ga0311339_10777670Not Available925Open in IMG/M
3300029999|Ga0311339_11582576Not Available579Open in IMG/M
3300030020|Ga0311344_10062336All Organisms → cellular organisms → Bacteria4507Open in IMG/M
3300030044|Ga0302281_10400544Not Available529Open in IMG/M
3300030045|Ga0302282_1051768All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales1881Open in IMG/M
3300030058|Ga0302179_10166036Not Available975Open in IMG/M
3300030058|Ga0302179_10259610Not Available766Open in IMG/M
3300030399|Ga0311353_11016871Not Available693Open in IMG/M
3300030503|Ga0311370_12074321Not Available565Open in IMG/M
3300030519|Ga0302193_10514051Not Available589Open in IMG/M
3300030580|Ga0311355_10288831All Organisms → cellular organisms → Bacteria1655Open in IMG/M
3300030618|Ga0311354_11816125Not Available529Open in IMG/M
3300030688|Ga0311345_10033904All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae6799Open in IMG/M
3300030707|Ga0310038_10147974Not Available1171Open in IMG/M
3300030739|Ga0302311_11020698All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Bryocella → Bryocella elongata522Open in IMG/M
3300031234|Ga0302325_11690525All Organisms → cellular organisms → Bacteria → Acidobacteria801Open in IMG/M
3300031236|Ga0302324_100295561All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Occallatibacter2488Open in IMG/M
3300031236|Ga0302324_100614683All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus1555Open in IMG/M
3300031236|Ga0302324_101705609Not Available806Open in IMG/M
3300031236|Ga0302324_101783608All Organisms → cellular organisms → Bacteria → Acidobacteria783Open in IMG/M
3300031236|Ga0302324_101838052All Organisms → cellular organisms → Bacteria768Open in IMG/M
3300031236|Ga0302324_102698799Not Available601Open in IMG/M
3300031258|Ga0302318_10182722All Organisms → cellular organisms → Bacteria1000Open in IMG/M
3300031525|Ga0302326_10231582All Organisms → cellular organisms → Bacteria3037Open in IMG/M
3300031708|Ga0310686_103237418All Organisms → cellular organisms → Bacteria → Acidobacteria5546Open in IMG/M
3300031708|Ga0310686_103807743Not Available510Open in IMG/M
3300031708|Ga0310686_104068083All Organisms → cellular organisms → Bacteria → Acidobacteria4051Open in IMG/M
3300031715|Ga0307476_10493701All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3907Open in IMG/M
3300031788|Ga0302319_10052068All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales6564Open in IMG/M
3300032895|Ga0335074_10205086All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter2395Open in IMG/M
3300032895|Ga0335074_11121688Not Available675Open in IMG/M
3300033158|Ga0335077_10367407Not Available1555Open in IMG/M
3300033977|Ga0314861_0020539All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria4183Open in IMG/M
3300033977|Ga0314861_0071872Not Available1839Open in IMG/M
3300033977|Ga0314861_0125181All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1282Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland26.72%
BogEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Bog14.50%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa12.98%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland6.87%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil5.34%
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog4.58%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil4.58%
BogEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Bog3.82%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil3.05%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil2.29%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil2.29%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil2.29%
PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland2.29%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland2.29%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil1.53%
FenEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Fen1.53%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil0.76%
Bog Forest SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil0.76%
PermafrostEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost0.76%
SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Soil0.76%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300001175Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_O3EnvironmentalOpen in IMG/M
3300002245Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027)EnvironmentalOpen in IMG/M
3300004471Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 57 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300005534Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1EnvironmentalOpen in IMG/M
3300005591Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1EnvironmentalOpen in IMG/M
3300005602Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2EnvironmentalOpen in IMG/M
3300005610Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3EnvironmentalOpen in IMG/M
