| Basic Information | |
|---|---|
| Family ID | F061386 |
| Family Type | Metagenome |
| Number of Sequences | 132 |
| Average Sequence Length | 36 residues |
| Representative Sequence | MDPTTIRIIAGVLFVVIVFIIVARRKKMASKRKPIP |
| Number of Associated Samples | 104 |
| Number of Associated Scaffolds | 132 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 90.77 % |
| % of genes near scaffold ends (potentially truncated) | 12.88 % |
| % of genes from short scaffolds (< 2000 bps) | 72.73 % |
| Associated GOLD sequencing projects | 95 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.51 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (83.333 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (25.000 % of family members) |
| Environment Ontology (ENVO) | Unclassified (36.364 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (49.242 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 45.31% β-sheet: 0.00% Coil/Unstructured: 54.69% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.51 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 132 Family Scaffolds |
|---|---|---|
| PF03544 | TonB_C | 16.67 |
| PF07811 | TadE | 1.52 |
| PF13400 | Tad | 1.52 |
| PF00482 | T2SSF | 1.52 |
| PF02518 | HATPase_c | 1.52 |
| PF12840 | HTH_20 | 1.52 |
| PF00675 | Peptidase_M16 | 0.76 |
| PF02653 | BPD_transp_2 | 0.76 |
| PF02675 | AdoMet_dc | 0.76 |
| PF00480 | ROK | 0.76 |
| PF10282 | Lactonase | 0.76 |
| PF13683 | rve_3 | 0.76 |
| PF13147 | Obsolete Pfam Family | 0.76 |
| PF08241 | Methyltransf_11 | 0.76 |
| PF02643 | DUF192 | 0.76 |
| PF16694 | Cytochrome_P460 | 0.76 |
| PF01527 | HTH_Tnp_1 | 0.76 |
| PF08533 | Glyco_hydro_42C | 0.76 |
| PF08450 | SGL | 0.76 |
| PF08388 | GIIM | 0.76 |
| PF00665 | rve | 0.76 |
| PF07992 | Pyr_redox_2 | 0.76 |
| PF03710 | GlnE | 0.76 |
| PF00025 | Arf | 0.76 |
| PF13432 | TPR_16 | 0.76 |
| PF13418 | Kelch_4 | 0.76 |
| PF00704 | Glyco_hydro_18 | 0.76 |
| PF02604 | PhdYeFM_antitox | 0.76 |
| PF00072 | Response_reg | 0.76 |
| COG ID | Name | Functional Category | % Frequency in 132 Family Scaffolds |
|---|---|---|---|
| COG0810 | Periplasmic protein TonB, links inner and outer membranes | Cell wall/membrane/envelope biogenesis [M] | 16.67 |
| COG1391 | Glutamine synthetase adenylyltransferase | Posttranslational modification, protein turnover, chaperones [O] | 1.52 |
| COG1940 | Sugar kinase of the NBD/HSP70 family, may contain an N-terminal HTH domain | Transcription [K] | 1.52 |
| COG1100 | GTPase SAR1 family domain | General function prediction only [R] | 0.76 |
| COG1430 | Uncharacterized conserved membrane protein, UPF0127 family | Function unknown [S] | 0.76 |
| COG1586 | S-adenosylmethionine decarboxylase | Amino acid transport and metabolism [E] | 0.76 |
| COG1874 | Beta-galactosidase GanA | Carbohydrate transport and metabolism [G] | 0.76 |
| COG2161 | Antitoxin component YafN of the YafNO toxin-antitoxin module, PHD/YefM family | Defense mechanisms [V] | 0.76 |
| COG2801 | Transposase InsO and inactivated derivatives | Mobilome: prophages, transposons [X] | 0.76 |
| COG2826 | Transposase and inactivated derivatives, IS30 family | Mobilome: prophages, transposons [X] | 0.76 |
| COG3316 | Transposase (or an inactivated derivative), DDE domain | Mobilome: prophages, transposons [X] | 0.76 |
| COG3386 | Sugar lactone lactonase YvrE | Carbohydrate transport and metabolism [G] | 0.76 |
| COG3391 | DNA-binding beta-propeller fold protein YncE | General function prediction only [R] | 0.76 |
| COG4118 | Antitoxin component of toxin-antitoxin stability system, DNA-binding transcriptional repressor | Defense mechanisms [V] | 0.76 |
| COG4584 | Transposase | Mobilome: prophages, transposons [X] | 0.76 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 83.33 % |
| Unclassified | root | N/A | 16.67 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2162886007|SwRhRL2b_contig_1355445 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2096 | Open in IMG/M |
| 2199352024|deeps__Contig_86627 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1544 | Open in IMG/M |
| 3300000156|NODE_c0377904 | Not Available | 717 | Open in IMG/M |
| 3300000363|ICChiseqgaiiFebDRAFT_11024361 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1321 | Open in IMG/M |
| 3300000364|INPhiseqgaiiFebDRAFT_100779973 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2168 | Open in IMG/M |
| 3300000364|INPhiseqgaiiFebDRAFT_100780683 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1483 | Open in IMG/M |
| 3300000364|INPhiseqgaiiFebDRAFT_100781241 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 846 | Open in IMG/M |
