Metagenome Family F061386

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences

Select file to download:
Download

Overview

Basic Information
Family ID	F061386
Family Type	Metagenome
Number of Sequences	132
Average Sequence Length	36 residues
Representative Sequence	MDPTTIRIIAGVLFVVIVFIIVARRKKMASKRKPIP
Number of Associated Samples	104
Number of Associated Scaffolds	132

Quality Assessment
Transcriptomic Evidence	No
Most common taxonomic group	Bacteria
% of genes with valid RBS motifs	90.77 %
% of genes near scaffold ends (potentially truncated)	12.88 %
% of genes from short scaffolds (< 2000 bps)	72.73 %
Associated GOLD sequencing projects	95
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.51

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign

Most Common Taxonomy
Group	Bacteria (83.333 % of family members)
NCBI Taxonomy ID	2
Taxonomy	All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (25.000 % of family members)
Environment Ontology (ENVO)	Unclassified (36.364 % of family members)
Earth Microbiome Project Ontology (EMPO)	Host-associated → Plant → Plant rhizosphere (49.242 % of family members)

Multiple Sequence Alignments

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Select alignment to view:

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification:	Transmembrane (alpha-helical)	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 45.31% β-sheet: 0.00% Coil/Unstructured: 54.69%
Feature Viewer

Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.51
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.51
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

Gene Neighborhood

Neighboring Pfam domains

Pfam ID	Name	% Frequency in 132 Family Scaffolds
PF03544	TonB_C	16.67
PF07811	TadE	1.52
PF13400	Tad	1.52
PF00482	T2SSF	1.52
PF02518	HATPase_c	1.52
PF12840	HTH_20	1.52
PF00675	Peptidase_M16	0.76
PF02653	BPD_transp_2	0.76
PF02675	AdoMet_dc	0.76
PF00480	ROK	0.76
PF10282	Lactonase	0.76
PF13683	rve_3	0.76
PF13147	Obsolete Pfam Family	0.76
PF08241	Methyltransf_11	0.76
PF02643	DUF192	0.76
PF16694	Cytochrome_P460	0.76
PF01527	HTH_Tnp_1	0.76
PF08533	Glyco_hydro_42C	0.76
PF08450	SGL	0.76
PF08388	GIIM	0.76
PF00665	rve	0.76
PF07992	Pyr_redox_2	0.76
PF03710	GlnE	0.76
PF00025	Arf	0.76
PF13432	TPR_16	0.76
PF13418	Kelch_4	0.76
PF00704	Glyco_hydro_18	0.76
PF02604	PhdYeFM_antitox	0.76
PF00072	Response_reg	0.76

COG ID	Name	Functional Category	% Frequency in 132 Family Scaffolds
COG0810	Periplasmic protein TonB, links inner and outer membranes	Cell wall/membrane/envelope biogenesis [M]	16.67
COG1391	Glutamine synthetase adenylyltransferase	Posttranslational modification, protein turnover, chaperones [O]	1.52
COG1940	Sugar kinase of the NBD/HSP70 family, may contain an N-terminal HTH domain	Transcription [K]	1.52
COG1100	GTPase SAR1 family domain	General function prediction only [R]	0.76
COG1430	Uncharacterized conserved membrane protein, UPF0127 family	Function unknown [S]	0.76
COG1586	S-adenosylmethionine decarboxylase	Amino acid transport and metabolism [E]	0.76
COG1874	Beta-galactosidase GanA	Carbohydrate transport and metabolism [G]	0.76
COG2161	Antitoxin component YafN of the YafNO toxin-antitoxin module, PHD/YefM family	Defense mechanisms [V]	0.76
COG2801	Transposase InsO and inactivated derivatives	Mobilome: prophages, transposons [X]	0.76
COG2826	Transposase and inactivated derivatives, IS30 family	Mobilome: prophages, transposons [X]	0.76
COG3316	Transposase (or an inactivated derivative), DDE domain	Mobilome: prophages, transposons [X]	0.76
COG3386	Sugar lactone lactonase YvrE	Carbohydrate transport and metabolism [G]	0.76
COG3391	DNA-binding beta-propeller fold protein YncE	General function prediction only [R]	0.76
COG4118	Antitoxin component of toxin-antitoxin stability system, DNA-binding transcriptional repressor	Defense mechanisms [V]	0.76
COG4584	Transposase	Mobilome: prophages, transposons [X]	0.76

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
All Organisms	root	All Organisms	83.33 %
Unclassified	root	N/A	16.67 %

Name	Rank	Taxonomy	Distribution
cellular organisms	root	All Organisms → cellular organisms	83.33 %
Unclassified	root	N/A	16.67 %

Name	Rank	Taxonomy	Distribution
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	83.33 %
Unclassified	root	N/A	16.67 %

Name	Rank	Taxonomy	Distribution
Acidobacteria	phylum	All Organisms → cellular organisms → Bacteria → Acidobacteria	68.94 %
Unclassified	root	N/A	16.67 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	2.27 %
Terrabacteria group	clade	All Organisms → cellular organisms → Bacteria → Terrabacteria group	0.76 %
Nitrospirae	phylum	All Organisms → cellular organisms → Bacteria → Nitrospirae	0.76 %

Name	Rank	Taxonomy	Distribution
unclassified Acidobacteria	no rank	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria	37.88 %
Unclassified	root	N/A	16.67 %
Acidobacteriia	class	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia	3.79 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	2.27 %
Nitrospira	class	All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira	0.76 %
Actinobacteria	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	0.76 %

Name	Rank	Taxonomy	Distribution
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	31.82 %
Unclassified	root	N/A	16.67 %
Acidobacteria bacterium 13_1_40CM_2_60_7	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_40CM_2_60_7	6.06 %
Acidobacteriales	order	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales	3.03 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	2.27 %
Bryobacterales	order	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales	0.76 %
Actinomycetia	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	0.76 %
Nitrospirales	order	All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales	0.76 %

Name	Rank	Taxonomy	Distribution
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	31.82 %
Unclassified	root	N/A	16.67 %
Acidobacteria bacterium 13_1_40CM_2_60_7	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_40CM_2_60_7	6.06 %
Acidobacteriaceae	family	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae	2.27 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	2.27 %
Bryobacteraceae	family	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae	0.76 %
unclassified Terriglobales	no rank	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales	0.76 %
Nitrospiraceae	family	All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae	0.76 %
Actinomycetia	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	0.76 %