3300005712Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4EnvironmentalOpen in IMG/M
3300009632Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_4_40EnvironmentalOpen in IMG/M
3300009636Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_150EnvironmentalOpen in IMG/M
3300009637Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_40EnvironmentalOpen in IMG/M
3300009644Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_10EnvironmentalOpen in IMG/M
3300009645Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_40EnvironmentalOpen in IMG/M
3300009665Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_10EnvironmentalOpen in IMG/M
3300009683Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_b_LC metaGEnvironmentalOpen in IMG/M
3300009698Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaGEnvironmentalOpen in IMG/M
3300009700Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaGEnvironmentalOpen in IMG/M
3300009764Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_40EnvironmentalOpen in IMG/M
3300009839Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaGEnvironmentalOpen in IMG/M
3300010341Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM2EnvironmentalOpen in IMG/M
3300014161Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_30_metaGEnvironmentalOpen in IMG/M
3300014167Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_10_metaGEnvironmentalOpen in IMG/M
3300014169Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_10_metaGEnvironmentalOpen in IMG/M
3300014199Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_30_metaGEnvironmentalOpen in IMG/M
3300014493Permafrost microbial communities from Stordalen Mire, Sweden - 712S2M metaGEnvironmentalOpen in IMG/M
3300014499Permafrost microbial communities from Stordalen Mire, Sweden - 612S2S metaGEnvironmentalOpen in IMG/M
3300014501Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300014838Permafrost microbial communities from Stordalen Mire, Sweden - 812S3M metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300016698Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_30_metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300016730Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_30_metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300017935Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_40EnvironmentalOpen in IMG/M
3300017938Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_150EnvironmentalOpen in IMG/M
3300017946Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_10EnvironmentalOpen in IMG/M
3300017948Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_10EnvironmentalOpen in IMG/M
3300017972Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MGEnvironmentalOpen in IMG/M
3300017996Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_21_40EnvironmentalOpen in IMG/M
3300018005Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_150EnvironmentalOpen in IMG/M
3300018013Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_100EnvironmentalOpen in IMG/M
3300018014Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_40EnvironmentalOpen in IMG/M
3300018016Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_40EnvironmentalOpen in IMG/M
3300018017Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_40EnvironmentalOpen in IMG/M
3300018018Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_150EnvironmentalOpen in IMG/M
3300018024Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_100EnvironmentalOpen in IMG/M
3300018026Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_100EnvironmentalOpen in IMG/M
3300018033Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_10EnvironmentalOpen in IMG/M
3300018035Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_10EnvironmentalOpen in IMG/M
3300018037Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_10EnvironmentalOpen in IMG/M
3300018038Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_10EnvironmentalOpen in IMG/M
3300018040Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_150EnvironmentalOpen in IMG/M
3300018042Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_10EnvironmentalOpen in IMG/M
3300018043Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_10EnvironmentalOpen in IMG/M
3300018044Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_21_10EnvironmentalOpen in IMG/M
3300018046Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_10EnvironmentalOpen in IMG/M
3300018047Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_10EnvironmentalOpen in IMG/M
3300018057Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_150EnvironmentalOpen in IMG/M
3300018062Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300018086Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MGEnvironmentalOpen in IMG/M