| 3300001213|JGIcombinedJ13530_101325652 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 659 | Open in IMG/M |
| 3300001471|JGI12712J15308_10015966 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1992 | Open in IMG/M |
| 3300005537|Ga0070730_10016798 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 5794 | Open in IMG/M |
| 3300005540|Ga0066697_10000194 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 18344 | Open in IMG/M |
| 3300005542|Ga0070732_10007150 | All Organisms → cellular organisms → Bacteria | 6075 | Open in IMG/M |
| 3300005542|Ga0070732_10184338 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1246 | Open in IMG/M |
| 3300005543|Ga0070672_100307028 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1346 | Open in IMG/M |
| 3300005548|Ga0070665_101790445 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 621 | Open in IMG/M |
| 3300005552|Ga0066701_10852893 | Not Available | 541 | Open in IMG/M |
| 3300005555|Ga0066692_10000871 | All Organisms → cellular organisms → Bacteria | 11167 | Open in IMG/M |
| 3300005555|Ga0066692_10084538 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1850 | Open in IMG/M |
| 3300005556|Ga0066707_10656069 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_40CM_2_60_7 | 663 | Open in IMG/M |
| 3300005563|Ga0068855_100191483 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2307 | Open in IMG/M |
| 3300005576|Ga0066708_10343363 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 958 | Open in IMG/M |
| 3300005586|Ga0066691_10138694 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1392 | Open in IMG/M |
| 3300005617|Ga0068859_102213250 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 607 | Open in IMG/M |
| 3300005844|Ga0068862_102027879 | All Organisms → cellular organisms → Bacteria | 586 | Open in IMG/M |
| 3300006028|Ga0070717_10454665 | All Organisms → cellular organisms → Bacteria | 1154 | Open in IMG/M |
| 3300006028|Ga0070717_10940856 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 787 | Open in IMG/M |
| 3300006806|Ga0079220_10447969 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 862 | Open in IMG/M |
| 3300006806|Ga0079220_10717460 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 738 | Open in IMG/M |
| 3300006852|Ga0075433_10144722 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2113 | Open in IMG/M |
| 3300006852|Ga0075433_10657918 | All Organisms → cellular organisms → Bacteria | 918 | Open in IMG/M |
| 3300006852|Ga0075433_11518003 | Not Available | 578 | Open in IMG/M |
| 3300006854|Ga0075425_102493525 | Not Available | 573 | Open in IMG/M |
| 3300006871|Ga0075434_100513912 | All Organisms → cellular organisms → Bacteria | 1218 | Open in IMG/M |
| 3300007258|Ga0099793_10005797 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus | 4496 | Open in IMG/M |
| 3300007788|Ga0099795_10109758 | Not Available | 1092 | Open in IMG/M |
| 3300009012|Ga0066710_100459325 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1911 | Open in IMG/M |
| 3300009038|Ga0099829_10135113 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1956 | Open in IMG/M |
| 3300009088|Ga0099830_10202266 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1555 | Open in IMG/M |
| 3300009089|Ga0099828_10010777 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 6804 | Open in IMG/M |
| 3300009090|Ga0099827_10079386 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2557 | Open in IMG/M |
| 3300009094|Ga0111539_10602697 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1279 | Open in IMG/M |
| 3300009162|Ga0075423_11168034 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 821 | Open in IMG/M |
| 3300009792|Ga0126374_10706808 | Not Available | 759 | Open in IMG/M |
| 3300010043|Ga0126380_10093273 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1784 | Open in IMG/M |
| 3300010043|Ga0126380_12111758 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Terriglobales bacterium | 518 | Open in IMG/M |
| 3300010046|Ga0126384_10728340 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 881 | Open in IMG/M |
| 3300010047|Ga0126382_12415872 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 511 | Open in IMG/M |
| 3300010320|Ga0134109_10414691 | Not Available | 541 | Open in IMG/M |
| 3300010358|Ga0126370_10090606 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2086 | Open in IMG/M |
| 3300010359|Ga0126376_10951340 | Not Available | 854 | Open in IMG/M |
| 3300010360|Ga0126372_12876072 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 533 | Open in IMG/M |