Name	Rank	Taxonomy	Distribution
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	31.82 %
Unclassified	root	N/A	16.67 %
Acidobacteria bacterium 13_1_40CM_2_60_7	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_40CM_2_60_7	6.06 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	2.27 %
Terriglobales bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Terriglobales bacterium	0.76 %
Nitrospira	genus	All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira	0.76 %
Bryobacter	genus	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter	0.76 %
unclassified Acidobacteriaceae	no rank	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae	0.76 %
Actinomycetia	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	0.76 %

Name	Rank	Taxonomy	Distribution
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	31.82 %
Unclassified	root	N/A	16.67 %
Acidobacteria bacterium 13_1_40CM_2_60_7	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_40CM_2_60_7	6.06 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	2.27 %
unclassified Nitrospira	no rank	All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira → unclassified Nitrospira	0.76 %
Acidobacteriaceae bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium	0.76 %
Bryobacter aggregatus	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus	0.76 %
Terriglobales bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Terriglobales bacterium	0.76 %
Actinomycetia	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	0.76 %

Name	Rank	Taxonomy	Distribution
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	31.82 %
Unclassified	root	N/A	16.67 %
Acidobacteria bacterium 13_1_40CM_2_60_7	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_40CM_2_60_7	6.06 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	2.27 %
Nitrospira sp.	species	All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira → unclassified Nitrospira → Nitrospira sp.	0.76 %
Acidobacteriaceae bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium	0.76 %
Bryobacter aggregatus	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus	0.76 %
Terriglobales bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Terriglobales bacterium	0.76 %
Actinomycetia	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	0.76 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
2162886007\|SwRhRL2b_contig_1355445	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	2096	Open in IMG/M
2199352024\|deeps__Contig_86627	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	1544	Open in IMG/M
3300000156\|NODE_c0377904	Not Available	717	Open in IMG/M
3300000363\|ICChiseqgaiiFebDRAFT_11024361	All Organisms → cellular organisms → Bacteria → Acidobacteria	1321	Open in IMG/M
3300000364\|INPhiseqgaiiFebDRAFT_100779973	All Organisms → cellular organisms → Bacteria → Acidobacteria	2168	Open in IMG/M
3300000364\|INPhiseqgaiiFebDRAFT_100780683	All Organisms → cellular organisms → Bacteria → Acidobacteria	1483	Open in IMG/M
3300000364\|INPhiseqgaiiFebDRAFT_100781241	All Organisms → cellular organisms → Bacteria → Acidobacteria	846	Open in IMG/M
3300001213\|JGIcombinedJ13530_101325652	All Organisms → cellular organisms → Bacteria → Acidobacteria	659	Open in IMG/M
3300001471\|JGI12712J15308_10015966	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	1992	Open in IMG/M
3300005537\|Ga0070730_10016798	All Organisms → cellular organisms → Bacteria → Proteobacteria	5794	Open in IMG/M
3300005540\|Ga0066697_10000194	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	18344	Open in IMG/M
3300005542\|Ga0070732_10007150	All Organisms → cellular organisms → Bacteria	6075	Open in IMG/M
3300005542\|Ga0070732_10184338	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	1246	Open in IMG/M
3300005543\|Ga0070672_100307028	All Organisms → cellular organisms → Bacteria → Acidobacteria	1346	Open in IMG/M
3300005548\|Ga0070665_101790445	All Organisms → cellular organisms → Bacteria → Acidobacteria	621	Open in IMG/M
3300005552\|Ga0066701_10852893	Not Available	541	Open in IMG/M
3300005555\|Ga0066692_10000871	All Organisms → cellular organisms → Bacteria	11167	Open in IMG/M
3300005555\|Ga0066692_10084538	All Organisms → cellular organisms → Bacteria → Proteobacteria	1850	Open in IMG/M
3300005556\|Ga0066707_10656069	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_40CM_2_60_7	663	Open in IMG/M
3300005563\|Ga0068855_100191483	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	2307	Open in IMG/M
3300005576\|Ga0066708_10343363	All Organisms → cellular organisms → Bacteria → Acidobacteria	958	Open in IMG/M
3300005586\|Ga0066691_10138694	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	1392	Open in IMG/M
3300005617\|Ga0068859_102213250	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae	607	Open in IMG/M
3300005844\|Ga0068862_102027879	All Organisms → cellular organisms → Bacteria	586	Open in IMG/M
3300006028\|Ga0070717_10454665	All Organisms → cellular organisms → Bacteria	1154	Open in IMG/M
3300006028\|Ga0070717_10940856	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	787	Open in IMG/M
3300006806\|Ga0079220_10447969	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	862	Open in IMG/M
3300006806\|Ga0079220_10717460	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	738	Open in IMG/M
3300006852\|Ga0075433_10144722	All Organisms → cellular organisms → Bacteria → Acidobacteria	2113	Open in IMG/M
3300006852\|Ga0075433_10657918	All Organisms → cellular organisms → Bacteria	918	Open in IMG/M
3300006852\|Ga0075433_11518003	Not Available	578	Open in IMG/M
3300006854\|Ga0075425_102493525	Not Available	573	Open in IMG/M
3300006871\|Ga0075434_100513912	All Organisms → cellular organisms → Bacteria	1218	Open in IMG/M
3300007258\|Ga0099793_10005797	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus	4496	Open in IMG/M
3300007788\|Ga0099795_10109758	Not Available	1092	Open in IMG/M
3300009012\|Ga0066710_100459325	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	1911	Open in IMG/M
3300009038\|Ga0099829_10135113	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	1956	Open in IMG/M
3300009088\|Ga0099830_10202266	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	1555	Open in IMG/M
3300009089\|Ga0099828_10010777	All Organisms → cellular organisms → Bacteria → Acidobacteria	6804	Open in IMG/M
3300009090\|Ga0099827_10079386	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	2557	Open in IMG/M
3300009094\|Ga0111539_10602697	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	1279	Open in IMG/M
3300009162\|Ga0075423_11168034	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	821	Open in IMG/M
3300009792\|Ga0126374_10706808	Not Available	759	Open in IMG/M
3300010043\|Ga0126380_10093273	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	1784	Open in IMG/M
3300010043\|Ga0126380_12111758	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Terriglobales bacterium	518	Open in IMG/M
3300010046\|Ga0126384_10728340	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	881	Open in IMG/M
3300010047\|Ga0126382_12415872	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	511	Open in IMG/M
3300010320\|Ga0134109_10414691	Not Available	541	Open in IMG/M
3300010358\|Ga0126370_10090606	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	2086	Open in IMG/M
3300010359\|Ga0126376_10951340	Not Available	854	Open in IMG/M
3300010360\|Ga0126372_12876072	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	533	Open in IMG/M
3300010360\|Ga0126372_13317550	All Organisms → cellular organisms → Bacteria → Acidobacteria	501	Open in IMG/M
3300010376\|Ga0126381_104653640	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	529	Open in IMG/M
3300010401\|Ga0134121_10246645	All Organisms → cellular organisms → Bacteria → Acidobacteria	1561	Open in IMG/M