3300019787Permafrost microbial communities from Stordalen Mire, Sweden - 812S3M metaG (PacBio error correction)EnvironmentalOpen in IMG/M
3300020580Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-MEnvironmentalOpen in IMG/M
3300021407Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-OEnvironmentalOpen in IMG/M
3300021474Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-OEnvironmentalOpen in IMG/M
3300023088Peat soil microbial communities from Stordalen Mire, Sweden - 717 S2 30-34EnvironmentalOpen in IMG/M
3300025453Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_4_40 (SPAdes)EnvironmentalOpen in IMG/M
3300025473Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_10 (SPAdes)EnvironmentalOpen in IMG/M
3300027652Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_O2 (SPAdes)EnvironmentalOpen in IMG/M
3300027853Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 (SPAdes)EnvironmentalOpen in IMG/M
3300027855Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 (SPAdes)EnvironmentalOpen in IMG/M
3300027867Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027889Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes)EnvironmentalOpen in IMG/M
3300028866Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_N3_2EnvironmentalOpen in IMG/M
3300028873Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_N2_1EnvironmentalOpen in IMG/M
3300029883I_Bog_E2 coassemblyEnvironmentalOpen in IMG/M
3300029907I_Bog_N1 coassemblyEnvironmentalOpen in IMG/M
3300029911III_Bog_N2 coassemblyEnvironmentalOpen in IMG/M
3300029913III_Bog_N3 coassemblyEnvironmentalOpen in IMG/M
3300029914III_Bog_E2 coassemblyEnvironmentalOpen in IMG/M
3300029915III_Bog_E1 coassemblyEnvironmentalOpen in IMG/M
3300029939I_Bog_E3 coassemblyEnvironmentalOpen in IMG/M
3300029954I_Bog_N3 coassemblyEnvironmentalOpen in IMG/M
3300029955II_Bog_E2 coassemblyEnvironmentalOpen in IMG/M
3300029999I_Palsa_E3 coassemblyEnvironmentalOpen in IMG/M
3300030020II_Bog_N1 coassemblyEnvironmentalOpen in IMG/M
3300030044Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Fen_E1_2EnvironmentalOpen in IMG/M
3300030045Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Fen_E1_3EnvironmentalOpen in IMG/M
3300030058Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_1EnvironmentalOpen in IMG/M
3300030399II_Palsa_E2 coassemblyEnvironmentalOpen in IMG/M
3300030503III_Palsa_E3 coassemblyEnvironmentalOpen in IMG/M
3300030519Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_E3_3EnvironmentalOpen in IMG/M
3300030580II_Palsa_N1 coassemblyEnvironmentalOpen in IMG/M
3300030618II_Palsa_E3 coassemblyEnvironmentalOpen in IMG/M
3300030688II_Bog_N2 coassemblyEnvironmentalOpen in IMG/M
3300030707Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG (v2)EnvironmentalOpen in IMG/M
3300030739Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N1_3EnvironmentalOpen in IMG/M
3300031234Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2EnvironmentalOpen in IMG/M
3300031236Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1EnvironmentalOpen in IMG/M
3300031258Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Bog_T0_1EnvironmentalOpen in IMG/M
3300031525Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3EnvironmentalOpen in IMG/M
3300031708FICUS49499 Metagenome Czech Republic combined assemblyEnvironmentalOpen in IMG/M
3300031715Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05EnvironmentalOpen in IMG/M
3300031788Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Bog_T0_2EnvironmentalOpen in IMG/M
3300032895Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.3EnvironmentalOpen in IMG/M
3300033158Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1EnvironmentalOpen in IMG/M
3300033977Tropical peat soil microbial communities from peatlands in Loreto, Peru - SJ75EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGI12649J13570_101686123300001175Forest SoilEVTVKRPDVKLRYRPGYVAARDAAVAPTLAEAIADPVALVGVGFSVQLDPMEGGYKASVTIDARNITLQPKEGKWTGSLEFLVVVGKVEQLTTIPLSFSDAMFHQIQEKGLVLGARVKTPPGTTGFSMGFRDIPSGLVGTLHVPL*
JGIcombinedJ26739_10062154113300002245Forest SoilGYVAARDTAVAPSLAEAIANPVALAGIGFTVHLEPVEGGFKASVTIDPRNITFEPKDGKWTGSLQFLVVVGKVEQLTTIPLNFTEAVFHQIQDKGLILGARIKTPPGTNGFSLGFRDIPSGMVGTLHVPL*
JGIcombinedJ26739_10139561313300002245Forest SoilYHQLEVAVQRPGVKARYRPGYVATKDPAVTPSLTEAIASPIALSGIGFTAHLDPVDGGYKMSLTIDASNITLEPKDGKWTGSLQFLVVVGKVEQLTTIPLSFTEAMFHQIQDQGLVMGARVKTPPGTTGFSVGFRDMPTGLVGTLHVWL*
Ga0068965_125167913300004471Peatlands SoilINELHTAMQEAASDANVTYSLAFYPPPDSLDNTYHRLEVSTRRPDLKLRYRPGYVATSKPAVAPSLADAITAPIAYAGIGITAHLAPTDGGYKLSVTVDPRTITLEPKDGQWTGSLQFLVVVGKVEQLTTVPLSFSEAMFQKIQGEGLVLGARVKTPPGTTGFSLGFRDIPSGLVGTLHVPL*
Ga0070735_1079548123300005534Surface SoilPAVAPSLAEAVTQPIAYAGIGITAHLAPTDGGYKLSVTVDPRTITLEPKDGKWTGSLQFLVVVGKVEQLTTVPLTFSEAMFQKIQSEGLVLGARVKTPPGTTGFSLGFRDIASGLVGTLHVPL*