| 3300010360|Ga0126372_13317550 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 501 | Open in IMG/M |
| 3300010376|Ga0126381_104653640 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 529 | Open in IMG/M |
| 3300010401|Ga0134121_10246645 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1561 | Open in IMG/M |
| 3300011270|Ga0137391_10010394 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 7416 | Open in IMG/M |
| 3300011442|Ga0137437_1084838 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1083 | Open in IMG/M |
| 3300012200|Ga0137382_11006743 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 598 | Open in IMG/M |
| 3300012202|Ga0137363_10003409 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 9652 | Open in IMG/M |
| 3300012202|Ga0137363_10006798 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 7136 | Open in IMG/M |
| 3300012202|Ga0137363_10380184 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1173 | Open in IMG/M |
| 3300012202|Ga0137363_10809822 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 794 | Open in IMG/M |
| 3300012203|Ga0137399_10518333 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1000 | Open in IMG/M |
| 3300012205|Ga0137362_10036828 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 3915 | Open in IMG/M |
| 3300012205|Ga0137362_10181224 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1810 | Open in IMG/M |
| 3300012205|Ga0137362_10420043 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium | 1158 | Open in IMG/M |
| 3300012206|Ga0137380_10025274 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 5471 | Open in IMG/M |
| 3300012206|Ga0137380_10064131 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 3362 | Open in IMG/M |
| 3300012206|Ga0137380_10173307 | All Organisms → cellular organisms → Bacteria | 1964 | Open in IMG/M |
| 3300012212|Ga0150985_102613628 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 520 | Open in IMG/M |
| 3300012212|Ga0150985_117065437 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 835 | Open in IMG/M |
| 3300012363|Ga0137390_10307276 | Not Available | 1568 | Open in IMG/M |
| 3300012484|Ga0157333_1010359 | Not Available | 683 | Open in IMG/M |
| 3300012683|Ga0137398_10098138 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1838 | Open in IMG/M |
| 3300012931|Ga0153915_10378033 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_40CM_2_60_7 | 1599 | Open in IMG/M |
| 3300012948|Ga0126375_10769444 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 758 | Open in IMG/M |
| 3300012958|Ga0164299_11454484 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_40CM_2_60_7 | 532 | Open in IMG/M |
| 3300012986|Ga0164304_10902978 | Not Available | 691 | Open in IMG/M |
| 3300014326|Ga0157380_10351274 | All Organisms → cellular organisms → Bacteria | 1380 | Open in IMG/M |
| 3300015242|Ga0137412_10736625 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 730 | Open in IMG/M |
| 3300015371|Ga0132258_11007592 | All Organisms → cellular organisms → Bacteria | 2105 | Open in IMG/M |
| 3300015372|Ga0132256_100373558 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1524 | Open in IMG/M |
| 3300015374|Ga0132255_104394745 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 598 | Open in IMG/M |
| 3300018081|Ga0184625_10636026 | Not Available | 519 | Open in IMG/M |
| 3300018433|Ga0066667_10332324 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1199 | Open in IMG/M |
| 3300018468|Ga0066662_10021500 | All Organisms → cellular organisms → Bacteria | 3632 | Open in IMG/M |
| 3300018468|Ga0066662_11079020 | Not Available | 801 | Open in IMG/M |
| 3300020170|Ga0179594_10041663 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1518 | Open in IMG/M |
| 3300020170|Ga0179594_10343098 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_40CM_2_60_7 | 566 | Open in IMG/M |
| 3300021086|Ga0179596_10300950 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_40CM_2_60_7 | 800 | Open in IMG/M |
| 3300022756|Ga0222622_10743360 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 715 | Open in IMG/M |
| 3300024179|Ga0247695_1002819 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2528 | Open in IMG/M |
| 3300024288|Ga0179589_10205654 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 862 | Open in IMG/M |
| 3300025457|Ga0208850_1029326 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 952 | Open in IMG/M |
| 3300025893|Ga0207682_10197232 | Not Available | 924 | Open in IMG/M |