3300011270\|Ga0137391_10010394	All Organisms → cellular organisms → Bacteria → Acidobacteria	7416	Open in IMG/M
3300011442\|Ga0137437_1084838	All Organisms → cellular organisms → Bacteria → Acidobacteria	1083	Open in IMG/M
3300012200\|Ga0137382_11006743	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	598	Open in IMG/M
3300012202\|Ga0137363_10003409	All Organisms → cellular organisms → Bacteria → Acidobacteria	9652	Open in IMG/M
3300012202\|Ga0137363_10006798	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae	7136	Open in IMG/M
3300012202\|Ga0137363_10380184	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	1173	Open in IMG/M
3300012202\|Ga0137363_10809822	All Organisms → cellular organisms → Bacteria → Acidobacteria	794	Open in IMG/M
3300012203\|Ga0137399_10518333	All Organisms → cellular organisms → Bacteria → Acidobacteria	1000	Open in IMG/M
3300012205\|Ga0137362_10036828	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	3915	Open in IMG/M
3300012205\|Ga0137362_10181224	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	1810	Open in IMG/M
3300012205\|Ga0137362_10420043	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium	1158	Open in IMG/M
3300012206\|Ga0137380_10025274	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	5471	Open in IMG/M
3300012206\|Ga0137380_10064131	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	3362	Open in IMG/M
3300012206\|Ga0137380_10173307	All Organisms → cellular organisms → Bacteria	1964	Open in IMG/M
3300012212\|Ga0150985_102613628	All Organisms → cellular organisms → Bacteria → Acidobacteria	520	Open in IMG/M
3300012212\|Ga0150985_117065437	All Organisms → cellular organisms → Bacteria → Acidobacteria	835	Open in IMG/M
3300012363\|Ga0137390_10307276	Not Available	1568	Open in IMG/M
3300012484\|Ga0157333_1010359	Not Available	683	Open in IMG/M
3300012683\|Ga0137398_10098138	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	1838	Open in IMG/M
3300012931\|Ga0153915_10378033	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_40CM_2_60_7	1599	Open in IMG/M
3300012948\|Ga0126375_10769444	All Organisms → cellular organisms → Bacteria → Acidobacteria	758	Open in IMG/M
3300012958\|Ga0164299_11454484	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_40CM_2_60_7	532	Open in IMG/M
3300012986\|Ga0164304_10902978	Not Available	691	Open in IMG/M
3300014326\|Ga0157380_10351274	All Organisms → cellular organisms → Bacteria	1380	Open in IMG/M
3300015242\|Ga0137412_10736625	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	730	Open in IMG/M
3300015371\|Ga0132258_11007592	All Organisms → cellular organisms → Bacteria	2105	Open in IMG/M
3300015372\|Ga0132256_100373558	All Organisms → cellular organisms → Bacteria → Acidobacteria	1524	Open in IMG/M
3300015374\|Ga0132255_104394745	All Organisms → cellular organisms → Bacteria → Acidobacteria	598	Open in IMG/M
3300018081\|Ga0184625_10636026	Not Available	519	Open in IMG/M
3300018433\|Ga0066667_10332324	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	1199	Open in IMG/M
3300018468\|Ga0066662_10021500	All Organisms → cellular organisms → Bacteria	3632	Open in IMG/M
3300018468\|Ga0066662_11079020	Not Available	801	Open in IMG/M
3300020170\|Ga0179594_10041663	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	1518	Open in IMG/M
3300020170\|Ga0179594_10343098	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_40CM_2_60_7	566	Open in IMG/M
3300021086\|Ga0179596_10300950	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_40CM_2_60_7	800	Open in IMG/M
3300022756\|Ga0222622_10743360	All Organisms → cellular organisms → Bacteria → Acidobacteria	715	Open in IMG/M
3300024179\|Ga0247695_1002819	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	2528	Open in IMG/M
3300024288\|Ga0179589_10205654	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	862	Open in IMG/M
3300025457\|Ga0208850_1029326	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	952	Open in IMG/M
3300025893\|Ga0207682_10197232	Not Available	924	Open in IMG/M
3300025911\|Ga0207654_11016621	All Organisms → cellular organisms → Bacteria → Acidobacteria	603	Open in IMG/M
3300025918\|Ga0207662_10183483	All Organisms → cellular organisms → Bacteria → Acidobacteria	1347	Open in IMG/M
3300025922\|Ga0207646_10171944	All Organisms → cellular organisms → Bacteria → Acidobacteria	1956	Open in IMG/M
3300025922\|Ga0207646_10490184	All Organisms → cellular organisms → Bacteria → Acidobacteria	1108	Open in IMG/M
3300025928\|Ga0207700_11954119	Not Available	513	Open in IMG/M
3300025939\|Ga0207665_10612980	All Organisms → cellular organisms → Bacteria	851	Open in IMG/M
3300025941\|Ga0207711_10583991	Not Available	1042	Open in IMG/M
3300026296\|Ga0209235_1034454	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_40CM_2_60_7	2581	Open in IMG/M
3300026490\|Ga0257153_1036184	All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira → unclassified Nitrospira → Nitrospira sp.	1019	Open in IMG/M
3300027512\|Ga0209179_1038784	All Organisms → cellular organisms → Bacteria → Acidobacteria	998	Open in IMG/M
3300027643\|Ga0209076_1206809	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_40CM_2_60_7	537	Open in IMG/M
3300027671\|Ga0209588_1045432	All Organisms → cellular organisms → Bacteria → Acidobacteria	1421	Open in IMG/M
3300027846\|Ga0209180_10013836	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	4209	Open in IMG/M
3300027846\|Ga0209180_10014004	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	4183	Open in IMG/M
3300027857\|Ga0209166_10015692	All Organisms → cellular organisms → Bacteria	4797	Open in IMG/M
3300027875\|Ga0209283_10015673	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	4575	Open in IMG/M
3300027907\|Ga0207428_10437700	All Organisms → cellular organisms → Bacteria → Acidobacteria	954	Open in IMG/M
3300027908\|Ga0209006_10004682	All Organisms → cellular organisms → Bacteria	12390	Open in IMG/M
3300028380\|Ga0268265_10726549	All Organisms → cellular organisms → Bacteria → Acidobacteria	962	Open in IMG/M
3300028536\|Ga0137415_10008732	All Organisms → cellular organisms → Bacteria → Proteobacteria	10050	Open in IMG/M
3300031057\|Ga0170834_112218996	Not Available	786	Open in IMG/M
3300031231\|Ga0170824_110706773	Not Available	733	Open in IMG/M
3300031716\|Ga0310813_10376609	All Organisms → cellular organisms → Bacteria → Acidobacteria	1216	Open in IMG/M
3300031740\|Ga0307468_101623484	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	605	Open in IMG/M
3300031754\|Ga0307475_10008370	All Organisms → cellular organisms → Bacteria → Acidobacteria	6760	Open in IMG/M
3300031754\|Ga0307475_10027464	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	4084	Open in IMG/M
3300031754\|Ga0307475_10267918	Not Available	1370	Open in IMG/M
3300031962\|Ga0307479_11159668	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_40CM_2_60_7	737	Open in IMG/M
3300032174\|Ga0307470_10004613	All Organisms → cellular organisms → Bacteria → Acidobacteria	5330	Open in IMG/M
3300032174\|Ga0307470_10214570	Not Available	1242	Open in IMG/M
3300032180\|Ga0307471_100005735	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	7802	Open in IMG/M
3300032180\|Ga0307471_100092178	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	2714	Open in IMG/M
3300032180\|Ga0307471_101755540	All Organisms → cellular organisms → Bacteria → Acidobacteria	773	Open in IMG/M
3300032180\|Ga0307471_102842281	All Organisms → cellular organisms → Bacteria → Acidobacteria	615	Open in IMG/M
3300033412\|Ga0310810_10001918	All Organisms → cellular organisms → Bacteria	22086	Open in IMG/M
3300033475\|Ga0310811_10468281	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	1338	Open in IMG/M

