Metagenome Family F061403

Overview

Basic Information

• Family ID: F061403
• Family Type: Metagenome
• Number of Sequences: 131
• Average Sequence Length: 38 residues
• Representative Sequence: RTLSYYCRQSIAKFDIKTGVVVYELVKQLSLIIVADLRY
• Number of Associated Samples: 25
• Number of Associated Scaffolds: 131

Quality Assessment

• Transcriptomic Evidence: No
• Most common taxonomic group: Unclassified
• % of genes with valid RBS motifs: 0.00 %
• % of genes near scaffold ends (potentially truncated): 98.47 %
• % of genes from short scaffolds (< 2000 bps): 62.60 %
• Associated GOLD sequencing projects: 25
• AlphaFold2 3D model prediction: Yes
• 3D model pTM-score: 0.51

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.

Most Common Taxonomy

• Group: Unclassified (61.832 % of family members)
• NCBI Taxonomy ID: N/A
• Taxonomy: N/A

Most Common Ecosystem

• GOLD Ecosystem: Host-Associated → Plants → Roots → Unclassified → Unclassified → Ectomycorrhiza (68.702 % of family members)
• Environment Ontology (ENVO): Unclassified (100.000 % of family members)
• Earth Microbiome Project Ontology (EMPO): Unclassified (93.893 % of family members)

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure

• Classification: Globular
• Signal Peptide: No
• Secondary Structure distribution:
  α-helix: 55.22%
  β-sheet: 0.00%
  Coil/Unstructured: 44.78%

Predicted 3D Structure

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

Gene Neighborhood

Neighboring Pfam domains

Pfam ID	Name	% Frequency in 131 Family Scaffolds
PF03732	Retrotrans_gag	9.16
PF00078	RVT_1	5.34
PF07727	RVT_2	2.29
PF14223	Retrotran_gag_2	1.53
PF00665	rve	0.76
PF13456	RVT_3	0.76
PF05701	WEMBL	0.76
PF13966	zf-RVT	0.76

Neighboring Clusters of Orthologous Genes (COGs)

COG ID	Name	Functional Category	% Frequency in 131 Family Scaffolds
COG2801	Transposase InsO and inactivated derivatives	Mobilome: prophages, transposons [X]	0.76
COG2826	Transposase and inactivated derivatives, IS30 family	Mobilome: prophages, transposons [X]	0.76
COG3316	Transposase (or an inactivated derivative), DDE domain	Mobilome: prophages, transposons [X]	0.76
COG4584	Transposase	Mobilome: prophages, transposons [X]	0.76

Phylogeny

NCBI Taxonomy

Level 1

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	61.83 %
All Organisms	root	All Organisms	38.17 %

Level 2

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	61.83 %
cellular organisms	root	All Organisms → cellular organisms	35.11 %
Viruses	superkingdom	All Organisms → Viruses	3.05 %

Level 3

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	61.83 %
Eukaryota	superkingdom	All Organisms → cellular organisms → Eukaryota	35.11 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	3.05 %

Level 4

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	61.83 %
Viridiplantae	kingdom	All Organisms → cellular organisms → Eukaryota → Viridiplantae	35.11 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	3.05 %

Level 5

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	61.83 %
Streptophyta	phylum	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta	35.11 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	3.05 %

Level 6

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	61.83 %
Streptophytina	subphylum	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina	35.11 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	3.05 %

Level 7

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	61.83 %
Embryophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	35.11 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	3.05 %

Level 8

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	61.83 %
Tracheophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta	24.43 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	3.05 %

Level 9

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	61.83 %
Euphyllophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta	24.43 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	3.05 %

Level 10

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	61.83 %
Spermatophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta	24.43 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	3.05 %

Level 11

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	61.83 %
Magnoliopsida	class	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida	24.43 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	3.05 %

Level 12

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	61.83 %
Mesangiospermae	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae	22.90 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	3.05 %

Level 13

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	61.83 %
eudicotyledons	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons	22.90 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	3.05 %

Level 14

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	61.83 %
Gunneridae	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae	22.90 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	3.05 %

Level 15

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	61.83 %
Pentapetalae	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae	22.90 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	3.05 %

Level 16

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	61.83 %
rosids	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids	22.90 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	3.05 %

Level 17

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	61.83 %
fabids	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids	20.61 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	3.05 %
rosids incertae sedis	no rank	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → rosids incertae sedis	1.53 %
malvids	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids	0.76 %

Level 18

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	61.83 %
Malpighiales	order	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales	18.32 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	3.05 %
Vitales	order	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → rosids incertae sedis → Vitales	1.53 %
Rosales	order	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Rosales	1.53 %
Fabales	order	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales	0.76 %
Sapindales	order	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Sapindales	0.76 %

Level 19

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	61.83 %
Salicaceae	family	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae	18.32 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	3.05 %
Vitaceae	family	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → rosids incertae sedis → Vitales → Vitaceae	1.53 %
Rosaceae	family	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Rosales → Rosaceae	1.53 %
Fabaceae	family	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae	0.76 %
Rutaceae	family	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Sapindales → Rutaceae	0.76 %

Level 20

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	61.83 %
Saliceae	tribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae	18.32 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	3.05 %
Amygdaloideae	subfamily	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Rosales → Rosaceae → Amygdaloideae	1.53 %
Viteae	tribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → rosids incertae sedis → Vitales → Vitaceae → Viteae	1.53 %
Aurantioideae	subfamily	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Sapindales → Rutaceae → Aurantioideae	0.76 %
Papilionoideae	subfamily	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae	0.76 %