Ga0070761_1052235813300005591SoilYALAFSPPAGSLDGSYHRLEVTVNRPGTKLRYRPGYVAAPDAAVAPSLAEAIANPVALAGVGFTVHLEPVEGGYKASVTIDARDITLEPKDGKWTGSLQFLVVVNKVEQLTTIPLSFTEAMFHQIQEKGLVLGARVKTPPGTTGFSMGFRDIPSGMVGTLHARL*
Ga0070762_1110084123300005602SoilQGAVSPSLADAVVNPVTLTGIGFTAHLDPVDGGYKLSVIVDPRNLTMNQKDGKWTGTLQFLVLVGKVEQLTTVPLNFTDEAFHRIQNQGLTVGARVKTPPGTTGFSLGFRDIPSGQVGTLHVPL*
Ga0070763_1005622633300005610SoilDDAKVSYSLTFSPAAGSLDGTYHRLEVTVNRSGVKLRYRPGYVAAPDRAVAPSLADAIANPVDLAGIGFTVHLDKVEEGYKVSVVIDPRNVTLELKDGKWIGSLQLIVVVGKVEQLTTIPLNFTEALYRRVQDEGLQMGAQVKTPAGTTGFSLGFRDIPSGMVGTLHVPL*
Ga0070764_1085755613300005712SoilDSYHRLQVAVQRSGVSVRYRPGYSATRQGAVSPSLADAVVNPVTLTGIGFTAHLDPVDGGYKLSVIVDPRNLTMNQKDGKWTGTLQFLVLVGKVEQLTTVPLNFTDEAFHRIQNQGLTVGARVKTPPGTTGFSLGFRDIPSGQVGTLHVPL*
Ga0116102_106354313300009632PeatlandLDGTYHRLEVTVKRPGVKLRYRPGYVAARDTVAAPSLAEAIANPVSLAGIGFSVHLEPVEGGYKAAVTIDPRNITLEPKDGKWTGSLQFLVVVGKVEQLTTIPLSFNESALRQIQDQGLVLGARVKTPPGTTGFSLGFRDVPSGMVGTLHVPL*
Ga0116112_123132413300009636PeatlandYRPGYVAARDTAVAPSLAEAIANPVPLTGIGFSVHLEPVEGGYKAAVTIDPRNITLEPKDGTWTGSLQFLVAVGKVEQLTTIPLSFTEGALRQIQDQGLVLGARVKTPPGTTGFSLGFRDVPSGMVGTLHVPL*
Ga0116118_118598713300009637PeatlandNLDGTYHRLEVTVKRPGVKLRYRPGYVAARDTVAAPSLAEAIANPVSLAGIGFSVHLEPVEGGYKAAVTIDPRNITLEPKDGKWTGSLQFLVVVGKVEQLTTIPLSFNESALRQIQDQGLVLGARVKTPPGTTGFSLGFRDVPSGMVGTLHVPL*
Ga0116121_107275723300009644PeatlandVKLRYRPGYVAARDAAMAPSLGEAVANPVSLAGIGFSVHLEPVEGGYKASVTIDPHDITLEPKDGRWAGSLQFLVVVGKVEQLTTIPLDFSETKFHQIRDQGLVLGARVKTPPGTTGFSLGFRDASSGMVGTLHVPLDGAGVGPDNRK*
Ga0116106_120566913300009645PeatlandRVSYSLAFSPPAGTLDDSYHRLEVSVKRPDVKLRYRPGYVAARGAAAAPSLAEAVANPVALAGIGFAVHLDAVEGGYKASVTIDARNITLQPKDGKWTASVQFLVVMGKVEQLTTIPLSFSDAMFHQIQDKGIVLGARVKTPPGTTGFSLGFRDIPSGMVGTLHVPL*
Ga0116135_119676713300009665PeatlandAAVAPTLAQAIASPVALAGIGLTVHLSPVEGGYKASVTIDPRGLTLEPKDGKWAGSLQFLVVVGKVEQLTTIPVSLSEAAYRQVKEKGLVLGARVKTPPGTTGFSMGFRDIPSGLVGTLHVPL*
Ga0116224_1016429513300009683Peatlands SoilDDSSHRLEVIVKRPDVKLRYRPGYVAARDVAVAPSLAEAIANPVALAGIGFAMHLEPVEGGYKASMTIDPRNITLEPKDGKWTGSLQFLVVVGKVEQLTTIPLSFTEAAFHQIQDQGLVLGARVKTPLGTTGFSVGFRDIPSGIVGTLHAPL*
Ga0116216_1006039013300009698Peatlands SoilHRLEVIVKRPDVKLRYRPGYVAARDVAVAPSLAEAIANPVALAGIGFAMHLEPVEGGYKASMTIDPRNITLEPKDGKWTGSLQFLVVVGKVEQLTTIPLSFTEAAFHQIQDQGLVLGARVKTPLGTTGFSVGFRDIPSGIVGTLHAPL*
Ga0116217_1068984413300009700Peatlands SoilSVTYSLAFYPPADSLDNTYHRLEVSMRRPDLKLRYRPGYVATSKPAVAPSLADAITAPIAYAGIGITAHLAPTDGGYKLSVTVDPRTITLEPKDGKWTGSLQFLVVVGKVEQLTTVPLSFSEAMFQKIQSDGLVLGARVKTPPGTTGFSLGFRDIPSGLVGTLHVPL*
Ga0116134_117477313300009764PeatlandSYHRLQVEVKRPGVSVRYRPGYLAAKQTAMAPSLADAVVNPVNLTGIGFTAHLDPVDGGYKLSVTVDSRNLTIDQKDGKFTGMLQFLVVVGKVEQLTTVPLSFTEDVYHRIQNQGLTLGARVKTPPGTTGFSLGFRDIPSGQVGTLHVSL*
Ga0116223_1087626523300009839Peatlands SoilATSKPAVAPSLADAITAPIAYAGIGITAHLAPTDGGYKLSVTVDPRTITLEPKDGKWTGSLQFLVVVGKVEQLTTVPLSFSEAMFQKIQSDGLVLGARVKTPPGTTGFSLGFRDIPSGLVGTLHVPL*
Ga0074045_1006978823300010341Bog Forest SoilRYRPGYVAARDAAMAPPLTEAIANPAALAGVGFSVHLDPLEGGYRAEVTIDPHSITLEPKDGKWTGALQFLVVVGKVEQMTTIPLSFSEATFHQVQDRGLVLGARVKTPPGTTGFSIGFRDVPSGMVGTLHIPL*
Ga0181529_1064666513300014161BogLGEAVANPVSLAGIGFSVHLEPVEGGYKASVTIDPHDITLGPKDGRWAGSLQFLVVVGKVEQLTTIPLDFSEAKFHQIQDQGLVLGARVKTPPGTTGFSLGFRDVSSGMVGTLHVPLDGAGVSSPIVAK*
Ga0181529_1065252513300014161BogLGEAVANPVSLAGIGFSVHLEPVEGGYKASVTIDPHDITLEPKDGRWAGSLQFLVVVGKVEQLTTIPLDFSETKFHQIRDQGLVLGARVKTPPGTTGFSLGFRDASSGMVGTLHVPLDGAGVGPDNRK*
Ga0181528_1037100413300014167BogRYRPGYVAARGAAAAPSLAEAVANPVALAGIGFAVHLDAVEGGYKASVTIDARNITLEPKDGKWTGSLQFLVVVGKVEQLTTIPLNFSEGMFHQIQEKGLVLGARVKTPPGTTGFSMGFRDIPSGTVGTLHVPL*
Ga0181531_1041367713300014169BogGQAFHHINDLSEAIQEAAGDARVSYSLAFSPPADSLDGSYHKLEVAVSRPDVKVRYRPGYVAAPDAAVAPSLAAAIASPVALAGIGFSVHLDPVEGGYKASVTIDARNITLQPKDRKWTGSLQFLVVVGKVGQLTTIPLNFSEAMFHQIQDKGLVLGARVKTPPGTTGFSLGFRDIPSGMVGTLHVPL*
Ga0181535_1012100413300014199BogMAPSLADAIANPVALTGIGLSVHLEPVEGGYKASVTIDPRNITLESKDGVWTGSLEFLVVVGKVEQLTTIPLHFIEAKFHQIQDQGLVLGARVKTPPGTTGFSMGFRDVPSGMVGTLHVPLDGEGAATADNPK*
Ga0181535_1043383913300014199BogDLSAAIREAAGDARVSYSLAFSPPAGTLDDSYHRLEVSVKRPDVKLRYRPGYVAARGAAAAPSLAEAVANPVALAGIGFAVHLDAVEGGYKASVTIDARNITLEPKDGKWTGSLQFLVVVGKVEQLTTIPLNFSEGMFHQIQEKGLVLGARVKTPPGTTGFSMGFRDIPSGTVGTLHVPL
Ga0182016_1005416753300014493BogMLAVLAAIREAAGDARVSYSMAFSPAASSLDGQYHHLALSVERPGVSLRYRPGYVAARDTVMTPPLAEAIASPVALAGIGFTVHLEPVDGGYKASVTLDAHNITLEPKDGKWTGSLQFLVVVGKVEQLTTIPLNFSDAMYRQIQEKGLVMGARVKTPPGTTGFGFGFRDIPSGMVGTLHVPLSLGTN*
Ga0182012_1000034523300014499BogMLAVLAAIREAAGDARVSYSMAFSPAASSLDGQYHHLALSVERPGVSLRYRPGYVAARDTVMTPPLAEAIASPVALAGIGFTVHLEPVDGGYKASVTLDAHNITLEPKDGKWTGSLQFLVVVGKVEQLTTIPLNFSDAMNRQIQEKGLVMGARVKTPPGTTGFGFGFRDIPSGMVGTLHVPLSLGTN*
Ga0182024_1068036123300014501PermafrostVKRPGVELRYRPGYVTARDAVLTPPLADAIANPVALAGIGFTVHLQPVDQGYQASVNIDPHNISFEMKDGMWTCTLQFLVVVGKVEQLTTIPLSFTEAKLHEIQADGLTLGARVKTPPGVTGFSMGFRDIPTGVVGTLHVHL*
Ga0182030_1053817223300014838BogSPAAGSLDDSYHRLEVTVKRPDVKLRYRPGYVAARGAAVAPSLAEAIANPVALVGIGFTVHLDAVEGGYKASVTIDTRNITLEPKDGKWIGSLQFLVVVGKVEQLTTIPLNFSEAMFHQIQEKGLVLGARVKTPPGTTGFSMGFRDIPSGMVGTLHVPL*