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:

Habitat	Taxonomy	Distribution
Environmental	Environmental	81.06%
Host-Associated	Host-Associated	18.18%
Engineered	Engineered	0.76%

Habitat	Taxonomy	Distribution
Terrestrial	Environmental → Terrestrial	77.27%
Plants	Host-Associated → Plants	18.18%
Aquatic	Environmental → Aquatic	3.79%
Solid Waste	Engineered → Solid Waste	0.76%

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil	77.27%
Rhizosphere	Host-Associated → Plants → Rhizosphere	11.36%
Rhizoplane	Host-Associated → Plants → Rhizoplane	6.82%
Sediment	Environmental → Aquatic → Sediment	2.27%
Freshwater	Environmental → Aquatic → Freshwater	0.76%
Marine	Environmental → Aquatic → Marine	0.76%
Grass	Engineered → Solid Waste → Grass	0.76%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified	70.45%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	8.33%
Loam	Environmental → Terrestrial → Soil → Loam	6.82%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified	3.79%
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	3.03%
Soil	Host-Associated → Plants → Rhizosphere → Soil	3.03%
Unclassified	Environmental → Aquatic → Sediment → Unclassified	2.27%
Wetlands	Environmental → Aquatic → Freshwater → Wetlands	0.76%
Wetlands	Environmental → Aquatic → Marine → Wetlands	0.76%
Composting	Engineered → Solid Waste → Grass → Composting	0.76%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified → Unclassified	43.18%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil	12.88%
Grasslands	Environmental → Terrestrial → Soil → Unclassified → Grasslands	12.12%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	8.33%
Agricultural Soil	Environmental → Terrestrial → Soil → Loam → Agricultural Soil	5.30%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified	3.79%
Unclassified	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified	3.03%
Unclassified	Host-Associated → Plants → Rhizosphere → Soil → Unclassified	3.03%
Unclassified	Environmental → Aquatic → Sediment → Unclassified → Unclassified	2.27%
Agricultural Land	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land	1.52%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil	1.52%
Unclassified	Environmental → Aquatic → Freshwater → Wetlands → Unclassified	0.76%
Sediment	Environmental → Aquatic → Marine → Wetlands → Sediment	0.76%
Permafrost	Environmental → Terrestrial → Soil → Unclassified → Permafrost	0.76%
Bioreactor	Engineered → Solid Waste → Grass → Composting → Bioreactor	0.76%

Habitat	Taxonomy	Distribution
Vadose Zone Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil	25.00%
Hardwood Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil	9.09%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil	8.33%
Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil	8.33%
Populus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere	6.06%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	4.55%
Corn, Switchgrass And Miscanthus Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere	4.55%
Grasslands Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil	3.79%
Surface Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil	3.03%
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	2.27%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	2.27%
Agricultural Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil	1.52%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil	1.52%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil	1.52%
Arabidopsis Rhizosphere	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere	1.52%
Avena Fatua Rhizosphere	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere	1.52%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere	1.52%
Freshwater Wetlands	Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands	0.76%
Wetland	Environmental → Aquatic → Marine → Wetlands → Sediment → Wetland	0.76%
Soil	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil	0.76%
Groundwater Sediment	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment	0.76%
Groundwater Sediment	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment	0.76%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	0.76%
Terrestrial Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil	0.76%
Grasslands Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil	0.76%
Arctic Peat Soil	Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil	0.76%
Switchgrass Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere	0.76%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Switchgrass Rhizosphere	0.76%
Corn Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere	0.76%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere	0.76%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere	0.76%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere	0.76%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere	0.76%
Arabidopsis Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere	0.76%
Sugar Cane Bagasse Incubating Bioreactor	Engineered → Solid Waste → Grass → Composting → Bioreactor → Sugar Cane Bagasse Incubating Bioreactor	0.76%