Level 21

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	61.83 %
Populus	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus	14.50 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	3.05 %
Amygdaleae	tribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Rosales → Rosaceae → Amygdaloideae → Amygdaleae	1.53 %
Vitis	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → rosids incertae sedis → Vitales → Vitaceae → Viteae → Vitis	1.53 %
50 kb inversion clade	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade	0.76 %
Citrus	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Sapindales → Rutaceae → Aurantioideae → Citrus	0.76 %
Salix	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Salix	0.76 %

Level 22

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	61.83 %
Populus trichocarpa	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	3.82 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	3.05 %
Prunus	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Rosales → Rosaceae → Amygdaloideae → Amygdaleae → Prunus	1.53 %
Populus alba	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus alba	1.53 %
Populus deltoides	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus deltoides	1.53 %
Vitis vinifera	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → rosids incertae sedis → Vitales → Vitaceae → Viteae → Vitis → Vitis vinifera	1.53 %
Populus davidiana	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus davidiana	0.76 %
NPAAA clade	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade	0.76 %
Salix viminalis	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Salix → Salix viminalis	0.76 %
Citrus unshiu	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Sapindales → Rutaceae → Aurantioideae → Citrus → Citrus unshiu	0.76 %

Level 23

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	61.83 %
Populus trichocarpa	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	3.82 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	3.05 %
Prunus persica	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Rosales → Rosaceae → Amygdaloideae → Amygdaleae → Prunus → Prunus persica	1.53 %
Populus alba	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus alba	1.53 %
Populus deltoides	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus deltoides	1.53 %
Vitis vinifera	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → rosids incertae sedis → Vitales → Vitaceae → Viteae → Vitis → Vitis vinifera	1.53 %
indigoferoid/millettioid clade	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade	0.76 %
Populus davidiana	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus davidiana	0.76 %
Salix viminalis	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Salix → Salix viminalis	0.76 %
Citrus unshiu	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Sapindales → Rutaceae → Aurantioideae → Citrus → Citrus unshiu	0.76 %

Level 24

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	61.83 %
Populus trichocarpa	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	3.82 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	3.05 %
Prunus persica	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Rosales → Rosaceae → Amygdaloideae → Amygdaleae → Prunus → Prunus persica	1.53 %
Populus alba	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus alba	1.53 %
Populus deltoides	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus deltoides	1.53 %
Vitis vinifera	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → rosids incertae sedis → Vitales → Vitaceae → Viteae → Vitis → Vitis vinifera	1.53 %
Phaseoleae	tribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae	0.76 %
Populus davidiana	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus davidiana	0.76 %
Salix viminalis	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Salix → Salix viminalis	0.76 %
Citrus unshiu	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Sapindales → Rutaceae → Aurantioideae → Citrus → Citrus unshiu	0.76 %

Level 25

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	61.83 %
Populus trichocarpa	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	3.82 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	3.05 %
Prunus persica	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Rosales → Rosaceae → Amygdaloideae → Amygdaleae → Prunus → Prunus persica	1.53 %
Populus alba	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus alba	1.53 %
Populus deltoides	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus deltoides	1.53 %
Vitis vinifera	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → rosids incertae sedis → Vitales → Vitaceae → Viteae → Vitis → Vitis vinifera	1.53 %
Glycine	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Glycine	0.76 %
Populus davidiana	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus davidiana	0.76 %
Salix viminalis	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Salix → Salix viminalis	0.76 %
Citrus unshiu	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Sapindales → Rutaceae → Aurantioideae → Citrus → Citrus unshiu	0.76 %

Level 26

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	61.83 %
Populus trichocarpa	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	3.82 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	3.05 %
Prunus persica	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Rosales → Rosaceae → Amygdaloideae → Amygdaleae → Prunus → Prunus persica	1.53 %
Populus alba	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus alba	1.53 %
Populus deltoides	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus deltoides	1.53 %
Vitis vinifera	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → rosids incertae sedis → Vitales → Vitaceae → Viteae → Vitis → Vitis vinifera	1.53 %
Glycine subgen. Soja	subgenus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Glycine → Glycine subgen. Soja	0.76 %
Populus davidiana	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus davidiana	0.76 %
Salix viminalis	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Salix → Salix viminalis	0.76 %
Citrus unshiu	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Sapindales → Rutaceae → Aurantioideae → Citrus → Citrus unshiu	0.76 %

Level 27

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	61.83 %
Populus trichocarpa	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	3.82 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	3.05 %
Prunus persica	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Rosales → Rosaceae → Amygdaloideae → Amygdaleae → Prunus → Prunus persica	1.53 %
Populus alba	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus alba	1.53 %
Populus deltoides	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus deltoides	1.53 %
Vitis vinifera	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → rosids incertae sedis → Vitales → Vitaceae → Viteae → Vitis → Vitis vinifera	1.53 %
Glycine max	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Glycine → Glycine subgen. Soja → Glycine max	0.76 %
Populus davidiana	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus davidiana	0.76 %
Salix viminalis	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Salix → Salix viminalis	0.76 %
Citrus unshiu	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Sapindales → Rutaceae → Aurantioideae → Citrus → Citrus unshiu	0.76 %