| 3300025911|Ga0207654_11016621 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 603 | Open in IMG/M |
| 3300025918|Ga0207662_10183483 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1347 | Open in IMG/M |
| 3300025922|Ga0207646_10171944 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1956 | Open in IMG/M |
| 3300025922|Ga0207646_10490184 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1108 | Open in IMG/M |
| 3300025928|Ga0207700_11954119 | Not Available | 513 | Open in IMG/M |
| 3300025939|Ga0207665_10612980 | All Organisms → cellular organisms → Bacteria | 851 | Open in IMG/M |
| 3300025941|Ga0207711_10583991 | Not Available | 1042 | Open in IMG/M |
| 3300026296|Ga0209235_1034454 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_40CM_2_60_7 | 2581 | Open in IMG/M |
| 3300026490|Ga0257153_1036184 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira → unclassified Nitrospira → Nitrospira sp. | 1019 | Open in IMG/M |
| 3300027512|Ga0209179_1038784 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 998 | Open in IMG/M |
| 3300027643|Ga0209076_1206809 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_40CM_2_60_7 | 537 | Open in IMG/M |
| 3300027671|Ga0209588_1045432 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1421 | Open in IMG/M |
| 3300027846|Ga0209180_10013836 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 4209 | Open in IMG/M |
| 3300027846|Ga0209180_10014004 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 4183 | Open in IMG/M |
| 3300027857|Ga0209166_10015692 | All Organisms → cellular organisms → Bacteria | 4797 | Open in IMG/M |
| 3300027875|Ga0209283_10015673 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 4575 | Open in IMG/M |
| 3300027907|Ga0207428_10437700 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 954 | Open in IMG/M |
| 3300027908|Ga0209006_10004682 | All Organisms → cellular organisms → Bacteria | 12390 | Open in IMG/M |
| 3300028380|Ga0268265_10726549 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 962 | Open in IMG/M |
| 3300028536|Ga0137415_10008732 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 10050 | Open in IMG/M |
| 3300031057|Ga0170834_112218996 | Not Available | 786 | Open in IMG/M |
| 3300031231|Ga0170824_110706773 | Not Available | 733 | Open in IMG/M |
| 3300031716|Ga0310813_10376609 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1216 | Open in IMG/M |
| 3300031740|Ga0307468_101623484 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 605 | Open in IMG/M |
| 3300031754|Ga0307475_10008370 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 6760 | Open in IMG/M |
| 3300031754|Ga0307475_10027464 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 4084 | Open in IMG/M |
| 3300031754|Ga0307475_10267918 | Not Available | 1370 | Open in IMG/M |
| 3300031962|Ga0307479_11159668 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_40CM_2_60_7 | 737 | Open in IMG/M |
| 3300032174|Ga0307470_10004613 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 5330 | Open in IMG/M |
| 3300032174|Ga0307470_10214570 | Not Available | 1242 | Open in IMG/M |
| 3300032180|Ga0307471_100005735 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 7802 | Open in IMG/M |
| 3300032180|Ga0307471_100092178 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2714 | Open in IMG/M |
| 3300032180|Ga0307471_101755540 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 773 | Open in IMG/M |
| 3300032180|Ga0307471_102842281 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 615 | Open in IMG/M |
| 3300033412|Ga0310810_10001918 | All Organisms → cellular organisms → Bacteria | 22086 | Open in IMG/M |
| 3300033475|Ga0310811_10468281 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1338 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 25.00% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 9.09% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 8.33% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 8.33% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 6.06% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 4.55% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 4.55% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 3.79% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 3.03% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.27% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 2.27% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.52% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.52% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 1.52% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.52% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 1.52% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 1.52% |
| Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 0.76% |
| Wetland | Environmental → Aquatic → Marine → Wetlands → Sediment → Wetland | 0.76% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 0.76% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.76% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.76% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.76% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.76% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.76% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 0.76% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.76% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.76% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.76% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.76% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.76% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.76% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.76% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.76% |
| Sugar Cane Bagasse Incubating Bioreactor | Engineered → Solid Waste → Grass → Composting → Bioreactor → Sugar Cane Bagasse Incubating Bioreactor | 0.76% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 | Host-Associated | Open in IMG/M |
| 2199352024 | Bare-fallow DEEP SOIL | Environmental | Open in IMG/M |
| 3300000156 | Sugar cane bagasse incubating bioreactor microbial communities from Sao Carlos, Brazil, that are aerobic and semianaerobic | Engineered | Open in IMG/M |
| 3300000363 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001213 | Combined assembly of wetland microbial communities from Twitchell Island in the Sacramento Delta (Jan 2013 JGI Velvet Assembly) | Environmental | Open in IMG/M |
| 3300001471 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 | Environmental | Open in IMG/M |
| 3300005537 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 | Environmental | Open in IMG/M |
| 3300005540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 | Environmental | Open in IMG/M |
| 3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
| 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 | Environmental | Open in IMG/M |
| 3300005555 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 | Environmental | Open in IMG/M |
| 3300005556 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 | Environmental | Open in IMG/M |
| 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Host-Associated | Open in IMG/M |
| 3300005576 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 | Environmental | Open in IMG/M |
| 3300005586 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 | Environmental | Open in IMG/M |
| 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
| 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Host-Associated | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
| 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010320 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_11112015 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300011442 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT138_2 | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012484 | Unplanted soil (control) microbial communities from North Carolina - M.Soil.2.old.190510 | Environmental | Open in IMG/M |
| 3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
| 3300012931 | Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 3 metaG | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012958 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG | Environmental | Open in IMG/M |
| 3300012986 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG | Environmental | Open in IMG/M |
| 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Host-Associated | Open in IMG/M |
| 3300015242 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300018081 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b1 | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300020170 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300021086 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300022756 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1 | Environmental | Open in IMG/M |
| 3300024179 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK36 | Environmental | Open in IMG/M |