Visualization

Powered by ApexCharts

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
2162886007	Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2	Host-Associated	Open in IMG/M
2199352024	Bare-fallow DEEP SOIL	Environmental	Open in IMG/M
3300000156	Sugar cane bagasse incubating bioreactor microbial communities from Sao Carlos, Brazil, that are aerobic and semianaerobic	Engineered	Open in IMG/M
3300000363	Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil	Environmental	Open in IMG/M
3300000364	Soil microbial communities from Great Prairies - Iowa, Native Prairie soil	Environmental	Open in IMG/M
3300001213	Combined assembly of wetland microbial communities from Twitchell Island in the Sacramento Delta (Jan 2013 JGI Velvet Assembly)	Environmental	Open in IMG/M
3300001471	Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2	Environmental	Open in IMG/M
3300005537	Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1	Environmental	Open in IMG/M
3300005540	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146	Environmental	Open in IMG/M
3300005542	Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1	Environmental	Open in IMG/M
3300005543	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG	Host-Associated	Open in IMG/M
3300005548	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG	Host-Associated	Open in IMG/M
3300005552	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150	Environmental	Open in IMG/M
3300005555	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141	Environmental	Open in IMG/M
3300005556	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156	Environmental	Open in IMG/M
3300005563	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2	Host-Associated	Open in IMG/M
3300005576	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157	Environmental	Open in IMG/M
3300005586	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140	Environmental	Open in IMG/M
3300005617	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2	Host-Associated	Open in IMG/M
3300005844	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2	Host-Associated	Open in IMG/M
3300006028	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG	Environmental	Open in IMG/M
3300006806	Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100	Environmental	Open in IMG/M
3300006852	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2	Host-Associated	Open in IMG/M
3300006854	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4	Host-Associated	Open in IMG/M
3300006871	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3	Host-Associated	Open in IMG/M
3300007258	Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3	Environmental	Open in IMG/M
3300007788	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2	Environmental	Open in IMG/M
3300009012	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159	Environmental	Open in IMG/M
3300009038	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG	Environmental	Open in IMG/M
3300009088	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG	Environmental	Open in IMG/M
3300009089	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG	Environmental	Open in IMG/M
3300009090	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG	Environmental	Open in IMG/M
3300009094	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2)	Host-Associated	Open in IMG/M
3300009162	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2	Host-Associated	Open in IMG/M
3300009792	Tropical forest soil microbial communities from Panama - MetaG Plot_12	Environmental	Open in IMG/M
3300010043	Tropical forest soil microbial communities from Panama - MetaG Plot_26	Environmental	Open in IMG/M
3300010046	Tropical forest soil microbial communities from Panama - MetaG Plot_36	Environmental	Open in IMG/M
3300010047	Tropical forest soil microbial communities from Panama - MetaG Plot_30	Environmental	Open in IMG/M
3300010320	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_11112015	Environmental	Open in IMG/M
3300010358	Tropical forest soil microbial communities from Panama - MetaG Plot_3	Environmental	Open in IMG/M
3300010359	Tropical forest soil microbial communities from Panama - MetaG Plot_15	Environmental	Open in IMG/M
3300010360	Tropical forest soil microbial communities from Panama - MetaG Plot_6	Environmental	Open in IMG/M
3300010376	Tropical forest soil microbial communities from Panama - MetaG Plot_28	Environmental	Open in IMG/M
3300010401	Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1	Environmental	Open in IMG/M
3300011270	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG	Environmental	Open in IMG/M
3300011442	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT138_2	Environmental	Open in IMG/M
3300012200	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG	Environmental	Open in IMG/M
3300012202	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG	Environmental	Open in IMG/M
3300012203	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG	Environmental	Open in IMG/M
3300012205	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG	Environmental	Open in IMG/M
3300012206	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG	Environmental	Open in IMG/M
3300012212	Combined assembly of Hopland grassland soil	Host-Associated	Open in IMG/M
3300012363	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG	Environmental	Open in IMG/M
3300012484	Unplanted soil (control) microbial communities from North Carolina - M.Soil.2.old.190510	Environmental	Open in IMG/M
3300012683	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG	Environmental	Open in IMG/M
3300012931	Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 3 metaG	Environmental	Open in IMG/M
3300012948	Tropical forest soil microbial communities from Panama - MetaG Plot_14	Environmental	Open in IMG/M
3300012958	Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG	Environmental	Open in IMG/M
3300012986	Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG	Environmental	Open in IMG/M
3300014326	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG	Host-Associated	Open in IMG/M
3300015242	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Hybrid Assembly)	Environmental	Open in IMG/M
3300015371	Combined assembly of cpr5 and col0 rhizosphere and soil	Host-Associated	Open in IMG/M
3300015372	Soil combined assembly	Host-Associated	Open in IMG/M
3300015374	Col-0 rhizosphere combined assembly	Host-Associated	Open in IMG/M
3300018081	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b1	Environmental	Open in IMG/M
3300018433	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116	Environmental	Open in IMG/M
3300018468	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111	Environmental	Open in IMG/M
3300020170	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad1_1_08_16fungal (Illumina Assembly)	Environmental	Open in IMG/M
3300020580	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M	Environmental	Open in IMG/M
3300021086	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_1_08_16fungal (Illumina Assembly)	Environmental	Open in IMG/M
3300022756	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1	Environmental	Open in IMG/M
3300024179	Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK36	Environmental	Open in IMG/M
3300024288	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal	Environmental	Open in IMG/M
3300025457	Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-2 shallow-092012 (SPAdes)	Environmental	Open in IMG/M
3300025893	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025911	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025918	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes)	Environmental	Open in IMG/M
3300025922	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes)	Environmental	Open in IMG/M
3300025928	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes)	Environmental	Open in IMG/M
3300025939	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes)	Environmental	Open in IMG/M
3300025941	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300026296	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_20cm (SPAdes)	Environmental	Open in IMG/M
3300026490	Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-10-A	Environmental	Open in IMG/M
3300027512	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes)	Environmental	Open in IMG/M
3300027643	Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 (SPAdes)	Environmental	Open in IMG/M
3300027671	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes)	Environmental	Open in IMG/M
3300027846	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes)	Environmental	Open in IMG/M
3300027857	Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 (SPAdes)	Environmental	Open in IMG/M
3300027875	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes)	Environmental	Open in IMG/M
3300027907	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes)	Host-Associated	Open in IMG/M
3300027908	Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes)	Environmental	Open in IMG/M
3300028380	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes)	Host-Associated	Open in IMG/M
3300028536	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly)	Environmental	Open in IMG/M
3300031057	Oak Coassembly Site 11 - Champenoux / Amance forest	Environmental	Open in IMG/M
3300031231	Coassembly Site 11 (all samples) - Champenoux / Amance forest	Environmental	Open in IMG/M
3300031715	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05	Environmental	Open in IMG/M
3300031716	Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3	Environmental	Open in IMG/M
3300031740	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05	Environmental	Open in IMG/M
3300031754	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515	Environmental	Open in IMG/M
3300031962	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515	Environmental	Open in IMG/M
3300032174	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05	Environmental	Open in IMG/M
3300032180	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515	Environmental	Open in IMG/M
3300033412	Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NC	Environmental	Open in IMG/M
3300033475	Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YC	Environmental	Open in IMG/M