Ga0182030_1069147713300014838BogTDARVSYSLAFYPATGSLDGSYHRLVVNTRRPDVKLQYRPGYFAAPDSAIAPLLPVAVGNPVTLAGIGFTVHLDPVEGGYKASITIDPRNITLESKDGKWMGSLQFLAVVGKVEQLTTIPLNLSPATYQQVQAKGLMLSMRVKTPPGTTGFSLGLRDIPSGMVGTLHVQL*
Ga0181503_138741013300016698PeatlandDGSYHRLEVIVKRPGVKLRYRPGYVAARDAAMAPSLGEAVANPVSLAGIGFSVHLEPVEGGYKASVTIDPHDITLEPKDGRWAGSLQFLVVVGKVEQLTTIPLDFSEAKFHQIQDQGLVLGARVKTPPGTTGFSLGFRDASSGMVGTLHVPLDGAGVGPDNRK
Ga0181515_100592213300016730PeatlandVTVKRPDLNLRYRPGYVAARDAALAPSLAEAIANPVPLAGIGFTVHLEPVEGGYRASLTIDPRNITLEPKDGKWIGSLQFLVVVGKVEQLTTIPLNFSEAMFHQIQEKGLVLGARVKTPPGTTGFSLGFRDVPSGMVGTLHVPL
Ga0187848_1030247523300017935PeatlandAARGAAVAPSLAEAIANPVALAGIGFTVHLDAVEGGYKASMTIDARNLTLEPKDGNWTGSLQFLVVVGKVEQLTTIPLNFSEAMFHQIQEKGLVLGARVKTPPGTTGFSMGFRDVPSGMVGTLHVPL
Ga0187854_1007369333300017938PeatlandYPSPVSWDGSYHRVDVTVNRPGTKLRYRPGYVAAPDTATTPSLADEIANPIELTGIGFSVHLDPMEDGYKAAITIDARNIALEPRDGKWTGSLQFLVVVGKVEQLTTIPLNFTEALFHQIQDRGLILGAHIKTPPGATGFSVGFRDVPSGMVGTLHVAL
Ga0187879_1065281023300017946PeatlandPGVKLRYRPGYVAAPDAAVAPTLAQAIASPVALAGIGFTVHLSPVEGGYKASVTIDPRGLTLEPKDGKWAGSLQFLVVVGKVEQLTTIPVSLSEAAYRQVKEKGLVLGARVKTPPGTTGFSMGFRDIPSGLVGTLHVPL
Ga0187847_1005924243300017948PeatlandPTLAEAIANPVALEGIGFSVHLEPVEGGYKASVTIDARNITLQPKDGKWTGSLQFLVVVGKVEQLTTIPLNFSDAMFHQVQDKGLVLGARVKTPPGTTGVSMGVRDSPSGVVGTLHVPL
Ga0187781_1130354013300017972Tropical PeatlandGETAMSPSLADVITNPIALAGIGFTAHLDLVEGGYKLSVTIDPRNITLETKDGKWTGSLEFLVVVGKTEQLTTIPLSFTEATYHQIQDKGLVLGARVETPPGTTGFSIGFRDMRSGLVGTLHVPL
Ga0187891_120408213300017996PeatlandSAHADSRGPHVRTSLADAIANPIELTGIGFSVHLDPMEDGYKAAITIDPRNIALEPRDGKWTGSLQFLVVVGKVEQLTTLPLNFTEAVFHEIQDKGLILGAHIKTPPGATGFSVGFRDVPSGMMGTLHVAL
Ga0187878_136330813300018005PeatlandVNRSGLKLRYRPGYVAAPDMVTVPSLAEAIANPVPLTGIGFSVHLEPVEGGYKATVTIDPRNITLEPKDGTWTGSLQFLVAVGKVEQLTTIPLSFTEGALRQIQDQGLVLGARVKTPPGTTGFSLGFRDVPSGMVGTLHVPL
Ga0187873_105436513300018013PeatlandPGYVAARDTAVAPSLAEAIANPVPLTGIGFSVHLEPVEGGYKAAVTIDPRNITLEPKDGTWTGSLQFLVAVGKVEQLTTIPLSFTEGALRQIQDQGLVLGARVKTPPGTTGFSLGFRDVPSGMVGTLHVPL
Ga0187860_134651423300018014PeatlandSYHRLDVTVTRPDVKLRYRSGYVAARDVAVAPSLAEAIANPVDLAGIGFSVHLEPVDGGYKASMTIDPRSLTLEPKDGKWTGSLQFLVVVGKVEQLTTIPLSLTEASFRHIEDTGLVLGARVKTPPGTKGFSIGFRDIPSGAVGTLHVPL
Ga0187880_126159113300018016PeatlandAASVDGSYHRLAVRVQRPGVKLRYRPGYVAARDTAVAPPLAEAIANPVALTGIGFTVHLDPVEGGYKASLTLDPRDITLEPRDGKWTGSLQFLVVVGKVEQLTTIPLSFTEATFRQIQDKGLVLGARVKTPPGTTGFSLGFRDVPSGMVGTLHVPP
Ga0187872_1005906613300018017PeatlandETGGLAFHHINDLSTAIQEAASDARVSYSLGFSLPAANLDGTYHRLEVTVKRPSVKLRYRPGYVAARDTAVAPSLAEAIANPVPLTGIGFSVHLEPVEGGYKAAVTIDPRNITLEPKDGTWTGSLQFLVAVGKVEQLTTIPLSFTEGALRQIQDQGLVLGARVKTPPGTTGFSLGFRDVPSGMVGTLHVPL
Ga0187886_113524113300018018PeatlandSSTGKRNKPPKAIFAPDFNYETLETLAGETGGLAFHHINDLSTAVQEAASDARVSYSLGFSLPAANLDGTYHRLEVTVKRPSVKLRYRPGYVAARDTAVAPSLAEAIANPVPLTGIGFSVHLEPVEGGYKAAVTIDPRNITLEPKDGTWTGSLQFLVAVGKVEQLTTIPLSFTEGALRQIQDQGLVLGARVKTPPGTTGFSLGFRDVPSGMVGTLHVPL
Ga0187881_1022933913300018024PeatlandETGGLAFHHINDLSTAIQEAASDARVSYSLGFSLPAANLDGTYHRLEVTVKRPSVKLRYRPGYVAARDTAVAPSLAEAIANPVPLTGIGFSVHLEPVEGGYKAAVTIDPRNITLEPKDGKWTGSLQFLVVVGKVEQLTTIPLSFNESALRQIQDQGLVLGARVKTPPGTTGFSLGFRDVPSGMVGTLHVPL
Ga0187857_1011721813300018026PeatlandGLAFHHINDLSAAIREAAGDARVSYSLAFSPAAGSLDDSYHRLEVAVKRPDVRLRYRPGYVAARDAAVAPTLAEAIANPVALAGIGFSVRLDPVEGGYKASVTIDARNVTLQPKDGKWIGSLQFLVVVGKVEQLTTIPLNFSDAMFHQIQEKGIVLGARVKTPPGTTGFSVGFRDIPSGVVGTLHVPL
Ga0187867_1005772223300018033PeatlandAPDFNYETLETLAGETGGLAFHHINDLSTAVQEAASDARASYSLGFSLPAANLDGTYHRLEVTVKRPSVKLRYRPGYVAARDTAVAPSLAEAIANPVPLTGIGFSVHLEPVEGGYKAAVTIDPRNITLEPKDGTWTGSLQFLVAVGKVEQLTTIPLSFTEGALRQIQDQGLVLGARVKTPPGTTGFSLGFRDVPSGMVGTLHVPL
Ga0187867_1009239943300018033PeatlandQEAAGDARVSYALAFSPTAGSLDGSYHKLEVSVSRPGVKLRYRPGYVAAPDVAVAPPLSEAIANPVALAGIGFSVHLEPIEGGYKASITIDARNITLQAKDGKWTGSVQFLVVVGKVEQLTTIPLSFSDAMFHQIQDKGIVLGARVKTPPGTTGFSLGFRDIPSGMVGTLHVPL
Ga0187867_1042407013300018033PeatlandLAEAIANPVALAGIGFTVHLDPVEGGYKASVTIDARNITLEPKNGKWTGSLQFLVVVGKVEQLTTIPLNFGEAMFHQIQEKGLVLGARVKTPPGTTGFSMGFRDIPSGRVGTLHVPL
Ga0187867_1049093213300018033PeatlandLRYRPGYVAARDTAVAPPLAEAIANPIALAGIGFSVHLDPIEGGYKATVTIDPRNITLEPKDDKWIGSLQFLVVVGKVEQLTTIPLNLPEATFHQIQDKGLILGARVKTPPGTTGFSLGFRDIPSGMVGTLHVQL
Ga0187875_1003895133300018035PeatlandRDAALAPSLAEAIANPVPLAGIGFTVHLEPVEGGYRASLTIDPRNITLEPKDGKWIGSLQFLVVVGNVEQLTTIPLNFTADKFHEIQEKGLQMSTRVKTRPDTTGFSIGFRDIPSGMVGTLHVPL
Ga0187875_1074563123300018035PeatlandVKLRYRPGYVAAPDVAVAPPLSEAIANPVALAGIGFSVHLEPIEGGYKASITIDARNITLQAKDGKWTGSVQFLVVVGKVEQLTTIPLSFSDAMFHQIQDKGIVLGARVKTPPGTTGFSLGFRDIPSGMVGTLHVPL
Ga0187883_1071755013300018037PeatlandLSAAIQDAASDARVSYSLAFSPSAGSLDDSYHTLEVTVKRPDVKLRYRPGYVASRDAAVAPTLAEAIANPVALEGIGFSVHLEPVEGGYKASVTIDARNITLQPKDGKWTGSLQFLVVVGKVEQLTTIPLNFSDAMFHQVQDRGLVLGARVKTPPGTTGVSMGVRDIPSGVVG
Ga0187855_1073453713300018038PeatlandGLDGSYHKLEVSVDRPGVKVRYRPGYVAAPDVAVAPPLAEAITNPIALAGIGFSVHLEPAEGGYKASITIDARNITLQPKDGKWTGSLQFLVVVGKVEQLTTVPLNFSEAMLHQIQDKGIVLGARVKTPPGTTGFSLGFLDIPSGMVGTLHVPL