| 3300024288 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300025457 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-2 shallow-092012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026296 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026490 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-10-A | Environmental | Open in IMG/M |
| 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027643 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027857 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027907 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027908 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300031057 | Oak Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
| 3300031716 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3 | Environmental | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300033412 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NC | Environmental | Open in IMG/M |
| 3300033475 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YC | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| SwRhRL2b_0161.00003410 | 2162886007 | Switchgrass Rhizosphere | MDPTLIRVVSGVLFVVIVFIILMRRKGMATKRKRI |
| deeps_01473560 | 2199352024 | Soil | MNPTTIRIIAGVLFVIFVAIIVWRRKNMASKRKHVL |
| NODE_03779041 | 3300000156 | Sugar Cane Bagasse Incubating Bioreactor | MNPTTIRIIAGVIFVILVVVIVARRKKMAAKRRPLA* |
| ICChiseqgaiiFebDRAFT_110243612 | 3300000363 | Soil | MDPTTIRVVAGVMFVVIVFVILMRRKGMATKRKRI* |
| INPhiseqgaiiFebDRAFT_1007799733 | 3300000364 | Soil | MDPTIIRVASGVLFVVIVFIILMRRKGMATKRKRI* |
| INPhiseqgaiiFebDRAFT_1007806832 | 3300000364 | Soil | MDPTMIRVVSGVLFVAIVFIIISRRKGMASKRKRIS* |
| INPhiseqgaiiFebDRAFT_1007812411 | 3300000364 | Soil | MDPTTIRVIAGVMFVAIVFIIIMRRKGMASKRKRI* |
| JGIcombinedJ13530_1013256522 | 3300001213 | Wetland | MDPTTIRIIGAILFVLAISIIVARRKRMASRRRKIH* |
| JGI12712J15308_100159662 | 3300001471 | Forest Soil | MDPTTIRIIAGILCVVIVIIIIARRKRMASKRKPGP* |
| Ga0070730_100167985 | 3300005537 | Surface Soil | MNPTTVRIIAGVLFVIFVTIIVWRRKNMASKRRHVL* |
| Ga0066697_1000019421 | 3300005540 | Soil | MNPTTIRIIAGILFVVVVFIIVARRKRMASRRKPIP* |
| Ga0070732_100071508 | 3300005542 | Surface Soil | MNPTTIRIIAGVLFVIFVTIIVWRRKNMASKRRHVL* |
| Ga0070732_101843382 | 3300005542 | Surface Soil | MDPTTVRVIAGVLFVVIVFIIIARRKSMAAKRKRVP* |
| Ga0070672_1003070282 | 3300005543 | Miscanthus Rhizosphere | MDPTTIRVISGVLFVVIVFIILARRKGMATKRKRI* |
| Ga0070665_1017904452 | 3300005548 | Switchgrass Rhizosphere | MDPTMIRVISGVLFVVIVFVILARRKGMATKRKRI* |
| Ga0066701_108528932 | 3300005552 | Soil | NASMNPTTIRIIAGILFVVVVFIIVARRKRMASRRKPIP* |
| Ga0066692_1000087110 | 3300005555 | Soil | MNPTTIRIIAGVVFVVIIFIIVARRKRMASNRKRVA* |
| Ga0066692_100845382 | 3300005555 | Soil | MDPITIRIIAGVLFVVIVAIIVWRRKKMASKRKPLP* |
| Ga0066707_106560693 | 3300005556 | Soil | MDPTTIRIIAGVLFVVIVIIIVARRKKMASRRKPGP* |
| Ga0068855_1001914832 | 3300005563 | Corn Rhizosphere | MDPTTIRIIAAILFVIFVSIIVIRRKKMASRRKHVL* |
| Ga0066708_103433632 | 3300005576 | Soil | MNPTTVRIVAAIIFVIVVFIIVARRKSMAARRKPIA* |
| Ga0066691_101386941 | 3300005586 | Soil | MDPTTIRIIAGVLFVEIVIIIVARRKKMASRRKPGP* |
| Ga0068859_1022132502 | 3300005617 | Switchgrass Rhizosphere | MDPTTMVRVVAGVMFVVIVFVIMARRKAMASKRKRIS* |
| Ga0068862_1020278791 | 3300005844 | Switchgrass Rhizosphere | MDPTTIRVISGVLFVVIMFVIIARRKGMATKRKRI* |
| Ga0070717_104546651 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MDPTTVRIIAGVVFVVLVVIIFARRKRMAGKRKPIP* |
| Ga0070717_109408562 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MDLQTKVRIIAGVLAVIFVFVIVMRRKKMASRRKPIA* |
| Ga0079220_104479691 | 3300006806 | Agricultural Soil | MNPTTIRIIAGVVFVILVIIIIMRRKKMASRRKPI |
| Ga0079220_107174601 | 3300006806 | Agricultural Soil | MSPTTIRIIAGVLFVIFVTIIVWRRKNMASKRRHVL* |
| Ga0075433_101447222 | 3300006852 | Populus Rhizosphere | MDPTLIRVVSGVLFVVIVFIILMRRKGMATKRKRI* |
| Ga0075433_106579182 | 3300006852 | Populus Rhizosphere | VIQMDPTTIRVISGILFVVIVFVIFARRKKMATRRKRVP* |
| Ga0075433_115180031 | 3300006852 | Populus Rhizosphere | MDPTTIRFVSGILFVVIVFIIIARRKGMASKRKRIS* |
| Ga0075425_1024935251 | 3300006854 | Populus Rhizosphere | MDSATIVRVIAGALVLLSVMVIVMRRKKMASKRKRIV* |
| Ga0075434_1005139122 | 3300006871 | Populus Rhizosphere | MDPTTIRVISGILFVVIVFVIFARRKKMATRRKRVP* |
| Ga0099793_100057972 | 3300007258 | Vadose Zone Soil | MDPTTIRIIAGVLFVVIVIIIVARRKRMASKRKQVP* |
| Ga0099795_101097581 | 3300007788 | Vadose Zone Soil | MDPTTIRIIAGVLFVVIVFIIVARRKKMASKRKPIP* |
| Ga0066710_1004593252 | 3300009012 | Grasslands Soil | MDPTTIRVISGILFVVIVFVIFARRKKMATRRKRVP |
| Ga0099829_101351133 | 3300009038 | Vadose Zone Soil | MDPTTIRIIAGVLFVVIVIIIVARRKRMASRRKPGP* |
| Ga0099830_102022661 | 3300009088 | Vadose Zone Soil | MDPTTIRIIAGVLFVVIVFIIVVRRKRMASKRKPGP* |