Associated Scaffolds

Scaffold	Taxonomy	Length
3300028786|Ga0307517_10097700	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	2342
3300028786|Ga0307517_10143534	Not Available	1665
3300028786|Ga0307517_10556124	Not Available	572
3300028786|Ga0307517_10614114	Not Available	533
3300028794|Ga0307515_10105590	Not Available	3351
3300028794|Ga0307515_10183627	Not Available	2030
3300028794|Ga0307515_10262005	Not Available	1463
3300028794|Ga0307515_10903411	Not Available	514
3300030521|Ga0307511_10023467	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	5749
3300030521|Ga0307511_10098958	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus	1927
3300030521|Ga0307511_10379019	Not Available	592
3300030521|Ga0307511_10453147	Not Available	506
3300030522|Ga0307512_10028884	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus	4852
3300030522|Ga0307512_10033380	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → rosids incertae sedis → Vitales → Vitaceae → Viteae → Vitis → Vitis vinifera	4426
3300030522|Ga0307512_10202696	Not Available	1070
3300030522|Ga0307512_10367049	Not Available	624
3300030522|Ga0307512_10390122	Not Available	590
3300031456|Ga0307513_10022765	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	7352
3300031456|Ga0307513_10048301	Not Available	4620
3300031456|Ga0307513_10071150	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	3631
3300031456|Ga0307513_10229165	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	1671
3300031456|Ga0307513_10274851	Not Available	1465
3300031456|Ga0307513_10321999	Not Available	1303
3300031456|Ga0307513_10325187	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	1294
3300031456|Ga0307513_10326547	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus alba	1290
3300031456|Ga0307513_10335758	Not Available	1264
3300031456|Ga0307513_10470371	Not Available	978
3300031456|Ga0307513_10770590	Not Available	667
3300031456|Ga0307513_10913687	Not Available	585
3300031507|Ga0307509_10014712	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus	9178
3300031507|Ga0307509_10052860	Not Available	4335
3300031507|Ga0307509_10091232	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae	3119
3300031507|Ga0307509_10100304	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Sapindales → Rutaceae → Aurantioideae → Citrus → Citrus unshiu	2933
3300031507|Ga0307509_10174547	Not Available	2023
3300031507|Ga0307509_10412720	All Organisms → Viruses → Predicted Viral	1053
3300031507|Ga0307509_10484326	Not Available	924
3300031507|Ga0307509_10516620	Not Available	876
3300031507|Ga0307509_10582249	Not Available	793
3300031616|Ga0307508_10040848	Not Available	4164
3300031616|Ga0307508_10060207	Not Available	3358
3300031616|Ga0307508_10065266	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	3207
3300031616|Ga0307508_10095520	Not Available	2563
3300031616|Ga0307508_10127048	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Rosales → Rosaceae → Amygdaloideae → Amygdaleae → Prunus → Prunus persica	2152
3300031616|Ga0307508_10147103	Not Available	1960
3300031616|Ga0307508_10232300	Not Available	1442
3300031616|Ga0307508_10232345	Not Available	1442
3300031616|Ga0307508_10251488	All Organisms → Viruses → Predicted Viral	1363
3300031616|Ga0307508_10279434	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	1263
3300031616|Ga0307508_10923040	Not Available	501
3300031649|Ga0307514_10184165	Not Available	1341
3300031649|Ga0307514_10269345	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	987
3300031649|Ga0307514_10503863	Not Available	574
3300031730|Ga0307516_10050043	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus	4101
3300031730|Ga0307516_10121597	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus	2400
3300031730|Ga0307516_10127613	Not Available	2326
3300031730|Ga0307516_10138032	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Salix → Salix viminalis	2210
3300031730|Ga0307516_10175431	Not Available	1880
3300031730|Ga0307516_10335623	Not Available	1179
3300031730|Ga0307516_10410054	Not Available	1013
3300031730|Ga0307516_10451564	Not Available	941
3300031730|Ga0307516_10483131	Not Available	893
3300031730|Ga0307516_10516392	Not Available	848
3300031730|Ga0307516_10545146	Not Available	813
3300031730|Ga0307516_10581801	Not Available	773
3300031730|Ga0307516_10760875	Not Available	628
3300031730|Ga0307516_10906174	Not Available	548
3300031838|Ga0307518_10126132	Not Available	1805
3300031838|Ga0307518_10151420	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus	1604
3300031838|Ga0307518_10173063	All Organisms → Viruses → Predicted Viral	1469
3300031838|Ga0307518_10192143	Not Available	1366
3300031838|Ga0307518_10192299	Not Available	1365
3300031838|Ga0307518_10464785	Not Available	669
3300031838|Ga0307518_10532203	Not Available	590
3300031838|Ga0307518_10593965	Not Available	531
3300032354|Ga0325403_1016485	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus alba	6850
3300032354|Ga0325403_1018351	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus	6423
3300032354|Ga0325403_1026706	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	4980
3300032354|Ga0325403_1055483	Not Available	2623
3300032354|Ga0325403_1061581	Not Available	2331
3300032354|Ga0325403_1078497	Not Available	1709
3300032354|Ga0325403_1087645	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae	1456
3300032354|Ga0325403_1104778	Not Available	1100
3300032354|Ga0325403_1111745	Not Available	993
3300032354|Ga0325403_1135743	Not Available	748
3300032354|Ga0325403_1137477	Not Available	731
3300032354|Ga0325403_1152451	Not Available	612
3300032354|Ga0325403_1154295	Not Available	600
3300032355|Ga0325401_1015743	Not Available	7201
3300032355|Ga0325401_1016480	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus	7008
3300032355|Ga0325401_1029262	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Glycine → Glycine subgen. Soja → Glycine max	4860
3300032355|Ga0325401_1060487	Not Available	2698
3300032355|Ga0325401_1115279	Not Available	1312
3300032355|Ga0325401_1182960	Not Available	740
3300032355|Ga0325401_1192768	Not Available	692
3300032374|Ga0325400_1001081	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus davidiana	21953
3300032374|Ga0325400_1050301	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → rosids incertae sedis → Vitales → Vitaceae → Viteae → Vitis → Vitis vinifera	3425
3300032374|Ga0325400_1170478	Not Available	1069
3300032374|Ga0325400_1171748	Not Available	1060
3300032389|Ga0325405_1000108	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae	75452
3300032389|Ga0325405_1034777	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	3707
3300032389|Ga0325405_1045999	Not Available	2779
3300032390|Ga0325404_1088947	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	959
3300032735|Ga0325410_1030508	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	4359
3300032740|Ga0325411_1043772	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	2865
3300033179|Ga0307507_10004729	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae	23548
3300033179|Ga0307507_10031869	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida	5520
3300033179|Ga0307507_10190122	Not Available	1445
3300033179|Ga0307507_10398743	Not Available	783
3300033179|Ga0307507_10442313	Not Available	721
3300033179|Ga0307507_10498846	Not Available	656
3300033180|Ga0307510_10029911	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	6186
3300033180|Ga0307510_10087624	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Rosales → Rosaceae → Amygdaloideae → Amygdaleae → Prunus → Prunus persica	2977
3300033180|Ga0307510_10213133	Not Available	1451
3300033180|Ga0307510_10241520	Not Available	1300
3300033180|Ga0307510_10246339	Not Available	1278
3300033180|Ga0307510_10297904	Not Available	1076
3300033180|Ga0307510_10299287	All Organisms → Viruses → Predicted Viral	1071
3300033180|Ga0307510_10320384	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	1007
3300033180|Ga0307510_10426205	Not Available	768
3300033180|Ga0307510_10457909	Not Available	716
3300034389|Ga0325419_068713	Not Available	1515
3300034389|Ga0325419_090539	Not Available	959
3300034688|Ga0325420_067032	Not Available	1858
3300034688|Ga0325420_097638	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	1103
3300034689|Ga0325421_000235	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	51928
3300034689|Ga0325421_002810	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus	17413
3300034778|Ga0325423_137386	Not Available	511
3300034899|Ga0325407_000378	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida	43057
3300034901|Ga0325409_022720	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus deltoides	5517
3300034901|Ga0325409_029991	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	4362
3300034901|Ga0325409_041787	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus deltoides	3095