Ga0187855_1090202813300018038PeatlandLEVSSRRQDLKLRYRPGYVATSKPAVAPSLAEAVTQPITYAGIGITAHLAPTDGGYKLSVTVDPRTITLEPKDGKWTGSLQFLVVVGKVEQLTTVPLSFSEAMFQKIQSDGLVLGARVKTPPGTTGFSLGFRDIPSGLVGTLHVPL
Ga0187862_1024522013300018040PeatlandMRYRPGYVAARDAALAPSLAEAIANPVPLAGIGFTVHLEPVEGGYRASLTIDPRNITLEPKDGKWIGSLQFLVVVGNVEQLTTIPLNFTADKFHEIQEKGLQMSTRVKTRPDTTGFSIGFRDIPSGMVGTLHVPL
Ga0187862_1043556923300018040PeatlandGYVAARDTAMAPALAEAITNPVSLAGIGFNVNLEPVEGGYQASVTIDPRNITLEPRDGKWAGSLQFLVVVGKVQQLTTIPLDFSEEKFHQIQEQGLVLGARVKTPPGTTGFSLGFRDVPSGMVGTLHVPL
Ga0187871_1002529513300018042PeatlandPPKAFNGPDFNYETLDTLAIETGGQSFHHINDLSAAIQEAAGDARVSYALAFSPTAGSLDGSYHKLEVTVNRPGVKLRYRPGYVAAPDVAVAPSLAEAIANPVALAGIGFSVHLEPVEGGYKASITIDARNITLQPKDGKWTGSVQFLVVMGKVEQLTTIPLSFSDAMFHQIQDKGIVLGARVKTPPGTTGFSLGFRDIPSGMVGTLHVPL
Ga0187887_1022185913300018043PeatlandLDGSYHRLEVTVKRPGVKLRYRPGYVAARDTAMAPALAEAITNPVSLAGIGFNVNLEPVEGGYQASVTIDPRNITLEPRDGKWAGSLQFLVVVGKVQQLTTIPLDFSEEKFHQIQEQGLVLGARVKTPPGTTGFSLGFRDVPSGMVGTLHVPL
Ga0187887_1025452813300018043PeatlandPASSLDGSYHTLEVTVNRPGLKLRYRPGYVAAPDMVTVPSLAEAIANPVPLTGIGFSVHLEPVEGGYKASVTIDPRRITLEPKDGKWSGSLQFLVVVGQVEQLTTIPLNFTEAMFHQIQDQGLVVGARVKTPPGTSGFSLAFRDIPSGTLGTLHVPLYGEGDGYR
Ga0187890_1024409713300018044PeatlandASDSRVTYSLTFSPAATSLDGTYHRLELTVNRPDVKLRYRPGYVASPDTVVAPSLAEAIANPVALAGVGFTVHLEPMDGGYKASMTIDPRNLTLQPKDGNWTGSLQFLVVVGKVEQLTTIPLNFTEAKFEQIQKQGLVLGARVKTPPGTTGFSVGFRDIPSGMVGTLHVPL
Ga0187890_1069367313300018044PeatlandSLAFSPPAASLDGSYHRLEVTVKRPGVKLRYRPGYVAARDTAMAPALAEAITNPVSLAGIGFNVNLEPVEGGYQASVTIDPRNITLEPRDGKWAGSLQFLVVVGKVQQLTTIPLDFSEEKFHQIQEQGLVLGARVKTPPGTTGFSLGFRDVPSGMVGTLHVPL
Ga0187851_1008131213300018046PeatlandFNYETLETLAGETGGLAFHHINDLSTAVQEAASDARASYSLGFSLPAANLDGTYHRLEVTVKRPSVKLRYRPGYVAARDTAVAPSLAEAIANPVPLTGIGFSVHLEPVEGGYKAAVTIDPRNITLEPKDGTWTGSLQFLVAVGKVEQLTTIPLSFTEGALRQIQDQGLVLGARVKTPPGTTGFSLGFRDVPSGMVGTLHVPL
Ga0187859_1090941513300018047PeatlandAAIQEAAGDGRVSYSLAFSPPPDSLDGSYHRLEVTVKRPDLNLRYRPGYVAARDAALAPSLAEAIANPVPLAGIGFTVHLEPVEGGYRASLTIDPRNITLEPKDGKWIGSLQFLVVVGNVEQLTTIPLNFTADKFHEIQEKGLQMSTRVKTRPDTTGFSIGFRDIPSG
Ga0187858_1039543423300018057PeatlandSLTFYPSDAGLDDSYHRLQVEVKRPGVSVRYRPGYLAAKQTAMAPSLADAVVNPVNLTGIGFTAHLDPVDGGYKLSVTVDSRNLTIDQKDGKFTGMLQFLVVVGKVEQITTVPLSFTENVYHRIQNQGLTLGARVKTPPGTTGFSLGFRDIPSGQVGTLHVSL
Ga0187858_1093193513300018057PeatlandPGYVAARDAALAPSLAEAIANPVPLAGIGFTVHLEPVEGGYRASLTIDPRNITLEPKDGKWIGSLQFLVVVGNVEQLTTIPLNFTADKFHEIQEKGLQMSTRVKTRPDTTGFSIGFRDIPSGMVGTLHVPL
Ga0187784_1073674013300018062Tropical PeatlandKSGRPPRGAAPPDFYYETLETLAEDTGGLAFHHINDLSRAIDDAASDAQVSYSLAFYPSTVSWDGSYYHLDVTVNRPGTKLRYRPGYVAAPDAATTPSLTDAIANPIELTGIGFSVHLDSMADGYKAAITIDPRNITLEPRGGIWTGSLQFLVMVGKVEQLTTIPLNFTEAVFRQIQDKGLILGARVKTPPGTTGFSVGFRDGPSGIVGTLHVAL
Ga0187769_1149004413300018086Tropical PeatlandPSTASWDGSCHRLEVSVKRPGTKLRYRPGYVAARAAAVAPPLAEAIANPIALAGIGFRVHLDPIEGGYKASVTIDPRNITLEPKDGRWAGSLQFLVVVGKVEQLTTIPLNFTEAMFQQVQNNGLVLGARVKTPAGTTGFSLGFRDIPSGMVGTLHLPL
Ga0182031_112505623300019787BogSPAAGSLDDSYHRLEVTVKRPDVKLRYRPGYVAARGAAVAPSLAEAIANPVALVGIGFTVHLDAVEGGYKASVTIDTRNITLEPKDGKWIGSLQFLVVVGKVEQLTTIPLNFSEAMFHQIQEKGLVLGARVKTPPGTTGFSMGFRDIPSGMVGTLHVPL
Ga0210403_1140773213300020580SoilSYSLAFYLSDARLDDSYHRLQVEVKRPGVSVRYRPGYLATKQNAMAPSLADAVVNPVNVTGIGFTAHLDPVDGGYKLSVNVDSRNLTIDQKDGKWTGMLQFLVVVGKVEQLTTVPLSFTEDVYHRIQNQGLTLGARVKTPPGTTGFSLGFRDIPSGQVGTLHVFL
Ga0210383_1053992813300021407SoilKAFHHINDMSAAIQDAESDAQVSYSLAFYLPAGSLDGTYHRLDISVKRPGMKLRYRPGYLAARDLAVAPSLAEAIRNPVASAGIGFTVHLDPTEGGYKASVTIDPRDITLKPQDGKWTGELQFLVVVGQTQQVSTIPLNFNADMFHQIQDQGLILGARVKTPPGTTGFSMGFRDVPSGMVGTLYVPLHNAD
Ga0210390_1123098713300021474SoilADDAKVSYSLTFSPAAGSLDGTYHRLEVTVNRSGVKLRYRPGYVAAPDRAVAPSLADAIANPVDLAGIGFTVHLDKVEEGYKLSVVIDPRNVTLELKDGKWIGSMQLIVVVGKVEQLTTIPLNFTEALYRRVQDEGLQMGAQVKTPAGTTGFSLGFRDIPSGMVGTLHVPL
Ga0224555_113056713300023088SoilDGSYHQLEVTLKRPGMNLRYRPGYVAAKDAAMAPSLADAIANPIALAGIGFTVHLEPVEGGYRASVTIDPHNITLEPRDGKWIGSLQFLVVVGNVEQLTTIPLNFTADKFHEIQEKGLLMSTRVKTRPETKGFSMGFRDVPSGMVGTLHMPL
Ga0208455_108200513300025453PeatlandHRLEVTVKRPGVKLRYRPGYVAARDTVAAPSLAEAIANPVSLAGIGFSVHLEPVEGGYKAAVTIDPRNITLEPKDGKWTGSLQFLVVVGKVEQLTTIPLSFNESALRQIQDQGLVLGARVKTPPGTTGFSLGFRDVPSGMVGTLHVPL
Ga0208190_103773013300025473PeatlandGEAVANPVSLAGIGFSVHLEPVEGGYKASVTIDPHDITLEPKDGRWAGSLQFLVVVGKVEQLTTIPLDFSETKFHQIRDQGLVLGARVKTPPGTTGFSLGFRDASSGMVGTLHVPLDGAGVGPDNRK
Ga0209007_103528933300027652Forest SoilYRPGYVATKDPAVTPSLTEAIASPIALSGIGFTAHLDPVDGGYKMSLTIDASNITLEPKDGKWTGSLQFLVVVGKVEQLTTIPLSFTEAMFHQIQDQGLVMGARVKTPPGTTGFSVGFRDMPTGLVGTLHVWL
Ga0209274_1070281813300027853SoilHRLEVTVNRPGTKLRYRPGYVAAPDAAVAPSLAEAIANPVALAGVGFTVHLEPVEGGYKASVTIDARDITLEPKDGKWTGSLQFLVVVNKVEQLTTIPLSFTEAMFHQIQEKGLVLGARVKTPPGTTGFSMGFRDIPSGMVGTLHARL
Ga0209693_1019482023300027855SoilGREMQASLPIPRYVGVDPMPQQRRHALEVTVNRPGVKLRYRPGYVAARDTAVAPSLAQAIANPVALAGIGFTVHLEPVDGGYKASMTIDPRNLTIEAKDGKWTGSLQFLVVVGKAEQLTTIPLNFTEAMFHQIQDRGLVLGARVKTPAGTTGFSLGFRDIPSGMVGTLHVPL
Ga0209167_1000182113300027867Surface SoilDTAAAPSLADAIANPVELAGIGFTVQLEPVEGGYKASVTIDPRSITLEPKDGKWTGSLQFLVVVGKTEQLTTIPLNFTEAVFNQIQSQGLILGARVKTPLGTTGFSMGFRDIPSGMVGTLHVPL