Geographical Distribution

Zoom:	Powered by OpenStreetMap

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
SwRhRL2b_0161.00003410	2162886007	Switchgrass Rhizosphere	MDPTLIRVVSGVLFVVIVFIILMRRKGMATKRKRI
deeps_01473560	2199352024	Soil	MNPTTIRIIAGVLFVIFVAIIVWRRKNMASKRKHVL
NODE_03779041	3300000156	Sugar Cane Bagasse Incubating Bioreactor	MNPTTIRIIAGVIFVILVVVIVARRKKMAAKRRPLA*
ICChiseqgaiiFebDRAFT_110243612	3300000363	Soil	MDPTTIRVVAGVMFVVIVFVILMRRKGMATKRKRI*
INPhiseqgaiiFebDRAFT_1007799733	3300000364	Soil	MDPTIIRVASGVLFVVIVFIILMRRKGMATKRKRI*
INPhiseqgaiiFebDRAFT_1007806832	3300000364	Soil	MDPTMIRVVSGVLFVAIVFIIISRRKGMASKRKRIS*
INPhiseqgaiiFebDRAFT_1007812411	3300000364	Soil	MDPTTIRVIAGVMFVAIVFIIIMRRKGMASKRKRI*
JGIcombinedJ13530_1013256522	3300001213	Wetland	MDPTTIRIIGAILFVLAISIIVARRKRMASRRRKIH*
JGI12712J15308_100159662	3300001471	Forest Soil	MDPTTIRIIAGILCVVIVIIIIARRKRMASKRKPGP*
Ga0070730_100167985	3300005537	Surface Soil	MNPTTVRIIAGVLFVIFVTIIVWRRKNMASKRRHVL*
Ga0066697_1000019421	3300005540	Soil	MNPTTIRIIAGILFVVVVFIIVARRKRMASRRKPIP*
Ga0070732_100071508	3300005542	Surface Soil	MNPTTIRIIAGVLFVIFVTIIVWRRKNMASKRRHVL*
Ga0070732_101843382	3300005542	Surface Soil	MDPTTVRVIAGVLFVVIVFIIIARRKSMAAKRKRVP*
Ga0070672_1003070282	3300005543	Miscanthus Rhizosphere	MDPTTIRVISGVLFVVIVFIILARRKGMATKRKRI*
Ga0070665_1017904452	3300005548	Switchgrass Rhizosphere	MDPTMIRVISGVLFVVIVFVILARRKGMATKRKRI*
Ga0066701_108528932	3300005552	Soil	NASMNPTTIRIIAGILFVVVVFIIVARRKRMASRRKPIP*
Ga0066692_1000087110	3300005555	Soil	MNPTTIRIIAGVVFVVIIFIIVARRKRMASNRKRVA*
Ga0066692_100845382	3300005555	Soil	MDPITIRIIAGVLFVVIVAIIVWRRKKMASKRKPLP*
Ga0066707_106560693	3300005556	Soil	MDPTTIRIIAGVLFVVIVIIIVARRKKMASRRKPGP*
Ga0068855_1001914832	3300005563	Corn Rhizosphere	MDPTTIRIIAAILFVIFVSIIVIRRKKMASRRKHVL*
Ga0066708_103433632	3300005576	Soil	MNPTTVRIVAAIIFVIVVFIIVARRKSMAARRKPIA*
Ga0066691_101386941	3300005586	Soil	MDPTTIRIIAGVLFVEIVIIIVARRKKMASRRKPGP*
Ga0068859_1022132502	3300005617	Switchgrass Rhizosphere	MDPTTMVRVVAGVMFVVIVFVIMARRKAMASKRKRIS*
Ga0068862_1020278791	3300005844	Switchgrass Rhizosphere	MDPTTIRVISGVLFVVIMFVIIARRKGMATKRKRI*
Ga0070717_104546651	3300006028	Corn, Switchgrass And Miscanthus Rhizosphere	MDPTTVRIIAGVVFVVLVVIIFARRKRMAGKRKPIP*
Ga0070717_109408562	3300006028	Corn, Switchgrass And Miscanthus Rhizosphere	MDLQTKVRIIAGVLAVIFVFVIVMRRKKMASRRKPIA*
Ga0079220_104479691	3300006806	Agricultural Soil	MNPTTIRIIAGVVFVILVIIIIMRRKKMASRRKPI
Ga0079220_107174601	3300006806	Agricultural Soil	MSPTTIRIIAGVLFVIFVTIIVWRRKNMASKRRHVL*
Ga0075433_101447222	3300006852	Populus Rhizosphere	MDPTLIRVVSGVLFVVIVFIILMRRKGMATKRKRI*
Ga0075433_106579182	3300006852	Populus Rhizosphere	VIQMDPTTIRVISGILFVVIVFVIFARRKKMATRRKRVP*
Ga0075433_115180031	3300006852	Populus Rhizosphere	MDPTTIRFVSGILFVVIVFIIIARRKGMASKRKRIS*
Ga0075425_1024935251	3300006854	Populus Rhizosphere	MDSATIVRVIAGALVLLSVMVIVMRRKKMASKRKRIV*
Ga0075434_1005139122	3300006871	Populus Rhizosphere	MDPTTIRVISGILFVVIVFVIFARRKKMATRRKRVP*
Ga0099793_100057972	3300007258	Vadose Zone Soil	MDPTTIRIIAGVLFVVIVIIIVARRKRMASKRKQVP*
Ga0099795_101097581	3300007788	Vadose Zone Soil	MDPTTIRIIAGVLFVVIVFIIVARRKKMASKRKPIP*
Ga0066710_1004593252	3300009012	Grasslands Soil	MDPTTIRVISGILFVVIVFVIFARRKKMATRRKRVP
Ga0099829_101351133	3300009038	Vadose Zone Soil	MDPTTIRIIAGVLFVVIVIIIVARRKRMASRRKPGP*
Ga0099830_102022661	3300009088	Vadose Zone Soil	MDPTTIRIIAGVLFVVIVFIIVVRRKRMASKRKPGP*
Ga0099828_100107773	3300009089	Vadose Zone Soil	MDPTTIRIIAGVLFVVIIIIIVARRKRMASRRKPGP*
Ga0099827_100793864	3300009090	Vadose Zone Soil	MDATTIRIIAGVLFVVIVIIIVARRKRMASKRKPGP*
Ga0111539_106026972	3300009094	Populus Rhizosphere	MDPTIIRVVSGVLFVVIVFVILMRRKGMATKRKRI*
Ga0075423_111680342	3300009162	Populus Rhizosphere	MDTPTIIRVIAGALFVLSVFVIIARRKRMAGKRKRIG*
Ga0126374_107068081	3300009792	Tropical Forest Soil	MDPTTIRIIAGVMFVVIVAIIIIRRKKMGSKRKPMP*
Ga0126380_100932732	3300010043	Tropical Forest Soil	MSPTTIRIIAGVIFVILVVIIIMRRKKMAAKRRPLP*