| Ga0099828_100107773 | 3300009089 | Vadose Zone Soil | MDPTTIRIIAGVLFVVIIIIIVARRKRMASRRKPGP* |
| Ga0099827_100793864 | 3300009090 | Vadose Zone Soil | MDATTIRIIAGVLFVVIVIIIVARRKRMASKRKPGP* |
| Ga0111539_106026972 | 3300009094 | Populus Rhizosphere | MDPTIIRVVSGVLFVVIVFVILMRRKGMATKRKRI* |
| Ga0075423_111680342 | 3300009162 | Populus Rhizosphere | MDTPTIIRVIAGALFVLSVFVIIARRKRMAGKRKRIG* |
| Ga0126374_107068081 | 3300009792 | Tropical Forest Soil | MDPTTIRIIAGVMFVVIVAIIIIRRKKMGSKRKPMP* |
| Ga0126380_100932732 | 3300010043 | Tropical Forest Soil | MSPTTIRIIAGVIFVILVVIIIMRRKKMAAKRRPLP* |
| Ga0126380_121117581 | 3300010043 | Tropical Forest Soil | MTPTTIRIIAGIIFVILVFIIIARRKRMASKRRPIP* |
| Ga0126384_107283402 | 3300010046 | Tropical Forest Soil | MIQMTPTTIRIIAGIIFVILVVIIIARRKRMASKRRPIP* |
| Ga0126382_124158722 | 3300010047 | Tropical Forest Soil | MDPTTIRVVSGVLFVVIVFIILMRRKGMATKRKRI* |
| Ga0134109_104146911 | 3300010320 | Grasslands Soil | PTTIRIIAGILFVVVVFIIVARRKRMASRRKPIP* |
| Ga0126370_100906062 | 3300010358 | Tropical Forest Soil | MDPTTVRIIAGVMFVVIVSIIIMRRKRMAGKRKPMP* |
| Ga0126376_109513401 | 3300010359 | Tropical Forest Soil | MDPTTIRIIAGAMFVVIVFIIVARRKRMASKRKSAL* |
| Ga0126372_128760721 | 3300010360 | Tropical Forest Soil | MNPTTIRIIAGVLFVVIVIIIVARRKAMASKRKRF* |
| Ga0126372_133175502 | 3300010360 | Tropical Forest Soil | MNPTTIRIIAGILFVVIVAIIVVRRKKMASKRKPMP* |
| Ga0126381_1046536402 | 3300010376 | Tropical Forest Soil | MIDPTTIRIIAGVIFVILVVIIVMRRKKMAAKRRPLP* |
| Ga0134121_102466452 | 3300010401 | Terrestrial Soil | MDPTIIRVVSGVLFVVIVFIVISRRKGMATKRKRI* |
| Ga0137391_100103941 | 3300011270 | Vadose Zone Soil | MDPTTIRIIAGVLFVVIVFIIVARRKRMASKRKPGP* |
| Ga0137437_10848382 | 3300011442 | Soil | MDPTVIRVISGVVFVVIVFIIITRRKGMAAKRKRI* |
| Ga0137382_110067432 | 3300012200 | Vadose Zone Soil | MDPTMVRIIAGVVFLVVVAIIVVRRKKMASKRKPGL* |
| Ga0137363_100034096 | 3300012202 | Vadose Zone Soil | MDPTTIRIIAGVLFVVVIIIIVARRKKMASRRKPGP* |
| Ga0137363_100067982 | 3300012202 | Vadose Zone Soil | MDPITIRIIAGVLFVAIVIIIVVRRKKMASRRKPGP* |
| Ga0137363_103801841 | 3300012202 | Vadose Zone Soil | MDPTMVRIIAGLVFLVVVVIIVMRRKKMASKRKPGP* |
| Ga0137363_108098222 | 3300012202 | Vadose Zone Soil | MDPTTIRIIAGILFVVIVIIIVARRKKMASRRKPGP* |
| Ga0137399_105183331 | 3300012203 | Vadose Zone Soil | GGVASMDPTTIRIIAGVLFVVIVFIIVARRKKMASKRKPIP* |
| Ga0137362_100368282 | 3300012205 | Vadose Zone Soil | MDPTTIRVIAGVVFVVLVFIIIARRKSMAAKRKRVP* |
| Ga0137362_101812242 | 3300012205 | Vadose Zone Soil | MNATMIRIVAGVVFVVILFVIVARRKRMASRRKRVM* |
| Ga0137362_104200431 | 3300012205 | Vadose Zone Soil | PTTIRIIAGVLFVVIVIIIVARRKKMASRRKPGP* |
| Ga0137380_100252742 | 3300012206 | Vadose Zone Soil | MNPITIRIIAGVLFVIFVIIIVWRRKNMASKRRHVL* |
| Ga0137380_100641312 | 3300012206 | Vadose Zone Soil | MNPTTIRIIAGVLFVVIVIIIVARRKRMASKRKPLP* |
| Ga0137380_101733072 | 3300012206 | Vadose Zone Soil | MDPTMIRVVSGVLFVVIVFIIISRRKGMASKRKRIS* |
| Ga0150985_1026136282 | 3300012212 | Avena Fatua Rhizosphere | MNPNMIRIIAAVLFVVTVFIIVARRNKLAAKRKRIT* |
| Ga0150985_1170654371 | 3300012212 | Avena Fatua Rhizosphere | MDTATMIRVVAGALFVLSVFVIVARRKKMASKRKRIG* |
| Ga0137390_103072761 | 3300012363 | Vadose Zone Soil | PNTIRIAAGVIFVILVFIIIMRRKKMASKRKRVP* |
| Ga0157333_10103592 | 3300012484 | Soil | MDPTTIRVISGVLFVVIVFVILARRKGMATKRKRI* |
| Ga0137398_100981381 | 3300012683 | Vadose Zone Soil | MDPTTIRIVAGVLFVVIVFIIVARRKKMASKRKPIP* |
| Ga0153915_103780333 | 3300012931 | Freshwater Wetlands | MNPTTIRIIAGVLFVIFVTIIVWRRKNMASKRKHVL* |
| Ga0126375_107694442 | 3300012948 | Tropical Forest Soil | MDPTTIRVVSGVIFVVLVFFIIARRKGMATKRKRIG* |
| Ga0164299_114544841 | 3300012958 | Soil | MNPTTIRIIAGVLFVIIVTIIVWRRKNMASKRKHVL* |
| Ga0164304_109029781 | 3300012986 | Soil | MDPTTIRIMAGVMFVVIIFLITLRRKKMAAKRKPIP |
| Ga0157380_103512743 | 3300014326 | Switchgrass Rhizosphere | SMDPTTIRVISGVLFVVIVFIILARRKGMATKRKRI* |
| Ga0137412_107366252 | 3300015242 | Vadose Zone Soil | SKEKFSMNPTTIRIIAGVLFVIFVTIIVWRRKNMASKRRHVL* |
| Ga0132258_110075923 | 3300015371 | Arabidopsis Rhizosphere | MDPNTIRIIAGVMFVVIIFIITLRRKKMAAKRKPIPGQG* |
| Ga0132256_1003735582 | 3300015372 | Arabidopsis Rhizosphere | MDPTIIRVISGVLFVVIVFIILARRKGMATKRKRI* |
| Ga0132255_1043947452 | 3300015374 | Arabidopsis Rhizosphere | MDPTTIRVISGALFVVIVFVIIMRRKGMATKRKRI* |
| Ga0184625_106360261 | 3300018081 | Groundwater Sediment | MDPTTMVRVVSGLMFVVIVFVIMARRKAMASKRKRFS |
| Ga0066667_103323242 | 3300018433 | Grasslands Soil | MNPTTIRIIAGILFVVVVFIIVARRKRMASRRKPIP |
| Ga0066662_100215001 | 3300018468 | Grasslands Soil | MNPTTIRIIAGVVFVVIIFIIVARRKRMASNRKRVA |