Ga0209380_1036089813300027889SoilYRPGYVATKDPAVTPSLTEAIASPIALSGIGFTAHLDPVDGGYKMSLTIDASNITLEPKDGKWTGSLQFLVVVGKVEQLTTIPLSFTEAMFHQIQDQGLVMGARVKTPPGTTGFSVGFRDMPTGLVGTLHVPL
Ga0302278_1048106023300028866BogVAAPGAAAVPTLAEAVANPVALAGIGFTVHLDPVNGGYQASVTIDARNITLQPHDGKWAGALQFLVVVGKVEQLTTIPLNLSEAMFRQIQEKGLMLGARVKTTPGTTGFSMGFRDIPSGLVGTLHVPL
Ga0302278_1048312513300028866BogYSMAFSPAASSLDGQYHHLALSVERPGVSLRYRPGYVAARDTVMTPPLAEAIASPVALAGIGFTVHLEPVDGGYKASVTLDAHNITLEPKDGKWTGSLQFLVVVGKVEQLTTIPLNFSDAMNRQIQEKGLVMGARVKTPPGTTGFGFGFRDIPSGMVGTLHVPLSLGTN
Ga0302197_1011763923300028873BogAARDTVMTPPLAEAIASPVALAGIGFTVHLEPVDGGYKASVTLDAHNITLEPKDGKWTGSLQFLVVVGKVEQLTTIPLNFSDAMYRQIQEKGLVMGARVKTPPGTTGFGFGFRDIPSGMVGTLHVPLSLGTN
Ga0311327_1030755923300029883BogMLAVLAAIREAAGDARVSYSMAFSPAASSLDGQYHHLALSVERPGVSLRYRPGYVAARDTVMTPPLAEAIASPVALAGIGFTVHLEPVDGGYKASVTLDAHNITLEPKDGKWTGSLQFLVVVGKVEQLTTIPLNFSDAMYRQIQEKGLVMGARVKTPPGTTGFGFGFRDIPSGMVVTLHVPLSLGTN
Ga0311329_1056845813300029907BogLDTLAVETGGKSFHHINDLSAAIHDASTDARVSYSLAFYPATGSLDGSYHRLVVNTRRPDVKLQYRPGYFAAPDSAIAPLLPVAVGNPVTLAGIGFTVHLDPVEGGYKASITIDPRNITLESKDGKWMGSLQFLAVVGKVEQLTTIPLNLSPATYQQVQAKGLMLSMRVKTPPGTTGFSLGLRDIPSGMVGTLHVQL
Ga0311361_1006276723300029911BogMLAVLAAIREAAGDARVSYSMAFSPAASSLDGQYHHLALSVERPGVSLRYRPGYVAARDTVMTPPLAEAIASPVALAGIGFTVHLEPVDGGYKASVTLDAHNITLEPKDGKWTGSLQFLVVVGKVEQLTTIPLNFSDAMYRQIQEKGLVMGARVKTPPGTTGFGFGFRDIPSGMVGTLHVPLSLGTN
Ga0311362_1011190223300029913BogMLAVLAAIREAAGDARVSYSMAFSPAASSLDGQYHHLALSVERPGVSLRYRPGYVAARDTVMTPPLAEAIASPVALAGIGFTVHLEPVDGGYKASVTLDAHNITLEPKDGKWTGSLQFLVVVGKVEQLTTIPLNFSDAMNRQIQEKGLVMGARVKTPPGTTGFGFGFRDIPSGMVGTLHVPLSLGTN
Ga0311362_1061227313300029913BogSYSLAFSPPAGSLDGSYHRLDVTVNRPGVKVRFRPGYVAAPGAAAVPTLAEAVANPVALAGIGFTVHLDPVNGGYQASVTIDARNITLQPHDGKWAGALQFLVVVGKVEQLTTIPLNLSEAMFRQIQEKGLMLGARVKTTPGTTGFSMGFRDIPSGLVGTLHVPL
Ga0311359_1009797913300029914BogRRPDVKLQYRPGYFAAPDSAIAPLLPVAVGNPVTLAGIGFTVHLDPVEGGYKASITIDPRNITLESKDGKWMGSLQFLAVVGKVEQLTTIPLNLSPATYQQVQAKGLMLSMRVKTPPGTTGFSLGLRDIPSGMVGTLHVQL
Ga0311359_1102135713300029914BogSGSGGPSGAGIATRVLLVLFDPGMLPVSPEHMLAVLAAIREAAGDARVSYSMAFSPAASSLDGQYHHLALSVERPGVSLRYRPGYVAARDTVMTPPLAEAIASPVALAGIGFTVHLEPVDGGYKASVTLDAHNITLEPKDGKWTGSLQFLVVVGKVEQLTTIPLNFSDAMNRQIQEKGLVMGAR
Ga0311358_1022485023300029915BogMLAVLAAIREAAGDARVSYSMAFSPAASSLDGQYHHLALSVERPGVSLRYRPGYVAARDTVMTPPLAEAIASPVALAGIGFTVHLEPVDGGYKASVTLDAHNITLEPKDGKWTGSLQFLVVVGKVEQLTTIPLNFSDAMYRQIQEKGLVMGARVKRPPGTRGFGFGFRDIPSGMVGTLHVPLSLGTN
Ga0311328_1033824013300029939BogFHHINDLSAAIHDASTDARVSYSLAFYPATGSLDGSYHRLVVNTRRPDVKLQYRPGYFAAPDSAIAPLLPVAVGNPVTLAGIGFTVHLDPVEGGYKASITIDPRNITLESKDGKWMGSLQFLAVVGKVEQLTTIPLNLSPATYQQVQAKGLMLSMRVKTPPGTTGFSLGLRDIPSGMVGTLHVQL
Ga0311331_1079727713300029954BogYHRLDVTVNRPGVKVRFRPGYVAAPGAAAVPTLAEAVANPVALAGIGFTVHLDPVNGGYQASVTIDARNITLQPHDGKWAGALQFLVVVGKVEQLTTIPLNLSEAMFRQIQEKGLMLGARVKTTPGTTGFSMGFRDIPSGLVGTLHVPL
Ga0311342_1067331123300029955BogNDLSAAIHDASTDARVSYSLAFYPATGSLDGSYHRLVVNTRRPDVKLQYRPGYFAAPDSAIAPLLPVAVGNPVTLAGIGFTVHLDPVEGGYKASITIDPRNITLESKDGKWMGSLQFLAVVGKVEQLTTIPLNLSPATYQQVQAKGLMLSMRVKTPPGTTGFSLGLRDIPSGMVGTLHVQ
Ga0311339_1077767013300029999PalsaRPGYVATKDAAVAPSLAEAIASPIALSGIGFTAHLDPVDGGYKLSLTIDTRNITLEPKDGKWTGSLQFLVVVGKVEQLTTIPLNFTETVFHQIQDQGLAMGARVKTPPGTTGFSVGLRDMPTGLVGTLHVAL
Ga0311339_1158257613300029999PalsaRVSYSLAFYPSAGSLDNTYHQLEVAVQRPGVKARYRPGYVATKDPAVAPSLTEAIASPIALAGIGFSAHLDPVDGGYKLALTIDPHNITLEPKDGKWTGSLQFLVVVGKVEQLTTIPLSFTEAMFRQIQDQGLVMGARVKTPPGTTGFSVGFRDMPTGLVGTLHVPL
Ga0311344_1006233613300030020BogRVSYSMAFSPAASSLDGQYHHLALSVERPGVSLRYRPGYVAARDTVMTPPLAEAIASPVALAGIGFTVHLEPVDGGYKASVTLDAHNITLEPKDGKWTGSLQFLVVVGKVEQLTTIPLNFSDAMNRQIQEKGLVMGARVKTPPGTTGFGFGFRDIPSGMVGTLHVPLSLGTN
Ga0302281_1040054413300030044FenGYVAARDTVMTPPLAEAIASPVALAGIGFTVHLEPVDGGYKASVTLDAHNITLEPKDGKWTGSLQFLVVVGKVEQLTTIPLNFSDAMYRQIQEKGLVMGARVKTPPGTTGFGFGFRDIPSGMVGTLHVPLSLGTN
Ga0302282_105176813300030045FenTRVLLVLFDPGMLPVSPEHMLAVLAAIREAAGDARVSYSMAFSPAASSLDGQYHHLALSVERPGVSLRYRPGYVAARDTVMTPPLAEAIASPVALAGIGFTVHLEPVDGGYKASVTLDAHNITLEPKDGKWTGSLQFLVVVGKVEQLTTIPLNFSDAMYRQIQEKGLVMGARVKTPPGTTGFGFGFRDIPSGMVGTLHVPLSLGTN
Ga0302179_1016603613300030058PalsaAFSPSAGSLDDSYHTLEVTVKRPDVKLRYRPGYVASRDAAVAPTLAEAIANPVALEGIGFSVHLEPVEGGYKASVTIDARNITLQPKDGKWTGSLQFLVVVGKVEQLTTIPLNFSDAMFHQVQDKGLVLGARVKTPPGTTGVSMGVRDIPSGVVGTLHVPL
Ga0302179_1025961013300030058PalsaRLEVAVARPGVSLRYRPGYLATTEAAVAPSLADAVANPIALAGIGFTAHLDKVEGGYKMSVTIDPRNITLEPKDGKWTGSLQFLVVVGKVEQLTTVPLNFTEAVFHQIQDKGLVLGARVKTPPGITGFSVGFRDIPSGLVGTLHVPL
Ga0311353_1101687113300030399PalsaELDAAMREAAGDARVSYSLAFYPAAGSLDDSYHRLEVAVERPGVSLRYRPGYLATTEAAVAPSLADAVANPIALAGIGFTAHLDKVEGGYKMSVTIDPRNITLEPKDGKWTGSLQFLVVVGKVEQLTTVPLNFTEAVFHQIQDKGLVLGARVKTPPGITGFSVGFRDIPSGLVGTLHVPL
Ga0311370_1207432113300030503PalsaGVSLRYRPGYLATTEAAVAPSLADAVANPIALAGIGFTAHLDQVEGGYKMSVTIDPRNITLEPKDGKWTGSLQFLVVVGKVEQLTTVPLNFTEAVFHQIQDKGLVLGARVKTPPGTTGFSVGFRDIPSGLVGTLHVPL
Ga0302193_1051405113300030519BogDTVMTPPLAEAIASPVALAGIGFTVHLEPVDGGYKASVTLDAHNITLEPKDGKWTGSLQFLVVVGKVEQLTTIPLNFSDAMNRQIQEKGLVMGARVKTPPGTTGFGFGFRDIPSGMVGTLHVPLSLGTN
Ga0311355_1028883113300030580PalsaYHTLEVTVKRPDVKLRYRPGYVASRDAAVAPTLAEAIANPVALEGIGFSVHLEPVEGGYKASVTIDARNITLQPKDGKWTGSLQFLVVVGKVEQLTTIPLNFSDAMFHQVQDKGLVLGARVKTPPGTTGVSMGVRDIPSGVVGTLHVPL
Ga0311354_1181612513300030618PalsaVAVSRPGVSLRYRAGYVAARDPVAPASSLAEAIASPVAVAGVGFSVHLDPVEDGYKASVTIDAHNLTLEPEDGKWTGSLQFLVVVGKVEQLSTIPLSFSESMFQQIQEKGLSLGARVKAPPGTTGFSMGFHDMPSGAMGTLHILL
Ga0311345_1003390413300030688BogSSMGKRNKPPGAAAPPDYNYETLDTLAVETGGKSFHHINDLSAAIHDASTDARVSYSLAFYPATGSLDGSYHRLVVNTRRPDVKLQYRPGYFAAPDSAIAPLLPVAVGNPVTLAGIGFTVHLDPVEGGYKASITIDPRNITLESKDGKWMGSLQFLAVVGKVEQLTTIPLNLSPATYQQVQAKGLMLSMRVKTPPGTTGFSLGLRDIPSGMVGTLHVQL
Ga0310038_1014797413300030707Peatlands SoilASDSSVTYSLAFYPPADSLDNTYHRLEVSMRRPDLKLRYRPGYVATSKPAVAPSLADAITAPIAYAGIGITAHLAPTDGGYKLSVTVDPRTITLEPKDGKWTGSLQFLVVVGKVEQLTTVPLSFSEAMFQKIQSDGLVLGARVKTPPGTTGFSLGFRDIPSGLVGTLHVPL
Ga0302311_1102069813300030739PalsaGQAFHHINDLSAAIQDAASDARVSYSLAFSPSAGSLDDSYHTLEVTVKRPDVKLRYRPGYVASRDAAVAPTLAEAIANPVALEGIGFSVHLEPVEGGYKASVTIDARNITLQPKDGKWTGSLQFLVVVGKVEQLTTIPLNFSDAMFHQVQDKGLVLGARVKTPPGTTGVSMGV
Ga0302325_1169052523300031234PalsaYHRLEVSVKRPGVKLRYRPGYVAAPGAAVAPTLAEAIVSPVALAGVGFTVHLDPVEGGYKASVTIDARNLTLEQKDGMWTGSLQFLVLVGKDEQLTTIPLSFTEAKYRQIQDQGLALGARVKTPPGTTGFSLGFRDMPSGMVGTLHVPL
Ga0302324_10029556113300031236PalsaYRAGYVAARDPVAPASSLAEAIASPVAVAGVGFSVHLDPVEGGYKASVTIDAHNLTLEPEDGKWTGSLQFLVVVGKVEQLSTIPLSFGESMFQQIQEKGLSLGARVKAPPGTTGFSMGFRDMPSGAMGTLHILL
Ga0302324_10061468333300031236PalsaAIQAAAGDARVSYSLAFSPAAGSLDGAYHRLEVTVKRPDVKVRYRPGYVASPDPAMTPSLADAIANPVALGGIGLSVHLDRVEGGYKASVTIDARNITLQPKDGKWTGSLQFLVVVGKVEQLTTIPLNFSDALFRQIQEKGIVLGARVKTPPGTTGFSMGFRDIPSGLVGTLHVRL
Ga0302324_10170560913300031236PalsaVAVNRPGVKVRYRPGYVAAPDAAVAPSLAEAISNPVALTGIGFSVHLEPVEGGYKASVTIDARNITLQPKDGKWTGSLQFLVVVGKVEQLTTIPLNFSEAMFHQIQEKGLVLGARVKTPPGTTGFSLGFRDIPSRMVGTLHVPL
Ga0302324_10178360813300031236PalsaYRPGYVAAPGAAVAPTLAEAIVSPVALAGVGFTVHLDPVEGGYKASVTIDARNLTLEQKDGMWTGSLQFLVLVGKDEQLTTIPLSFTEAKYRQIQDQGLALGARVKTPPGTTGFSLGFRDMPSGMVGTLHVPL
Ga0302324_10183805223300031236PalsaKVRYRPGYVASPDTAVAPSLTEAIANPVALAGIGFSVHLDPVEGGYKASVTIDARNVTLQPKDGKWIGSLQFLVVVGKVEQLTTIPLNFSEAMFHQIQEKGIVLGARVKTPPGTTGFSMGFRDIPSGMVGTLHVPL
Ga0302324_10269879913300031236PalsaAVAPPLTEAIANPVALAGIGFSVHLDPVEGGYKASVTIDARNVTLQPKDGKWIGSLQFLVVVGKVAQLTTVPLNFSDAMFHQVQEKGIVLGARVKTPPGTTGFSMGFRDVPSGMVGTLHVPL
Ga0302318_1018272213300031258BogTVMTPPLAEAIASPVALAGIGFTVHLEPVDGGYKASVTLDAHNITLEPKDGKWTGSLQFLVVVGKVEQLTTIPLNFSDAMYRQIQEKGLVMGARVKTPPGTTGFGFGFRDIPSGMVGTLHVPLSLGTN
Ga0302326_1023158213300031525PalsaVAPTLAEAIVSPVALAGVGFTVHLDPVEGGYKASVTIDARNLTLEQKDGMWTGSLQFLVLVGKDEQLTTIPLSFTEAKYRQIQDQGLALGARVKTPPGTTGFSLGFRDMPSGMVGTLHVP
Ga0310686_10323741853300031708SoilGSAFEQAADDAKVSYSLTFSPAASSLDGSYHRLELTVNRSGVKLRYRPGYVAAPDRAVAPSLADAIANPVDLAGIGFTVHLDKVEEGYKASVVIDPHSVTLEPKGGKWIGSLQFIVVVGKVVQLTTIPLNFTEALYRRVQDEGLQMGAQVKTSPGTTGFSLGLRDIPSGLVGTLHVRL
Ga0310686_10380774313300031708SoilDARVSYSLAFSPAAGSLDGSYHRLEVTVKRSSVKLRYRPGYVAAPGTAVAPPLAEAIANPVALAGIGFTVHLDPVEGGYKASVTIDAHTLTLEPKDGMWVGSLQFLVVVGREEQLTTIPLNFTEATMHQIQDRGLALGARVKTPPGTTGFSLGFRDAPSGMVGTLHVPL
Ga0310686_10406808313300031708SoilPAVSLDDAYHRIEVSSRRQDLKLRYRPGYVATNNPAVAPSLAEAVTQPIAYAGIGITAHLAPTDGGYKLSVTVDPRTITLEPRDGKWTGSLQFLVVVGKVEQLTTVPLTFSEAMFQKIQSEGLVLGARVKTPPGTTGFSLGFRDIPSGLVGTLHVPL
Ga0307476_1049370123300031715Hardwood Forest SoilHRLQVEVKRPGVSVRYRPGYLSTKQNAMAPSLADAVVNPVNVTGIGFTAHLDPVDGGYKLSVTVDSRNLTIDQKDGKFTGMLQFLVVVGKVEQLTTVPLSFTEDVYHRIQNQGLTLGARVKTPPGTTGFSLGFRDIPSGQVGTLHVSL
Ga0302319_1005206893300031788BogAAIREAAGDARVSYSMAFSPAASSLDGQYHHLALSVERPGVSLRYRPGYVAARDTVMTPPLAEAIASPVALAGIGFTVHLEPVDGGYKASVTLDAHNITLEPKDGKWTGSLQFLVVVGKVEQLTTIPLNFSDAMNRQIQEKGLVMGARVKTPPGTTGFGFGFRDIPSGMVGTLHVPLSLGTN
Ga0335074_1020508633300032895SoilSPDRAVTPTLADAITNPVALAGIGFSVHLEPVEGGYRASVTIDAHNITLVPKDGKWIGSLQFLVVVGKVEQLTTIPISLNEATYHQVEEKGLSLGARVKTPPGTPGFNIGFRDIPSGLVGTLHVSL
Ga0335074_1112168813300032895SoilGAYHRLEVAVNRPGAKLRYRPGYLAARDSIVAPPLASAIQNPVSLTGIGMTVHLEPTAGGYKTSVTLDSRDITLQPASDGKWTGSLEFLVVVGRTEQLTRIPLSLNEATFRSVEQRGLTLGARVKTPPGTTGFSLGFRDVPSGLTGTLHIGL
Ga0335077_1036740733300033158SoilYHRLEVTVKRADVKLRYRPGYVAAPDKAVAPSLAEAIANPVALAGIGFTVHLEKVEGGYKASMTIDPRNITLEPKDGKWTGSLQFLVVVGKVEQLTTIPLNFSEATFHQVQDKGLILGARVKTPPGTTGFSLGFRDIPSGMVGTLHVPL
Ga0314861_0020539_341_7603300033977PeatlandVTVNRPAVKLRYRPGYVAAPSAAVAPSLAEAIASLIALAGIGFTVNLDPVESGYKASVTLDPRNITLEPKDGKWTGALQFLVVVGKVEQLSTIPLNFSGAMFQQIQRTGLNLTARVETPAGTTGFSGCGSPIPHLPQDN
Ga0314861_0071872_2_3583300033977PeatlandVTVNRLGVKLRYRPGYVAAPSAAVAPPLAEAIASPIALAGIGFTVNLDPVEGGYKASVTLDPRNITLEPKDGKGTGALQFLVVVGKVEQLSTIPLNFSGAMFQQIQRTGLNLTARVETP
Ga0314861_0125181_870_12803300033977PeatlandKLRYRPGYVAERAAAVAPPLAEAIANPIALAGIGFRVHLDPIEGGYKASVTIDPRNITLEPKDGRWTGSLQFLVVVGKVEQLTTIPLNFTEAMFQQVQNNGLVLSARVKTPAGTPGFSLGFRDIPSGMVGTLHVPL


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.