Ga0126380_121117581	3300010043	Tropical Forest Soil	MTPTTIRIIAGIIFVILVFIIIARRKRMASKRRPIP*
Ga0126384_107283402	3300010046	Tropical Forest Soil	MIQMTPTTIRIIAGIIFVILVVIIIARRKRMASKRRPIP*
Ga0126382_124158722	3300010047	Tropical Forest Soil	MDPTTIRVVSGVLFVVIVFIILMRRKGMATKRKRI*
Ga0134109_104146911	3300010320	Grasslands Soil	PTTIRIIAGILFVVVVFIIVARRKRMASRRKPIP*
Ga0126370_100906062	3300010358	Tropical Forest Soil	MDPTTVRIIAGVMFVVIVSIIIMRRKRMAGKRKPMP*
Ga0126376_109513401	3300010359	Tropical Forest Soil	MDPTTIRIIAGAMFVVIVFIIVARRKRMASKRKSAL*
Ga0126372_128760721	3300010360	Tropical Forest Soil	MNPTTIRIIAGVLFVVIVIIIVARRKAMASKRKRF*
Ga0126372_133175502	3300010360	Tropical Forest Soil	MNPTTIRIIAGILFVVIVAIIVVRRKKMASKRKPMP*
Ga0126381_1046536402	3300010376	Tropical Forest Soil	MIDPTTIRIIAGVIFVILVVIIVMRRKKMAAKRRPLP*
Ga0134121_102466452	3300010401	Terrestrial Soil	MDPTIIRVVSGVLFVVIVFIVISRRKGMATKRKRI*
Ga0137391_100103941	3300011270	Vadose Zone Soil	MDPTTIRIIAGVLFVVIVFIIVARRKRMASKRKPGP*
Ga0137437_10848382	3300011442	Soil	MDPTVIRVISGVVFVVIVFIIITRRKGMAAKRKRI*
Ga0137382_110067432	3300012200	Vadose Zone Soil	MDPTMVRIIAGVVFLVVVAIIVVRRKKMASKRKPGL*
Ga0137363_100034096	3300012202	Vadose Zone Soil	MDPTTIRIIAGVLFVVVIIIIVARRKKMASRRKPGP*
Ga0137363_100067982	3300012202	Vadose Zone Soil	MDPITIRIIAGVLFVAIVIIIVVRRKKMASRRKPGP*
Ga0137363_103801841	3300012202	Vadose Zone Soil	MDPTMVRIIAGLVFLVVVVIIVMRRKKMASKRKPGP*
Ga0137363_108098222	3300012202	Vadose Zone Soil	MDPTTIRIIAGILFVVIVIIIVARRKKMASRRKPGP*
Ga0137399_105183331	3300012203	Vadose Zone Soil	GGVASMDPTTIRIIAGVLFVVIVFIIVARRKKMASKRKPIP*
Ga0137362_100368282	3300012205	Vadose Zone Soil	MDPTTIRVIAGVVFVVLVFIIIARRKSMAAKRKRVP*
Ga0137362_101812242	3300012205	Vadose Zone Soil	MNATMIRIVAGVVFVVILFVIVARRKRMASRRKRVM*
Ga0137362_104200431	3300012205	Vadose Zone Soil	PTTIRIIAGVLFVVIVIIIVARRKKMASRRKPGP*
Ga0137380_100252742	3300012206	Vadose Zone Soil	MNPITIRIIAGVLFVIFVIIIVWRRKNMASKRRHVL*
Ga0137380_100641312	3300012206	Vadose Zone Soil	MNPTTIRIIAGVLFVVIVIIIVARRKRMASKRKPLP*
Ga0137380_101733072	3300012206	Vadose Zone Soil	MDPTMIRVVSGVLFVVIVFIIISRRKGMASKRKRIS*
Ga0150985_1026136282	3300012212	Avena Fatua Rhizosphere	MNPNMIRIIAAVLFVVTVFIIVARRNKLAAKRKRIT*
Ga0150985_1170654371	3300012212	Avena Fatua Rhizosphere	MDTATMIRVVAGALFVLSVFVIVARRKKMASKRKRIG*
Ga0137390_103072761	3300012363	Vadose Zone Soil	PNTIRIAAGVIFVILVFIIIMRRKKMASKRKRVP*
Ga0157333_10103592	3300012484	Soil	MDPTTIRVISGVLFVVIVFVILARRKGMATKRKRI*
Ga0137398_100981381	3300012683	Vadose Zone Soil	MDPTTIRIVAGVLFVVIVFIIVARRKKMASKRKPIP*
Ga0153915_103780333	3300012931	Freshwater Wetlands	MNPTTIRIIAGVLFVIFVTIIVWRRKNMASKRKHVL*
Ga0126375_107694442	3300012948	Tropical Forest Soil	MDPTTIRVVSGVIFVVLVFFIIARRKGMATKRKRIG*
Ga0164299_114544841	3300012958	Soil	MNPTTIRIIAGVLFVIIVTIIVWRRKNMASKRKHVL*
Ga0164304_109029781	3300012986	Soil	MDPTTIRIMAGVMFVVIIFLITLRRKKMAAKRKPIP
Ga0157380_103512743	3300014326	Switchgrass Rhizosphere	SMDPTTIRVISGVLFVVIVFIILARRKGMATKRKRI*
Ga0137412_107366252	3300015242	Vadose Zone Soil	SKEKFSMNPTTIRIIAGVLFVIFVTIIVWRRKNMASKRRHVL*
Ga0132258_110075923	3300015371	Arabidopsis Rhizosphere	MDPNTIRIIAGVMFVVIIFIITLRRKKMAAKRKPIPGQG*
Ga0132256_1003735582	3300015372	Arabidopsis Rhizosphere	MDPTIIRVISGVLFVVIVFIILARRKGMATKRKRI*
Ga0132255_1043947452	3300015374	Arabidopsis Rhizosphere	MDPTTIRVISGALFVVIVFVIIMRRKGMATKRKRI*
Ga0184625_106360261	3300018081	Groundwater Sediment	MDPTTMVRVVSGLMFVVIVFVIMARRKAMASKRKRFS
Ga0066667_103323242	3300018433	Grasslands Soil	MNPTTIRIIAGILFVVVVFIIVARRKRMASRRKPIP
Ga0066662_100215001	3300018468	Grasslands Soil	MNPTTIRIIAGVVFVVIIFIIVARRKRMASNRKRVA
Ga0066662_110790201	3300018468	Grasslands Soil	MNPTTVRIVAAIIFVIVVFIIVARRKSMAARRKPIA
Ga0179594_100416632	3300020170	Vadose Zone Soil	MDPITIRIIAGVLFVAIVIIIVVRRKKMASRRKPGP
Ga0179594_103430982	3300020170	Vadose Zone Soil	MDPTTIRIIAGVLFVVIVIIIVARRKKMASRRKPGP
Ga0210403_105076722	3300020580	Soil	MDPTIVRLVAGVIFVVLVFIIIARRKSMAAKRKHV
Ga0179596_103009501	3300021086	Vadose Zone Soil	MDPTTIRIIAGVLFVVIVIIIVARRKRMASKRKQVP