Environmental Properties

Associated Habitat Types

Ecosystem

Habitat	Taxonomy	Distribution
Host-Associated	Host-Associated	100.00%

Class

Habitat	Taxonomy	Distribution
Plants	Host-Associated → Plants	100.00%

Category

Habitat	Taxonomy	Distribution
Roots	Host-Associated → Plants → Roots	68.70%
Wood	Host-Associated → Plants → Wood	25.95%
Phylloplane	Host-Associated → Plants → Phylloplane	5.34%

Type

Habitat	Taxonomy	Distribution
Unclassified	Host-Associated → Plants → Roots → Unclassified	68.70%
Unclassified	Host-Associated → Plants → Wood → Unclassified	25.95%
Unclassified	Host-Associated → Plants → Phylloplane → Unclassified	5.34%

Subtype

Habitat	Taxonomy	Distribution
Unclassified	Host-Associated → Plants → Roots → Unclassified → Unclassified	68.70%
Unclassified	Host-Associated → Plants → Wood → Unclassified → Unclassified	25.95%
Unclassified	Host-Associated → Plants → Phylloplane → Unclassified → Unclassified	5.34%

Habitat

Habitat	Taxonomy	Distribution
Ectomycorrhiza	Host-Associated → Plants → Roots → Unclassified → Unclassified → Ectomycorrhiza	68.70%
Xylem	Host-Associated → Plants → Wood → Unclassified → Unclassified → Xylem	25.95%
Leaf	Host-Associated → Plants → Phylloplane → Unclassified → Unclassified → Leaf	5.34%

Associated Samples

Taxon OID	Sample Name	Habitat Type
3300028786	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM	Host-Associated
3300028794	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM	Host-Associated
3300030521	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM	Host-Associated
3300030522	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM	Host-Associated
3300031456	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM	Host-Associated
3300031507	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM	Host-Associated
3300031616	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM	Host-Associated
3300031649	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM	Host-Associated
3300031730	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM	Host-Associated
3300031838	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM	Host-Associated
3300032354	Populus deltoides microbial communities from Bellville, Georgia, United States - Xylem-PdKOR-R4	Host-Associated
3300032355	Populus deltoides microbial communities from Bellville, Georgia, United States - Xylem-PdKOR-R2	Host-Associated
3300032374	Populus deltoides microbial communities from Bellville, Georgia, United States - Xylem-PdKOR-R1	Host-Associated
3300032389	Populus deltoides microbial communities from Bellville, Georgia, United States - Xylem-Control-R2	Host-Associated
3300032390	Populus deltoides microbial communities from Bellville, Georgia, United States - Xylem-Control-R1	Host-Associated
3300032735	Populus deltoides microbial communities from Bellville, Georgia, United States - Xylem-PdIQD-R3	Host-Associated
3300032740	Populus deltoides microbial communities from Bellville, Georgia, United States - Xylem-PdIQD-R4	Host-Associated
3300033179	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM	Host-Associated
3300033180	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM	Host-Associated
3300034389	Populus deltoides microbial communities from Bellville, Georgia, United States - Leaf-Control-R4	Host-Associated
3300034688	Populus deltoides microbial communities from Bellville, Georgia, United States - Leaf-PdIQD-R1	Host-Associated
3300034689	Populus deltoides microbial communities from Bellville, Georgia, United States - Leaf-PdIQD-R2	Host-Associated
3300034778	Populus deltoides microbial communities from Bellville, Georgia, United States - Leaf-PdIQD-R4	Host-Associated
3300034899	Populus deltoides microbial communities from Bellville, Georgia, United States - Xylem-Control-R4	Host-Associated
3300034901	Populus deltoides microbial communities from Bellville, Georgia, United States - Xylem-PdIQD-R2	Host-Associated

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
Ga0307517_100977001	3300028786	Ectomycorrhiza	LSYYCRQSIAKFDIKTGVVVYELVKQLSLIIVTDLRY
Ga0307517_101435341	3300028786	Ectomycorrhiza	ERTLSYYCEQSIAKFDIKTGVVIYELVKQLSLIIVAKLRY
Ga0307517_105561241	3300028786	Ectomycorrhiza	LSYYCRQSIAKFNIKTGVVVYELVKQLSLIIVADLRY
Ga0307517_106141141	3300028786	Ectomycorrhiza	LERTLSYYCRQSIAKFDIKTGVVVYELVKQLSLIIVADLRY
Ga0307515_101055901	3300028794	Ectomycorrhiza	LERTLSYYCEQSIAKFDIKTGVVVYKLVKQLSLIIVAELRY
Ga0307515_101836271	3300028794	Ectomycorrhiza	RTLSYYCEQSIAKFDIKTRVVIYELVKQLSLIIVAELRY
Ga0307515_102620052	3300028794	Ectomycorrhiza	ERTLSYYCEQSIAKFNIKTRVVIYELVKQLNLIIVVELHY
Ga0307515_109034111	3300028794	Ectomycorrhiza	ISYYCRQSIAKFDIKIGVVVYELVKQLSLIIMADLRY
Ga0307511_100234671	3300030521	Ectomycorrhiza	LSYYCRQSIAKFDIKTGVVVYELVKQLSLIIVADLRY
Ga0307511_100989581	3300030521	Ectomycorrhiza	SYYCRQSIAKFDIKTGVVVYELVKQLSLIIVADLRY
Ga0307511_103790191	3300030521	Ectomycorrhiza	SYYCIQYIAKFDIKTGVVVYELVKQLSLIIVANLCY
Ga0307511_104531471	3300030521	Ectomycorrhiza	LERTLSYYCRQSIAKFDIKTGVVVYELVKQLSLIIMADLRY
Ga0307512_100288841	3300030522	Ectomycorrhiza	LERTLSYYCEQSIAKFDIKTGVVIYELVKQLSLIIVVKLRY
Ga0307512_100333801	3300030522	Ectomycorrhiza	SYYCEQSIAKFDIKTGVVIYELAKQLSLIIVAELRY
Ga0307512_102026961	3300030522	Ectomycorrhiza	ERTLSYYCRQSIAKFDIKTRVVVYELVKQLSLITAVDLRY
Ga0307512_103670491	3300030522	Ectomycorrhiza	WTLSYYCRQSIAKFDIKTGVVVYELVKQLSLIIMADLHY
Ga0307512_103901221	3300030522	Ectomycorrhiza	LSYYCEQSIAKFDIKTGVVIYELVKQLSLIIMAELRY
Ga0307513_100227651	3300031456	Ectomycorrhiza	LLERTLSYYCEQSIAKFDIKTGVVIYELVKQLNLIIMAELRY
Ga0307513_100483015	3300031456	Ectomycorrhiza	ERTLSYYYKQSIAKFDIKTGVVVYELVKQLSLIIVADLYY
Ga0307513_100711505	3300031456	Ectomycorrhiza	LSYYCEQSIAKFDIKTGVMVYKLVKQLSLIIVAELRY
Ga0307513_102291651	3300031456	Ectomycorrhiza	RTLSYYCRQSIAKFDIKTGVVVYELVKQLSLIIVADLRY
Ga0307513_102748511	3300031456	Ectomycorrhiza	LSYCCEQSIAKFNIKTGVVIYELVKQLSLIIVAELRY
Ga0307513_103219991	3300031456	Ectomycorrhiza	RTLSYYCEQSIAKFDIKTGVVIYKLVKQLSLVIVAELRY
Ga0307513_103251871	3300031456	Ectomycorrhiza	YYCRQSIAKFDIKTGVVVYELVKQLSLIIMADLHY
Ga0307513_103265471	3300031456	Ectomycorrhiza	YYCEQSIAKFDIKTGVVIYKLVKQLSLVIVAELRY
Ga0307513_103357581	3300031456	Ectomycorrhiza	TLSYYCRQSIAKFDIKTGVVVYELVKQLSLIIMADLHY
Ga0307513_104703712	3300031456	Ectomycorrhiza	RTLSYCCEQSIAKFNIKTEVVIYELVKQLSLIIMAELRY
Ga0307513_107705901	3300031456	Ectomycorrhiza	RTLSYYCKQSIAKFDIKTGVVVYELVKQLSLIIVADLR
Ga0307513_109136871	3300031456	Ectomycorrhiza	RTLSYYCEQSIAKFDIKTGVVIYELVKQLSLIIVVELRY
Ga0307509_100147121	3300031507	Ectomycorrhiza	ERTLSYYCRQSIAKFDIKTGVVVYELVKQLSLIIVADLRY
Ga0307509_100528601	3300031507	Ectomycorrhiza	LLERTLSYYCEKSIAKFVIKTGVVVYKLVKQLRLIIVADPDY
Ga0307509_100912321	3300031507	Ectomycorrhiza	MINMLVYSSLSYYCKQSIAKFTIKTRVVVYKLVKQLRLIVMVDLGY
Ga0307509_101003041	3300031507	Ectomycorrhiza	TLSYYCRQFIAKFDIKTGVVVYELVKQLSLIIVTDLRY
Ga0307509_101745472	3300031507	Ectomycorrhiza	TLSYYCRQSIAKFDIKTGVMVYELMKQLSLIIVADLRY
Ga0307509_104127201	3300031507	Ectomycorrhiza	YYCEQSIAKFDIKTGVVIYELVKQLNLIIMAELRY
Ga0307509_104843261	3300031507	Ectomycorrhiza	ERTLSYYCEQSIAKFNIKTGVVIYELVKQLNLIIVVELHY
Ga0307509_105166201	3300031507	Ectomycorrhiza	YYCEQSIAKFDIKTGAVIYELAKQLSLIIVAELRY
Ga0307509_105822491	3300031507	Ectomycorrhiza	LSYYCKQYIAKFTIKTRVVVYKLVKQLRLIVMVDLGY
Ga0307508_100408481	3300031616	Ectomycorrhiza	YYCRQSIAKFDIKTGVVVYELVKQMSLIIVADLHY
Ga0307508_100602071	3300031616	Ectomycorrhiza	RTLSYYCRQSIAKFDIKTGVVVYELVKQLSLIIVTDLRY
Ga0307508_100652661	3300031616	Ectomycorrhiza	ERTLSYYCEQSIAKFDIKTGVVVYKLVKQLSLIIVAELRY
Ga0307508_100955201	3300031616	Ectomycorrhiza	IYYCRQSIAKFDIKARVVVYELVKQLSLIIVVDLRY
Ga0307508_101270481	3300031616	Ectomycorrhiza	CLSLFLKRTLSYYCEQSIAKFYIKTGVVVYKLVKQLSLIIVAELRY
Ga0307508_101471033	3300031616	Ectomycorrhiza	LSYYCEQSIAKFDIKTEVVVYKLVKQLSLIIVAEQCY
Ga0307508_102323003	3300031616	Ectomycorrhiza	LLERTLSYYCEQSIAKFAIKIGVVVYELAKQLSLIIVVDLRY
Ga0307508_102323451	3300031616	Ectomycorrhiza	ILSYYCEQSIAKFAIKTGVVVYKLVKQLRLIIVADPD
Ga0307508_102514883	3300031616	Ectomycorrhiza	YYCRQSIAKFDIKTEVVVYELVKQLSLIIEADLRY
Ga0307508_102794341	3300031616	Ectomycorrhiza	ANFDIKTGVVVYELVKQLSLKLWRIYVINLRENIQSN
Ga0307508_109230401	3300031616	Ectomycorrhiza	LSYYCRQSIAKFDIKTVVVVYELVKQLSLIIVADPRY
Ga0307514_101841651	3300031649	Ectomycorrhiza	WTLNYYCRQSIAKFDIKTGVVVYELVKQLSLIIVADLRY
Ga0307514_102693451	3300031649	Ectomycorrhiza	LLERTLSYYCRQSIAKFDIKTGVVVYELVKQLNLIIVADLRY
Ga0307514_105038633	3300031649	Ectomycorrhiza	LERTLSYYCKQSIAKFDIKTRVVVYELVKQLSLTIVADLRY
Ga0307516_100500431	3300031730	Ectomycorrhiza	SYYCEQSIAKFDIKTGVVIYELVKQLSLIIVAELRY
Ga0307516_101215971	3300031730	Ectomycorrhiza	YYFEQSIAKFDIKTGVVVYKLVKQLSLIIVADLHN
Ga0307516_101276132	3300031730	Ectomycorrhiza	LSYYCEQSIAKFDIKTGVVVYKLVKQLSLIIVEKLRY
Ga0307516_101380322	3300031730	Ectomycorrhiza	IVYFKRTLSYYCEQSIAKFAIKTGVVIYKLMKQLRLIIVVDLRY
Ga0307516_101754311	3300031730	Ectomycorrhiza	LERTLSYYCEQSIAKFDIKTEVVVYKLVKQLNLIIIAELRY
Ga0307516_103356232	3300031730	Ectomycorrhiza	LERTLSYYCRQSIAKFDIKTGVVVYELVKQLSLIIVADLRYYF
Ga0307516_104100542	3300031730	Ectomycorrhiza	TLSYYCEQSIAKFDIKTGVVIYELVKQLSLIIVAELHY
Ga0307516_104515641	3300031730	Ectomycorrhiza	RTLSYYCRQSIAKFDIKTGVVVYELVKQLSLIIMADLRY
Ga0307516_104831312	3300031730	Ectomycorrhiza	LLERTLSYYCRQSIAKFDIKTRVVVYELVKQLSLITAVDLRY
Ga0307516_105163921	3300031730	Ectomycorrhiza	LSYYYKQFIVKFAIETRVVIYKLVKQLSLIIVTDLRY
Ga0307516_105451461	3300031730	Ectomycorrhiza	IILNQSTAKFAIKTRVVIFEFMKRLSLIIMADLSC
Ga0307516_105818012	3300031730	Ectomycorrhiza	ERPLSYYCEQSIAKFDIKTGVVIYELVKQLSLIIVAELRY
Ga0307516_107608752	3300031730	Ectomycorrhiza	LSYYCEQSIAKFDIKTGVVIYELVKQLSLIIVAELHY
Ga0307516_109061741	3300031730	Ectomycorrhiza	RTLSYYCRQSIAKFDIKTGVVVYELVKQLSLIIVVDLRY
Ga0307518_101261323	3300031838	Ectomycorrhiza	ERTLSYYCRQSIAKFDIKTGVVVYELLKQLSLIIVADLRY
Ga0307518_101514203	3300031838	Ectomycorrhiza	LSYYCRQSIAKFDIKTRVVVYELVKQLSLIIVVDLRY
Ga0307518_101730631	3300031838	Ectomycorrhiza	TLSYYCRQSIAKFDIKTRVVVYELVKQLSLIIVADLRY
Ga0307518_101921431	3300031838	Ectomycorrhiza	RTLSYYCRQSIAKFDIKTGVVVYELVKQLSLIIVEDLRY
Ga0307518_101922992	3300031838	Ectomycorrhiza	ERTLSYYCEQSIAKFDIKTGVVVYKLVKQLSLIIVAELRC
Ga0307518_104647851	3300031838	Ectomycorrhiza	YYYRQSIAKFDIKTGVVVYELVKQLSLIFVANLHY
Ga0307518_105322031	3300031838	Ectomycorrhiza	RTLSYYCEQSIAKFDIKTGVMVYKLVKQLSLIIIVELRY
Ga0307518_105939651	3300031838	Ectomycorrhiza	RTLSYYCEQSIAKFDIKTGVVIYELMKQLSLIIMAELRY
Ga0325403_10164853	3300032354	Xylem	SYCCEQSIAKFNIKTGVVIYELVKQLSLIIVAELHY
Ga0325403_10183516	3300032354	Xylem	LERTLSYYCRQFIAKFDIKTGVVVYELVKQPSLIIVADLRY
Ga0325403_10267061	3300032354	Xylem	LERTLSYYCEQSIAKFDIKTGVVIYKLVKQLSLVIVAELRY
Ga0325403_10554831	3300032354	Xylem	ERTLSYYCRQSIAKFDIKTGVVVYELVKQLSLIIMADLRY
Ga0325403_10615812	3300032354	Xylem	LLERTLSYCYEQSIAKFNIKTGVVIYELVKQLSLIIVAELRY
Ga0325403_10784974	3300032354	Xylem	SYYCRQSIAKFDIKTGVVVYELVKQLSLIIVADLHY
Ga0325403_10876451	3300032354	Xylem	LERTLSYYCRQSIAKFDIKTGVVVYELVKQLNLIIVADLRY
Ga0325403_11047783	3300032354	Xylem	LSYYCRQSIAKFDIKTGVVVYELVKQLSLIIMADLRY
Ga0325403_11117451	3300032354	Xylem	TLSYYCRQSIAKFDIKTGVVVYELVKQLSLIIVVDLRY
Ga0325403_11357431	3300032354	Xylem	LERTLSYYCRQSIAKFDIKTGVVVYELVKQLSLIIVADLHY
Ga0325403_11374771	3300032354	Xylem	TLSYYCRQSIAKFDIKTGVVVYKLVKQLSLIIMADLCY
Ga0325403_11524511	3300032354	Xylem	LLERTLSYYCRQSIAKFDIKTGVVVYELVKQLSLIIVADLRC
Ga0325403_11542951	3300032354	Xylem	SYYCEQSIAKFDIKTGVVVYKLVKQLSLIIVAELRY
Ga0325401_10157438	3300032355	Xylem	RTLSYYCRQSIAKFDIKTGVVVYELVKQLSLIIVADLHY
Ga0325401_10164805	3300032355	Xylem	MFDIKTGVVIYELMKQLSLIIVAQLSLIIVADLRY
Ga0325401_10292621	3300032355	Xylem	LERTLSYYCRQSIAKFDIKTGVVVYELVKQLSLIIVADLRYSS
Ga0325401_10604871	3300032355	Xylem	LERTLSYYCRQSIAKFDIKTGVVVYELVKQLSLIIVTDLRY
Ga0325401_11152791	3300032355	Xylem	TLSYYCEQYIATFDIKTRVVVYKLVKQLNLIIVAELRY
Ga0325401_11829601	3300032355	Xylem	TLSYYCRQSIAKFDIKTGVVVYELVKQLSLIIVADLRY
Ga0325401_11927682	3300032355	Xylem	LERTLSYYCRQSIAKFDIKTGVVVYELVKQLSLIIVVDLRY
Ga0325400_100108113	3300032374	Xylem	TQSYYCRQSIAKFDIKTGVVVYELMKQLSLIIVMDLCY
Ga0325400_10503011	3300032374	Xylem	ERTLSYYYRQSIAKFDIKTGVVVYELVKQLSLIIVADLRY
Ga0325400_11704781	3300032374	Xylem	YYCRQSIAKFDIKTGVVVYELVKQLSSIIVADLRY
Ga0325400_11717481	3300032374	Xylem	LSYYCRQSIAKFDIKTGVVVYELVKQLSLIIVADLCY
Ga0325405_10001081	3300032389	Xylem	YYCRQSIAKFDIKTGVMVYELVKQLSLIIMADLRY
Ga0325405_10347771	3300032389	Xylem	RTLIYCCEQSIAKFNIKTGVVIYELVKQLSLIIVAELRY
Ga0325405_10459992	3300032389	Xylem	ERTLSYYCRQSIAKFDIKTGVMVYELVKQLSLIIMADLRY
Ga0325404_10889471	3300032390	Xylem	LERTLSYYCEQSIAKFDIKTRVVIYKLVKQLSLVIVAELRY
Ga0325410_10305085	3300032735	Xylem	YYCRQFIAKFDIKTGVVVYELVKQLSLIIVADLRY
Ga0325411_10437723	3300032740	Xylem	SYYCEQSIAKFDIKTGVVIYKLVKQLSLVIVAELRY
Ga0307507_100047291	3300033179	Ectomycorrhiza	LLERTLSYCCEQSIAKFNIKTGVVIYELVKQLSLIIVAELHY
Ga0307507_100318691	3300033179	Ectomycorrhiza	LERTLSYYCRQSIAKFDIKTGVVVYELVKQLGLIIMADLRY
Ga0307507_101901221	3300033179	Ectomycorrhiza	ERTLSYYCEQSIAKFDIKTGVVIYELVKQLSLIIVAELRY
Ga0307507_103987431	3300033179	Ectomycorrhiza	LLERTLSYYCRQPIAKFDIKTGVVVYELEKQLSLIIVADLRY
Ga0307507_104423131	3300033179	Ectomycorrhiza	LSYYCRQSIAKFDIKTGVVVYELMKQLSLIIMADLCY
Ga0307507_104988461	3300033179	Ectomycorrhiza	SYYCRQSIAKFDIKIGVVVYELVKQLSLIIVADLCY
Ga0307510_100299111	3300033180	Ectomycorrhiza	LKQTLSCYCEQSIAKFAIKTGVVVFKLMKQLRLIIMADLCY
Ga0307510_100876245	3300033180	Ectomycorrhiza	TLSYYCRQSITKFDIKTGVVVYELVKKMSLIIVADLRY
Ga0307510_102131333	3300033180	Ectomycorrhiza	RTLSYYCRQFIAKFDIKTGVVVYELVKQLSLIIVADLRY
Ga0307510_102415201	3300033180	Ectomycorrhiza	LERTLSYYCEQSIAKFGIKTGVVVYKLVKQLSLIIVVELCY
Ga0307510_102463391	3300033180	Ectomycorrhiza	LSYYCKQSIAKFDIKTGVVVYELVKQLSLIIMADLHY
Ga0307510_102979042	3300033180	Ectomycorrhiza	TLSYYCEQSIAKFAIKTGVVVYKLVKQLRLIIVTDPD
Ga0307510_102992871	3300033180	Ectomycorrhiza	LERTLSYYCRQSIAKFDIKTGVVVYELVKQLSLIIVADLCY
Ga0307510_103203841	3300033180	Ectomycorrhiza	TLSYYCEQSIAKFDIKTGVMVYKLVKQLSLIIVAELRY
Ga0307510_104262051	3300033180	Ectomycorrhiza	LERTLSYYYRQSIAKFDIKTGIVVYELVKQLSLIIVADLRY
Ga0307510_104579091	3300033180	Ectomycorrhiza	LLERTLSYYCRQSIAKFDIKTGVVVYEFVKQLSLIIMADLR
Ga0325419_068713_1395_1514	3300034389	Leaf	RTLSYYCRQSIAKFDIKTGVVVYELVKQLSLIIVADLCY
Ga0325419_090539_3_122	3300034389	Leaf	RTLSYCCEQSIAKFNIKTGVVIYELVKQLSLIIVAELCY
Ga0325420_067032_2_142	3300034688	Leaf	CLFLLLERTLSYYCRQFIAKFDIKTGVVVYELVKQPSLIIVADLRY
Ga0325420_097638_986_1102	3300034688	Leaf	TLSYYCRQSIAKFDIKTGVVVYELVKQLSLIIVADLCY
Ga0325421_000235_51816_51926	3300034689	Leaf	SYYYRQSIAKFDIKTGVVVYELVKQLSLIIVADLRY
Ga0325421_002810_2_115	3300034689	Leaf	LSYYCRQSIAKFDIKTGVMVYELVKQLSLIIVADLRY
Ga0325423_137386_3_119	3300034778	Leaf	TLSYCCEQSIAKFNIKTGVVIYELVKQLSLIIVAELRY
Ga0325407_000378_2_118	3300034899	Xylem	TLSYYCRQSIAKFDIKTGVLVYELVKQLSLIIVADLRY
Ga0325409_022720_5409_5516	3300034901	Xylem	CEQSIAKFNIKTGVVIYELVKQLSLIIVAELRYWT
Ga0325409_029991_4251_4361	3300034901	Xylem	SYYCRQFIAKFDIKTGVVVYELVKQLSLIIVADLRY
Ga0325409_041787_2973_3095	3300034901	Xylem	ERTLSYCCEQSIAKFNIKTGVVIYELVKQLSLIIVAELCY