| Ga0066662_110790201 | 3300018468 | Grasslands Soil | MNPTTVRIVAAIIFVIVVFIIVARRKSMAARRKPIA |
| Ga0179594_100416632 | 3300020170 | Vadose Zone Soil | MDPITIRIIAGVLFVAIVIIIVVRRKKMASRRKPGP |
| Ga0179594_103430982 | 3300020170 | Vadose Zone Soil | MDPTTIRIIAGVLFVVIVIIIVARRKKMASRRKPGP |
| Ga0210403_105076722 | 3300020580 | Soil | MDPTIVRLVAGVIFVVLVFIIIARRKSMAAKRKHV |
| Ga0179596_103009501 | 3300021086 | Vadose Zone Soil | MDPTTIRIIAGVLFVVIVIIIVARRKRMASKRKQVP |
| Ga0222622_107433602 | 3300022756 | Groundwater Sediment | MDPTMIRVVSGVLFVVIVFIIISRRKGMAAKRKRIS |
| Ga0247695_10028193 | 3300024179 | Soil | MNPTAIRIVAGILFVVVLVIIVARRKRMASKRKPGP |
| Ga0179589_102056541 | 3300024288 | Vadose Zone Soil | MDPTTIRIIAGVLFVVIVFIIVARRKKMASKRKPIP |
| Ga0208850_10293262 | 3300025457 | Arctic Peat Soil | MDTTTIRIIAGVLFVVIVFIIVARRKKMSSRRKPL |
| Ga0207682_101972321 | 3300025893 | Miscanthus Rhizosphere | MDPTMIRVISGVLFVVIVFVILARRKGMATKRKRI |
| Ga0207654_110166211 | 3300025911 | Corn Rhizosphere | MDPTTIRIIAAILFVIFVSIIVIRRKKMASRRKHVL |
| Ga0207662_101834831 | 3300025918 | Switchgrass Rhizosphere | MDPTTIRVISGVLFVVIVFIILARRKGMATKRKRI |
| Ga0207646_101719443 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MDPTTIRVVSGVLFVVIVFIIMARRKGMASKRKRIS |
| Ga0207646_104901842 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MDTATMIRVIAGALFVLSVLVIVARRKKMASKRKRIG |
| Ga0207700_119541191 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | ASMDPTTVRVIAGVLFVVIVFIIIARRKSMAAKRKRVP |
| Ga0207665_106129802 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | MDPTTIRIIAGVAFVLIILIIMMRRKKMAAKRKPIP |
| Ga0207711_105839912 | 3300025941 | Switchgrass Rhizosphere | MDPTTMVRVVAGVMFVVIVFVIMARRKAMASKRKRIS |
| Ga0209235_10344542 | 3300026296 | Grasslands Soil | MDPITIRIIAGVLFVVIVAIIVWRRKKMASKRKPLP |
| Ga0257153_10361842 | 3300026490 | Soil | MDSTTIRIIAGILFVVIVFIIVARRKKMASKRKPGP |
| Ga0209179_10387841 | 3300027512 | Vadose Zone Soil | IKGGVASMDPTTIRIIAGVLFVVIVFIIVARRKKMASKRKPIP |
| Ga0209076_12068092 | 3300027643 | Vadose Zone Soil | MDPTTIRIIAGVLFVVIIIIIVARRKKMASRRKPGP |
| Ga0209588_10454323 | 3300027671 | Vadose Zone Soil | MDPTTIRIIAGVLFIVIVIIIVARRKKMASRRKPGP |
| Ga0209180_100138361 | 3300027846 | Vadose Zone Soil | MDATTIRIIAGVLFVVIVIIIVARRKRMASKRKPGP |
| Ga0209180_100140043 | 3300027846 | Vadose Zone Soil | MDPTTIRIIAGVLFVVIIIIIVARRKRMASRRKPGP |
| Ga0209166_100156923 | 3300027857 | Surface Soil | MSPTTIRIIAGVIFVILVVIIIARRKKMASKRRPMA |
| Ga0209283_100156734 | 3300027875 | Vadose Zone Soil | MDPTTIRIIAGVLFVVIVIIIVARRKRMASRRKPGP |
| Ga0207428_104377002 | 3300027907 | Populus Rhizosphere | MDPTLIRVVSGVLFVVIVFVILMRRKGMATKRKRI |
| Ga0209006_100046826 | 3300027908 | Forest Soil | MDPTTIRIIAGILCVVIVIIIIARRKRMASKRKPGP |
| Ga0268265_107265491 | 3300028380 | Switchgrass Rhizosphere | MDPTTIRVISGVLFVVIMFVIIARRKGMATKRKRI |
| Ga0137415_100087327 | 3300028536 | Vadose Zone Soil | MDPTTIRVIAGVVFVVLVFIIIARRKSMAAKRKRVP |
| Ga0170834_1122189961 | 3300031057 | Forest Soil | MNPTAIRIIAGILFVVVLVIIVARRKRMASKRKPGP |
| Ga0170824_1107067732 | 3300031231 | Forest Soil | SMDPTTVRVIAGVVFVVLVFIIIARRKSMAAKRKRVP |
| Ga0307476_102582702 | 3300031715 | Hardwood Forest Soil | MDPTTVRIVAGVIFVVLVFIIIARRKSMAAKRKRVP |
| Ga0310813_103766092 | 3300031716 | Soil | MSQDMIRIIAGVLFVVIVVVIVMRRKSMAGKRKQI |
| Ga0307468_1016234842 | 3300031740 | Hardwood Forest Soil | MDPTTIRVIAGVIFVVIVFVIFARRQKMATKRKRVT |
| Ga0307475_100083705 | 3300031754 | Hardwood Forest Soil | MDPTTIRIIAGVLFVVVVIIIVARRKRMASRRKPGP |
| Ga0307475_100274641 | 3300031754 | Hardwood Forest Soil | MNPTIIRIIAGVLFVVIVFIIAARRKRMASKRKSF |
| Ga0307475_102679182 | 3300031754 | Hardwood Forest Soil | MNPTTVRIVAAIIFVIMLFIIVARRKRMSARRKPIV |
| Ga0307479_111596681 | 3300031962 | Hardwood Forest Soil | MDPTTIRIIAGVLFVVIVIIIVARRKKMASKRKPGP |
| Ga0307470_100046134 | 3300032174 | Hardwood Forest Soil | MSPTTVRIIAGVLAVILVIIIFARRKRMASKRRALP |
| Ga0307470_102145702 | 3300032174 | Hardwood Forest Soil | MNPTIIRIVAGVLFIIIVSIIVMRRKKMASRRKRIA |
| Ga0307471_1000057352 | 3300032180 | Hardwood Forest Soil | MDPTTIRIIAGVAFVLIILMIMLRRKKMAAKRKPIP |
| Ga0307471_1000921783 | 3300032180 | Hardwood Forest Soil | MDPTTIRIIAGVLFVVIIIIIVARRKRMASKRKPIP |
| Ga0307471_1017555402 | 3300032180 | Hardwood Forest Soil | MDPTIIRVVSGVLFVVIVFVILMRRKGMATKRKRI |
| Ga0307471_1028422811 | 3300032180 | Hardwood Forest Soil | MDPTMIRVISGVLFVVIVFVIMARRKGMASKRKRI |
| Ga0310810_100019185 | 3300033412 | Soil | MDPTTIRVVSGVLFVVIVFIILARRKGMATKRKRI |
| Ga0310811_104682811 | 3300033475 | Soil | MNPTTIRIIAGVLFVIFVTIIVWRRKNMASKRKHVL |
| ⦗Top⦘ |