Ga0222622_107433602	3300022756	Groundwater Sediment	MDPTMIRVVSGVLFVVIVFIIISRRKGMAAKRKRIS
Ga0247695_10028193	3300024179	Soil	MNPTAIRIVAGILFVVVLVIIVARRKRMASKRKPGP
Ga0179589_102056541	3300024288	Vadose Zone Soil	MDPTTIRIIAGVLFVVIVFIIVARRKKMASKRKPIP
Ga0208850_10293262	3300025457	Arctic Peat Soil	MDTTTIRIIAGVLFVVIVFIIVARRKKMSSRRKPL
Ga0207682_101972321	3300025893	Miscanthus Rhizosphere	MDPTMIRVISGVLFVVIVFVILARRKGMATKRKRI
Ga0207654_110166211	3300025911	Corn Rhizosphere	MDPTTIRIIAAILFVIFVSIIVIRRKKMASRRKHVL
Ga0207662_101834831	3300025918	Switchgrass Rhizosphere	MDPTTIRVISGVLFVVIVFIILARRKGMATKRKRI
Ga0207646_101719443	3300025922	Corn, Switchgrass And Miscanthus Rhizosphere	MDPTTIRVVSGVLFVVIVFIIMARRKGMASKRKRIS
Ga0207646_104901842	3300025922	Corn, Switchgrass And Miscanthus Rhizosphere	MDTATMIRVIAGALFVLSVLVIVARRKKMASKRKRIG
Ga0207700_119541191	3300025928	Corn, Switchgrass And Miscanthus Rhizosphere	ASMDPTTVRVIAGVLFVVIVFIIIARRKSMAAKRKRVP
Ga0207665_106129802	3300025939	Corn, Switchgrass And Miscanthus Rhizosphere	MDPTTIRIIAGVAFVLIILIIMMRRKKMAAKRKPIP
Ga0207711_105839912	3300025941	Switchgrass Rhizosphere	MDPTTMVRVVAGVMFVVIVFVIMARRKAMASKRKRIS
Ga0209235_10344542	3300026296	Grasslands Soil	MDPITIRIIAGVLFVVIVAIIVWRRKKMASKRKPLP
Ga0257153_10361842	3300026490	Soil	MDSTTIRIIAGILFVVIVFIIVARRKKMASKRKPGP
Ga0209179_10387841	3300027512	Vadose Zone Soil	IKGGVASMDPTTIRIIAGVLFVVIVFIIVARRKKMASKRKPIP
Ga0209076_12068092	3300027643	Vadose Zone Soil	MDPTTIRIIAGVLFVVIIIIIVARRKKMASRRKPGP
Ga0209588_10454323	3300027671	Vadose Zone Soil	MDPTTIRIIAGVLFIVIVIIIVARRKKMASRRKPGP
Ga0209180_100138361	3300027846	Vadose Zone Soil	MDATTIRIIAGVLFVVIVIIIVARRKRMASKRKPGP
Ga0209180_100140043	3300027846	Vadose Zone Soil	MDPTTIRIIAGVLFVVIIIIIVARRKRMASRRKPGP
Ga0209166_100156923	3300027857	Surface Soil	MSPTTIRIIAGVIFVILVVIIIARRKKMASKRRPMA
Ga0209283_100156734	3300027875	Vadose Zone Soil	MDPTTIRIIAGVLFVVIVIIIVARRKRMASRRKPGP
Ga0207428_104377002	3300027907	Populus Rhizosphere	MDPTLIRVVSGVLFVVIVFVILMRRKGMATKRKRI
Ga0209006_100046826	3300027908	Forest Soil	MDPTTIRIIAGILCVVIVIIIIARRKRMASKRKPGP
Ga0268265_107265491	3300028380	Switchgrass Rhizosphere	MDPTTIRVISGVLFVVIMFVIIARRKGMATKRKRI
Ga0137415_100087327	3300028536	Vadose Zone Soil	MDPTTIRVIAGVVFVVLVFIIIARRKSMAAKRKRVP
Ga0170834_1122189961	3300031057	Forest Soil	MNPTAIRIIAGILFVVVLVIIVARRKRMASKRKPGP
Ga0170824_1107067732	3300031231	Forest Soil	SMDPTTVRVIAGVVFVVLVFIIIARRKSMAAKRKRVP
Ga0307476_102582702	3300031715	Hardwood Forest Soil	MDPTTVRIVAGVIFVVLVFIIIARRKSMAAKRKRVP
Ga0310813_103766092	3300031716	Soil	MSQDMIRIIAGVLFVVIVVVIVMRRKSMAGKRKQI
Ga0307468_1016234842	3300031740	Hardwood Forest Soil	MDPTTIRVIAGVIFVVIVFVIFARRQKMATKRKRVT
Ga0307475_100083705	3300031754	Hardwood Forest Soil	MDPTTIRIIAGVLFVVVVIIIVARRKRMASRRKPGP
Ga0307475_100274641	3300031754	Hardwood Forest Soil	MNPTIIRIIAGVLFVVIVFIIAARRKRMASKRKSF
Ga0307475_102679182	3300031754	Hardwood Forest Soil	MNPTTVRIVAAIIFVIMLFIIVARRKRMSARRKPIV
Ga0307479_111596681	3300031962	Hardwood Forest Soil	MDPTTIRIIAGVLFVVIVIIIVARRKKMASKRKPGP
Ga0307470_100046134	3300032174	Hardwood Forest Soil	MSPTTVRIIAGVLAVILVIIIFARRKRMASKRRALP
Ga0307470_102145702	3300032174	Hardwood Forest Soil	MNPTIIRIVAGVLFIIIVSIIVMRRKKMASRRKRIA
Ga0307471_1000057352	3300032180	Hardwood Forest Soil	MDPTTIRIIAGVAFVLIILMIMLRRKKMAAKRKPIP
Ga0307471_1000921783	3300032180	Hardwood Forest Soil	MDPTTIRIIAGVLFVVIIIIIVARRKRMASKRKPIP
Ga0307471_1017555402	3300032180	Hardwood Forest Soil	MDPTIIRVVSGVLFVVIVFVILMRRKGMATKRKRI
Ga0307471_1028422811	3300032180	Hardwood Forest Soil	MDPTMIRVISGVLFVVIVFVIMARRKGMASKRKRI
Ga0310810_100019185	3300033412	Soil	MDPTTIRVVSGVLFVVIVFIILARRKGMATKRKRI
Ga0310811_104682811	3300033475	Soil	MNPTTIRIIAGVLFVIFVTIIVWRRKNMASKRKHVL

Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome Family F061386

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Gene Neighborhood

Neighboring Pfam domains

Neighboring Clusters of Orthologous Genes (COGs)

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences