| Basic Information | |
|---|---|
| Family ID | F061304 |
| Family Type | Metagenome |
| Number of Sequences | 132 |
| Average Sequence Length | 43 residues |
| Representative Sequence | HHYHIVALALEELQRELSTEQRAQLLQKLHEEMNRPNPS |
| Number of Associated Samples | 113 |
| Number of Associated Scaffolds | 132 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 96.97 % |
| % of genes from short scaffolds (< 2000 bps) | 90.91 % |
| Associated GOLD sequencing projects | 105 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.40 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (77.273 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (9.091 % of family members) |
| Environment Ontology (ENVO) | Unclassified (18.939 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (59.091 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 46.27% β-sheet: 0.00% Coil/Unstructured: 53.73% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.40 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 132 Family Scaffolds |
|---|---|---|
| PF08338 | DUF1731 | 31.06 |
| PF00749 | tRNA-synt_1c | 6.82 |
| PF01712 | dNK | 1.52 |
| PF13462 | Thioredoxin_4 | 1.52 |
| PF00909 | Ammonium_transp | 1.52 |
| PF07726 | AAA_3 | 0.76 |
| PF00975 | Thioesterase | 0.76 |
| PF01435 | Peptidase_M48 | 0.76 |
| PF04014 | MazE_antitoxin | 0.76 |
| PF14765 | PS-DH | 0.76 |
| PF01726 | LexA_DNA_bind | 0.76 |
| PF05598 | DUF772 | 0.76 |
| PF13328 | HD_4 | 0.76 |
| PF00069 | Pkinase | 0.76 |
| COG ID | Name | Functional Category | % Frequency in 132 Family Scaffolds |
|---|---|---|---|
| COG1090 | NAD dependent epimerase/dehydratase family enzyme | General function prediction only [R] | 31.06 |
| COG0008 | Glutamyl- or glutaminyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 6.82 |
| COG0515 | Serine/threonine protein kinase | Signal transduction mechanisms [T] | 3.03 |
| COG0004 | Ammonia channel protein AmtB | Inorganic ion transport and metabolism [P] | 1.52 |
| COG1428 | Deoxyadenosine/deoxycytidine kinase | Nucleotide transport and metabolism [F] | 1.52 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 77.27 % |
| Unclassified | root | N/A | 22.73 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000567|JGI12270J11330_10275442 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 532 | Open in IMG/M |
| 3300001593|JGI12635J15846_10142078 | All Organisms → cellular organisms → Bacteria | 1659 | Open in IMG/M |
| 3300004479|Ga0062595_100431593 | Not Available | 959 | Open in IMG/M |
| 3300005177|Ga0066690_10612757 | All Organisms → cellular organisms → Bacteria | 726 | Open in IMG/M |
| 3300005454|Ga0066687_10558019 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 680 | Open in IMG/M |
| 3300005538|Ga0070731_11075417 | All Organisms → cellular organisms → Bacteria | 532 | Open in IMG/M |
| 3300005541|Ga0070733_10613410 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 729 | Open in IMG/M |
| 3300005542|Ga0070732_10229762 | All Organisms → cellular organisms → Bacteria | 1110 | Open in IMG/M |
| 3300005542|Ga0070732_10860327 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 553 | Open in IMG/M |
| 3300005560|Ga0066670_10306359 | All Organisms → cellular organisms → Bacteria | 967 | Open in IMG/M |
| 3300005564|Ga0070664_101623129 | Not Available | 613 | Open in IMG/M |
| 3300005610|Ga0070763_10324401 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 851 | Open in IMG/M |
| 3300005764|Ga0066903_105515937 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 667 | Open in IMG/M |
| 3300005921|Ga0070766_11176807 | All Organisms → cellular organisms → Bacteria | 530 | Open in IMG/M |
| 3300005950|Ga0066787_10037504 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 896 | Open in IMG/M |
| 3300006028|Ga0070717_10052993 | All Organisms → cellular organisms → Bacteria | 3344 | Open in IMG/M |
| 3300006052|Ga0075029_100118394 | All Organisms → cellular organisms → Bacteria | 1605 | Open in IMG/M |
| 3300006086|Ga0075019_10154135 | All Organisms → cellular organisms → Bacteria | 1345 | Open in IMG/M |
| 3300006163|Ga0070715_10659143 | All Organisms → cellular organisms → Bacteria | 620 | Open in IMG/M |
| 3300006174|Ga0075014_100256406 | All Organisms → cellular organisms → Bacteria | 905 | Open in IMG/M |
| 3300006174|Ga0075014_101008461 | All Organisms → cellular organisms → Bacteria | 505 | Open in IMG/M |
| 3300006175|Ga0070712_101595326 | Not Available | 571 | Open in IMG/M |
| 3300006176|Ga0070765_100205836 | Not Available | 1787 | Open in IMG/M |
| 3300006796|Ga0066665_10244097 | All Organisms → cellular organisms → Bacteria | 1417 | Open in IMG/M |
| 3300006914|Ga0075436_101123307 | All Organisms → cellular organisms → Bacteria | 592 | Open in IMG/M |
| 3300009038|Ga0099829_11764888 | All Organisms → cellular organisms → Bacteria | 507 | Open in IMG/M |
| 3300009521|Ga0116222_1124261 | All Organisms → cellular organisms → Bacteria | 1111 | Open in IMG/M |
| 3300009525|Ga0116220_10394727 | All Organisms → cellular organisms → Bacteria | 618 | Open in IMG/M |
| 3300009700|Ga0116217_10309455 | All Organisms → cellular organisms → Bacteria | 1014 | Open in IMG/M |
| 3300009824|Ga0116219_10277306 | All Organisms → cellular organisms → Bacteria | 948 | Open in IMG/M |
| 3300009824|Ga0116219_10596071 | All Organisms → cellular organisms → Bacteria | 607 | Open in IMG/M |
| 3300009839|Ga0116223_10864161 | All Organisms → cellular organisms → Bacteria | 516 | Open in IMG/M |
| 3300010379|Ga0136449_100498259 | Not Available | 2116 | Open in IMG/M |
| 3300010398|Ga0126383_10233196 | Not Available | 1793 | Open in IMG/M |
| 3300010398|Ga0126383_10447982 | All Organisms → cellular organisms → Bacteria | 1339 | Open in IMG/M |
| 3300010398|Ga0126383_10450840 | All Organisms → cellular organisms → Bacteria | 1336 | Open in IMG/M |
| 3300011120|Ga0150983_11583888 | All Organisms → cellular organisms → Bacteria | 630 | Open in IMG/M |
| 3300012199|Ga0137383_10607117 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 800 | Open in IMG/M |
| 3300012361|Ga0137360_10182450 | All Organisms → cellular organisms → Bacteria | 1687 | Open in IMG/M |
| 3300012971|Ga0126369_10431669 | All Organisms → cellular organisms → Bacteria | 1362 | Open in IMG/M |
| 3300014489|Ga0182018_10503408 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 641 | Open in IMG/M |
| 3300014489|Ga0182018_10757715 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 504 | Open in IMG/M |
| 3300014495|Ga0182015_11047644 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 503 | Open in IMG/M |
| 3300014501|Ga0182024_10098872 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 4258 | Open in IMG/M |
| 3300015241|Ga0137418_10997896 | All Organisms → cellular organisms → Bacteria | 606 | Open in IMG/M |
| 3300016341|Ga0182035_11193446 | All Organisms → cellular organisms → Bacteria | 679 | Open in IMG/M |
| 3300016422|Ga0182039_10900175 | Not Available | 790 | Open in IMG/M |
| 3300017822|Ga0187802_10239933 | Not Available | 700 | Open in IMG/M |
| 3300017925|Ga0187856_1005141 | All Organisms → cellular organisms → Bacteria | 8483 | Open in IMG/M |
| 3300017933|Ga0187801_10205077 | All Organisms → cellular organisms → Bacteria | 782 | Open in IMG/M |
| 3300017936|Ga0187821_10278656 | Not Available | 659 | Open in IMG/M |
| 3300017961|Ga0187778_10092737 | All Organisms → cellular organisms → Bacteria | 1871 | Open in IMG/M |
| 3300017974|Ga0187777_10076610 | All Organisms → cellular organisms → Bacteria | 2176 | Open in IMG/M |
| 3300017995|Ga0187816_10045900 | All Organisms → cellular organisms → Bacteria | 1814 | Open in IMG/M |
| 3300018006|Ga0187804_10293214 | All Organisms → cellular organisms → Bacteria | 708 | Open in IMG/M |
| 3300018035|Ga0187875_10690008 | All Organisms → cellular organisms → Bacteria | 537 | Open in IMG/M |
| 3300018046|Ga0187851_10771938 | Not Available | 541 | Open in IMG/M |
| 3300018058|Ga0187766_10757311 | All Organisms → cellular organisms → Bacteria | 675 | Open in IMG/M |
| 3300018058|Ga0187766_11119118 | All Organisms → cellular organisms → Bacteria | 566 | Open in IMG/M |
| 3300018085|Ga0187772_10569539 | Not Available | 804 | Open in IMG/M |
| 3300018088|Ga0187771_10906097 | Not Available | 748 | Open in IMG/M |
| 3300018088|Ga0187771_11230213 | All Organisms → cellular organisms → Bacteria | 635 | Open in IMG/M |
| 3300018482|Ga0066669_10968478 | All Organisms → cellular organisms → Bacteria | 766 | Open in IMG/M |
| 3300020579|Ga0210407_10785262 | Not Available | 735 | Open in IMG/M |
| 3300020583|Ga0210401_10289554 | All Organisms → cellular organisms → Bacteria | 1498 | Open in IMG/M |
| 3300021403|Ga0210397_11455061 | All Organisms → cellular organisms → Bacteria | 532 | Open in IMG/M |
| 3300021405|Ga0210387_10913353 | All Organisms → cellular organisms → Bacteria | 772 | Open in IMG/M |
| 3300021406|Ga0210386_11276852 | All Organisms → cellular organisms → Bacteria | 619 | Open in IMG/M |
| 3300021407|Ga0210383_10948704 | All Organisms → cellular organisms → Bacteria | 731 | Open in IMG/M |
| 3300021407|Ga0210383_11689420 | All Organisms → cellular organisms → Bacteria | 519 | Open in IMG/M |
| 3300021407|Ga0210383_11745332 | All Organisms → cellular organisms → Bacteria | 509 | Open in IMG/M |
| 3300021420|Ga0210394_10873550 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 783 | Open in IMG/M |
| 3300021474|Ga0210390_10682037 | All Organisms → cellular organisms → Bacteria | 857 | Open in IMG/M |
| 3300021474|Ga0210390_11530841 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 527 | Open in IMG/M |
| 3300025412|Ga0208194_1021190 | Not Available | 1040 | Open in IMG/M |
| 3300025625|Ga0208219_1028431 | Not Available | 1548 | Open in IMG/M |
| 3300025812|Ga0208457_1047137 | Not Available | 915 | Open in IMG/M |
| 3300025915|Ga0207693_11356800 | Not Available | 530 | Open in IMG/M |
| 3300025929|Ga0207664_11171355 | Not Available | 686 | Open in IMG/M |
| 3300026078|Ga0207702_10884087 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 885 | Open in IMG/M |
| 3300026508|Ga0257161_1142438 | All Organisms → cellular organisms → Bacteria | 504 | Open in IMG/M |
| 3300026538|Ga0209056_10174159 | All Organisms → cellular organisms → Bacteria | 1610 | Open in IMG/M |
| 3300026557|Ga0179587_10810825 | All Organisms → cellular organisms → Bacteria | 617 | Open in IMG/M |
| 3300027266|Ga0209215_1063281 | All Organisms → cellular organisms → Bacteria | 519 | Open in IMG/M |
| 3300027545|Ga0209008_1029607 | Not Available | 1274 | Open in IMG/M |
| 3300027565|Ga0209219_1041173 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1151 | Open in IMG/M |
| 3300027591|Ga0209733_1162328 | All Organisms → cellular organisms → Bacteria | 538 | Open in IMG/M |
| 3300027706|Ga0209581_1170712 | All Organisms → cellular organisms → Bacteria | 698 | Open in IMG/M |
| 3300027842|Ga0209580_10064796 | All Organisms → cellular organisms → Bacteria | 1727 | Open in IMG/M |
| 3300027854|Ga0209517_10051833 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3090 | Open in IMG/M |
| 3300027867|Ga0209167_10198884 | All Organisms → cellular organisms → Bacteria | 1066 | Open in IMG/M |
| 3300027867|Ga0209167_10277953 | All Organisms → cellular organisms → Bacteria | 903 | Open in IMG/M |
| 3300027889|Ga0209380_10780957 | All Organisms → cellular organisms → Bacteria | 543 | Open in IMG/M |
| 3300027905|Ga0209415_10967897 | All Organisms → cellular organisms → Bacteria | 570 | Open in IMG/M |
| 3300027911|Ga0209698_10646596 | All Organisms → cellular organisms → Bacteria | 809 | Open in IMG/M |
| 3300028801|Ga0302226_10412807 | Not Available | 565 | Open in IMG/M |
| 3300028866|Ga0302278_10116199 | Not Available | 1455 | Open in IMG/M |
| 3300028906|Ga0308309_10163186 | Not Available | 1804 | Open in IMG/M |
| 3300028906|Ga0308309_10477345 | Not Available | 1076 | Open in IMG/M |
| 3300029943|Ga0311340_10290929 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1563 | Open in IMG/M |
| 3300029954|Ga0311331_10922769 | All Organisms → cellular organisms → Bacteria | 768 | Open in IMG/M |
| 3300030058|Ga0302179_10040279 | All Organisms → cellular organisms → Bacteria | 2136 | Open in IMG/M |
| 3300030058|Ga0302179_10198337 | Not Available | 886 | Open in IMG/M |
| 3300030580|Ga0311355_11668626 | All Organisms → cellular organisms → Bacteria | 545 | Open in IMG/M |
| 3300030688|Ga0311345_10256993 | Not Available | 1699 | Open in IMG/M |
| 3300030693|Ga0302313_10233758 | All Organisms → cellular organisms → Bacteria | 737 | Open in IMG/M |
| 3300031057|Ga0170834_100415713 | All Organisms → cellular organisms → Bacteria | 516 | Open in IMG/M |
| 3300031231|Ga0170824_108454281 | All Organisms → cellular organisms → Bacteria | 599 | Open in IMG/M |
| 3300031234|Ga0302325_12818660 | All Organisms → cellular organisms → Bacteria | 569 | Open in IMG/M |
| 3300031241|Ga0265325_10517262 | All Organisms → cellular organisms → Bacteria | 517 | Open in IMG/M |
| 3300031258|Ga0302318_10652318 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 531 | Open in IMG/M |
| 3300031525|Ga0302326_10070645 | All Organisms → cellular organisms → Bacteria | 6463 | Open in IMG/M |
| 3300031708|Ga0310686_109689027 | All Organisms → cellular organisms → Bacteria | 995 | Open in IMG/M |
| 3300031718|Ga0307474_10078107 | All Organisms → cellular organisms → Bacteria | 2460 | Open in IMG/M |
| 3300031823|Ga0307478_11542578 | All Organisms → cellular organisms → Bacteria | 549 | Open in IMG/M |
| 3300031912|Ga0306921_10901358 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1004 | Open in IMG/M |
| 3300031962|Ga0307479_11689306 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 587 | Open in IMG/M |
| 3300031962|Ga0307479_11700073 | All Organisms → cellular organisms → Bacteria | 585 | Open in IMG/M |
| 3300032160|Ga0311301_12248923 | Not Available | 623 | Open in IMG/M |
| 3300032180|Ga0307471_102011712 | All Organisms → cellular organisms → Bacteria | 725 | Open in IMG/M |
| 3300032770|Ga0335085_10407851 | All Organisms → cellular organisms → Bacteria | 1575 | Open in IMG/M |
| 3300032805|Ga0335078_11246315 | All Organisms → cellular organisms → Bacteria | 854 | Open in IMG/M |
| 3300032805|Ga0335078_11661684 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 703 | Open in IMG/M |
| 3300032892|Ga0335081_10221369 | Not Available | 2591 | Open in IMG/M |
| 3300032954|Ga0335083_10409062 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1157 | Open in IMG/M |
| 3300032954|Ga0335083_10994486 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 661 | Open in IMG/M |
| 3300033004|Ga0335084_10439270 | All Organisms → cellular organisms → Bacteria | 1343 | Open in IMG/M |
| 3300033158|Ga0335077_11603487 | All Organisms → cellular organisms → Bacteria | 619 | Open in IMG/M |
| 3300033158|Ga0335077_11891498 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 558 | Open in IMG/M |
| 3300034163|Ga0370515_0084962 | Not Available | 1372 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 9.09% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 9.09% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 7.58% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 6.06% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 6.06% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 5.30% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 4.55% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 4.55% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 3.79% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 3.79% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 3.79% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 3.79% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 3.79% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 3.03% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.03% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 3.03% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 2.27% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.27% |
| Palsa | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa | 2.27% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 1.52% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.52% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.76% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.76% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 0.76% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.76% |
| Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 0.76% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 0.76% |
| Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 0.76% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.76% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.76% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.76% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.76% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.76% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.76% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000567 | Peat soil microbial communities from Weissenstadt, Germany - SII-2010 | Environmental | Open in IMG/M |
| 3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300005177 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 | Environmental | Open in IMG/M |
| 3300005454 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 | Environmental | Open in IMG/M |
| 3300005538 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 | Environmental | Open in IMG/M |
| 3300005541 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 | Environmental | Open in IMG/M |
| 3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
| 3300005560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119 | Environmental | Open in IMG/M |
| 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005610 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
| 3300005950 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 2 DNA2013-047 | Environmental | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
| 3300006086 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 | Environmental | Open in IMG/M |
| 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
| 3300006174 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014 | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009521 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_9_AC metaG | Environmental | Open in IMG/M |
| 3300009525 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_7_NC metaG | Environmental | Open in IMG/M |
| 3300009700 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG | Environmental | Open in IMG/M |
| 3300009824 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG | Environmental | Open in IMG/M |
| 3300009839 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300014489 | Permafrost microbial communities from Stordalen Mire, Sweden - 812P2M metaG | Environmental | Open in IMG/M |
| 3300014495 | Permafrost microbial communities from Stordalen Mire, Sweden - 712P3M metaG | Environmental | Open in IMG/M |
| 3300014501 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300015241 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300017822 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_2 | Environmental | Open in IMG/M |
| 3300017925 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_40 | Environmental | Open in IMG/M |
| 3300017933 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_1 | Environmental | Open in IMG/M |
| 3300017936 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_1 | Environmental | Open in IMG/M |
| 3300017961 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MG | Environmental | Open in IMG/M |
| 3300017974 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MG | Environmental | Open in IMG/M |
| 3300017995 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_1 | Environmental | Open in IMG/M |
| 3300018006 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_4 | Environmental | Open in IMG/M |
| 3300018035 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_10 | Environmental | Open in IMG/M |
| 3300018046 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_10 | Environmental | Open in IMG/M |
| 3300018058 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MG | Environmental | Open in IMG/M |
| 3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018088 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MG | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
| 3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
| 3300025412 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_10 (SPAdes) | Environmental | Open in IMG/M |
| 3300025625 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 53-2 shallow-072012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025812 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_150 (SPAdes) | Environmental | Open in IMG/M |
| 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026508 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-01-A | Environmental | Open in IMG/M |
| 3300026538 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes) | Environmental | Open in IMG/M |
| 3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300027266 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM2H0_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027545 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027565 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027591 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027706 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen15_06102014_R2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027842 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027854 | Peat soil microbial communities from Weissenstadt, Germany - SII-2010 (SPAdes) | Environmental | Open in IMG/M |
| 3300027867 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027889 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes) | Environmental | Open in IMG/M |
| 3300027905 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes) | Environmental | Open in IMG/M |
| 3300027911 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300028801 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E3_3 | Environmental | Open in IMG/M |
| 3300028866 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_N3_2 | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300029943 | I_Palsa_N3 coassembly | Environmental | Open in IMG/M |
| 3300029954 | I_Bog_N3 coassembly | Environmental | Open in IMG/M |
| 3300030058 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_1 | Environmental | Open in IMG/M |
| 3300030580 | II_Palsa_N1 coassembly | Environmental | Open in IMG/M |
| 3300030688 | II_Bog_N2 coassembly | Environmental | Open in IMG/M |
| 3300030693 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N2_2 | Environmental | Open in IMG/M |
| 3300031057 | Oak Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031234 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2 | Environmental | Open in IMG/M |
| 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Host-Associated | Open in IMG/M |
| 3300031258 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Bog_T0_1 | Environmental | Open in IMG/M |
| 3300031525 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
| 3300032782 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1 | Environmental | Open in IMG/M |
| 3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
| 3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
| 3300032954 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2 | Environmental | Open in IMG/M |
| 3300033004 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4 | Environmental | Open in IMG/M |
| 3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
| 3300034163 | Peat soil microbial communities from wetlands in Alaska, United States - Goldstream_04D_14 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI12270J11330_102754421 | 3300000567 | Peatlands Soil | RYAGAHHYHIVALALEELQRELNSDQRAQLLAKLLDEMHRDDPPN* |
| JGI12635J15846_101420781 | 3300001593 | Forest Soil | LALEELQRELSTEQRAQLLAKLHEEIDRSMPSGSA* |
| Ga0062595_1004315933 | 3300004479 | Soil | HHYHIVALALEELQRELTTEQRAQLLQKLQEEMNRPNQQ* |
| Ga0066690_106127572 | 3300005177 | Soil | PKFSGAHHYHIVALALEELQRELSTEQRAQLLQKLQEEMNRPNQQ* |
| Ga0066687_105580191 | 3300005454 | Soil | AHHYHIVALALEELKRELSTEQRAQLLKKLHDEMNPPKPQ* |
| Ga0070731_110754172 | 3300005538 | Surface Soil | IVSLALEELQRELSTEQRAELLDKLQEEMKRPNPQ* |
| Ga0070733_106134102 | 3300005541 | Surface Soil | TTDPKFASAHHYHIVALALDELQRELSTDQRAQLLQKLQEEIKRSDPN* |
| Ga0070732_102297621 | 3300005542 | Surface Soil | HHYHVMALALEELQRELTTEQRADLLRKLQEEMNRPNPQ* |
| Ga0070732_108603272 | 3300005542 | Surface Soil | FAGAHHYHVMALALEELQRELSTEQRGQLLQKLHDEMNRSNPN* |
| Ga0066670_103063594 | 3300005560 | Soil | HHYHIVALALEELQRELSTQERSQLLQKLHDEMNRPNPQ* |
| Ga0070664_1016231291 | 3300005564 | Corn Rhizosphere | HIVALALEELQRELTTEQRAQLLQKLQEEMNRPNQQ* |
| Ga0070763_103244013 | 3300005610 | Soil | HYHIVALALEELQRELTTEQRAQLLQKLQDEVNRPNQQ* |
| Ga0066903_1055159371 | 3300005764 | Tropical Forest Soil | HHYHIVALALEELKRELSTEQRAQLLEKLHEEMNRPNPQ* |
| Ga0070766_111768071 | 3300005921 | Soil | AGAHHYHIVALALEELKRELTTEQREELLAKLLDEMHRDLPEC* |
| Ga0066787_100375041 | 3300005950 | Soil | ADPKYAGAHHYHVVALALQELRRELTSDQRAATLAKLLDEMHVDDPPSQN* |
| Ga0070717_100529936 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | DITTDPKFAGAHHYHIVALALEELKRELSTEQRAQLLEKLHDEMNHPGQQ* |
| Ga0075029_1001183941 | 3300006052 | Watersheds | TADSKFAGAHHYHIVALALEELKRELSTEQRIQLLEKLHEEMNRPNPQ* |
| Ga0075019_101541354 | 3300006086 | Watersheds | HIVALALEELKRELSTEQRAQLLQKLHDEMNHPGQQ* |
| Ga0070715_106591431 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | SDPQYAGAHHYHIVALALEELQRELKTSQRPELLGKLIREMQQGIAPKKN* |
| Ga0075014_1002564063 | 3300006174 | Watersheds | HHYHIVALALEELQRELSTEQRTELLEKLQQEMNHPNPQ* |
| Ga0075014_1010084612 | 3300006174 | Watersheds | ITADPKYSGAHHYHIVALALEELQRELTTEQRAQLLEKLHQEMNRPNPL* |
| Ga0070712_1015953261 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | GAHHYHIVALALEELQRELTTEQRAQLLQKLQEEMNRPNQQ* |
| Ga0070765_1002058364 | 3300006176 | Soil | KFAGAHHYHVVALALEELQRELSTDQRAELLQKLLEEMNHPKPS* |
| Ga0066665_102440972 | 3300006796 | Soil | VHHYHIVALALEELQKELNSDTRAQVLAKLLDELHRKDGSS* |
| Ga0075436_1011233071 | 3300006914 | Populus Rhizosphere | YHIVALALEELKRELSTEERAQLLQKLHDEMNRPNQQ* |
| Ga0099829_117648881 | 3300009038 | Vadose Zone Soil | TADPKFAGTHHYHIVALALEELQRELSTEQRAQLLQKLHDEMNRSNPS* |
| Ga0116222_11242612 | 3300009521 | Peatlands Soil | DPKYAGAHHYHIVAVALEELQRELNGDQRAEVLAKLLDEMYRDHPPSQS* |
| Ga0116220_103947271 | 3300009525 | Peatlands Soil | RYAGAHHYHVVALALEELKRELTTEQRAALLAKLLDEMHRDSGAN* |
| Ga0116217_103094551 | 3300009700 | Peatlands Soil | VALALEELQRELSTEQRAELLQKLHDEMNRFNPQ* |
| Ga0116219_102773062 | 3300009824 | Peatlands Soil | TDPKFAGAHHYHIVALALEELQRELSTDQRAQLLDKLQEEMRRSNPN* |
| Ga0116219_105960711 | 3300009824 | Peatlands Soil | HIVALALEELRREMSTEQRAELLQKLQEEMRRSEPN* |
| Ga0116223_108641612 | 3300009839 | Peatlands Soil | DPKYAGAHHYHVVALALEELRRELNSDVRAELLAKLLDEMNGDKPPGQS* |
| Ga0136449_1004982591 | 3300010379 | Peatlands Soil | TDPKYAGAHHYHIVALALEELRREMSTEQRAELLQKLQEEMRRSEPN* |
| Ga0126383_102331961 | 3300010398 | Tropical Forest Soil | ITADPKFAGAHHYHIVALALEELKRELSTEQRAQLLEKLHDEMNRPNPQ* |
| Ga0126383_104479821 | 3300010398 | Tropical Forest Soil | TCDPKFAGAHHYHIVALALEELQKELSTEQRAELLQKLHDEMNRPNQQ* |
| Ga0126383_104508401 | 3300010398 | Tropical Forest Soil | KYAGAHHYHIVALALEELQRELGTDQRAQLLEKLQDEVNRPNQQ* |
| Ga0150983_115838881 | 3300011120 | Forest Soil | HHYHIVALALEELQRELSTEQRAQLLQKLHEEMNRPNPS* |
| Ga0137383_106071173 | 3300012199 | Vadose Zone Soil | HIVALALEELQRELSTEQRAQLLQKLHDEMNRSNPS* |
| Ga0137360_101824501 | 3300012361 | Vadose Zone Soil | HIVALALEELQRELSTEQRAQLLQKLQEEMGRPDSTRIQ* |
| Ga0126369_104316691 | 3300012971 | Tropical Forest Soil | KFAGAHHYHIVALALEELKRELTTEQRAQLLQKLHDEMNRSTPQ* |
| Ga0182018_105034081 | 3300014489 | Palsa | TDPKYAGAHHYHIVSLALEELQRELSTEQRAQLLQKLQEEMNRSEPN* |
| Ga0182018_107577151 | 3300014489 | Palsa | TTDPKFAGAHHYHIVALALEELQRELSTEQRAQLLQKLQEEVNRSGEKSGPPN* |
| Ga0182015_110476441 | 3300014495 | Palsa | TTDPKFAGAHHYHIVALALEELQRELSTEQRAQLLQKLQEEMNRSGEKSGPPN* |
| Ga0182024_100988724 | 3300014501 | Permafrost | SDPKYAGAHHYHIVALALEELQRELKCEQRAALLTKLLDEMHRDDSDPKAN* |
| Ga0137418_109978961 | 3300015241 | Vadose Zone Soil | GAHHYHIVALALEELQRELSTEQRAQLLQKLQEEMGRSSPN* |
| Ga0182035_111934461 | 3300016341 | Soil | DPKFAGAHHYHIVALALEELKRELSTEQRAQLLEKLHEEMNRPNPQ |
| Ga0182039_109001751 | 3300016422 | Soil | VHHYHIVALALEELQRELSTEERAHLLAKLQEEMHKDQLPN |
| Ga0187802_102399331 | 3300017822 | Freshwater Sediment | HYHIVALALEELQRELHSDQRAQLLAKLLDEMHRDDPPN |
| Ga0187856_10051411 | 3300017925 | Peatland | ITTDPKYAAAHHYHIVALALEELQRELGTEQRDQLLEKLQEEMNDPNPQ |
| Ga0187801_102050773 | 3300017933 | Freshwater Sediment | YHIVALALEELQRELSSEQRAQLLQKLHDEMNRSDQQ |
| Ga0187821_102786562 | 3300017936 | Freshwater Sediment | IVALALEELQRELTTEQRAQLLQKLHDEMNRPSPQ |
| Ga0187778_100927375 | 3300017961 | Tropical Peatland | AGTHHYHIVALALEELRRELSSEQRAELLEKLQEEMKRPNPQ |
| Ga0187777_100766101 | 3300017974 | Tropical Peatland | HHYHIVALALEELRRELSSEQRAELLEKLQEEMKRPNPQ |
| Ga0187816_100459001 | 3300017995 | Freshwater Sediment | PKYSGAHHYHIVALALEELQRELSTEQRAQLLQKLQEEMNRSNPQ |
| Ga0187804_102932141 | 3300018006 | Freshwater Sediment | AHHYHIVALALEELKRELTTEQRAQLLEKLHEEMNHPNPQ |
| Ga0187875_106900081 | 3300018035 | Peatland | ITTDPRFAGAHHYHIVALALEELQRELSTDQRAELLQKLQEEMRRSEPE |
| Ga0187851_107719381 | 3300018046 | Peatland | AGAHHYHIVSLALEELRRELCTEQRAELLQKLQEEMNRSENT |
| Ga0187766_107573111 | 3300018058 | Tropical Peatland | HHYHIVALALEELQRELSTEQRAELLQKLQEEMRRTNPS |
| Ga0187766_111191181 | 3300018058 | Tropical Peatland | AHHYHIVALALDELQRELTTEQRVQLLEKLQKEMNGPNPQ |
| Ga0187772_105695392 | 3300018085 | Tropical Peatland | IVALALEELQRELTTDQRAELLDKLSKEMDHPNPQ |
| Ga0187771_109060971 | 3300018088 | Tropical Peatland | HHYHIVALALEELQRELSTEQRAQLLQKLQEEMNHPSQQ |
| Ga0187771_112302131 | 3300018088 | Tropical Peatland | ITSDPKYAGAHHYHIVALALEELKRELNSEQRAELLTKLLDEMHRDHPPS |
| Ga0066669_109684781 | 3300018482 | Grasslands Soil | FAGTHHYHIVALALEELQRELTTEQRAQLLQKLHDEMNRSNPQ |
| Ga0210407_107852622 | 3300020579 | Soil | ITKDPKYAGAHHYHIVALALEELQRELSTEQRAQLLQKLQEEMRRSNPN |
| Ga0210401_102895541 | 3300020583 | Soil | IVALALEELQRELSTEQRAQLLQKLQEEMNRSNPN |
| Ga0210397_114550611 | 3300021403 | Soil | ALEELQRELSTEQRAQLLQKLQDEMKAPGSSDKGLDS |
| Ga0210387_109133531 | 3300021405 | Soil | KFAGAHHYHIVALALEELQRELSTEQRTQLLQKLQEEMNRSSEEPKN |
| Ga0210386_112768521 | 3300021406 | Soil | HVVALALEELQRELSTDQRAELLQKLLEEMNHPNPS |
| Ga0210383_109487042 | 3300021407 | Soil | DPRFAGAHHYHIVALALEELQRELSTEQRTQLLQKLQEEMNRSGDGPKN |
| Ga0210383_116894202 | 3300021407 | Soil | KFAGAHHYHIVALALEELQRELSTEQRTQLLQKLQEEMNRSGDQPKN |
| Ga0210383_117453322 | 3300021407 | Soil | HHYHIVALALEELRRELSTEQRAQLLDKLQKEMEPPPPQ |
| Ga0210394_108735501 | 3300021420 | Soil | HHYHVVALALEELQRELSTEQRAQLLQKLQDEINRSNPS |
| Ga0210390_106820371 | 3300021474 | Soil | HYHVVALALEELQRELSTEQRAQLLQKLQDEINRSNPS |
| Ga0210390_115308412 | 3300021474 | Soil | AHHYHIVALALEELQRELSTEQRAQLLAKLQDEINRPNPQ |
| Ga0208194_10211902 | 3300025412 | Peatland | HHYHVIALALEELRRELGTEQRAQLLQKLQEEMNRPDPL |
| Ga0208219_10284312 | 3300025625 | Arctic Peat Soil | AAHHYHIVALALEELKRELSSEQRAALLDKLREEMQRGSSNSS |
| Ga0208457_10471371 | 3300025812 | Peatland | HHYHIVALALEELRREMSTEQRAELLQKLQEEMRRSEPN |
| Ga0207693_113568001 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | HHYHIVALALEELQRELTTEQRAQLLQKLQEEMNRPNQQ |
| Ga0207664_111713551 | 3300025929 | Agricultural Soil | IVALALEELQRELTTEQRAQLLQKLQEEMNRPNQQ |
| Ga0207702_108840871 | 3300026078 | Corn Rhizosphere | NITSDPKFSGAHHYHIVALALEELQRELSTEQRAQLLQKLQEEMNRPNQQ |
| Ga0257161_11424381 | 3300026508 | Soil | HHYHVVALALEELQRELSTDQRAELLQKLLEEMNHPNPS |
| Ga0209056_101741592 | 3300026538 | Soil | VHHYHIVALALEELQKELNSDTRAQVLAKLLDELHRKDGSS |
| Ga0179587_108108252 | 3300026557 | Vadose Zone Soil | DPKFAGAHHYHIVALALEELKRELNTEQKAQLLAKLQDEMNTSGENCSPQE |
| Ga0209215_10632811 | 3300027266 | Forest Soil | HYHIVALALEELKRELSTEQRAQLLEKLHDEMNHPGQQ |
| Ga0209008_10296071 | 3300027545 | Forest Soil | TTDPKYAGAHHYHIVALALEELRRELSTEQRTDLLQKLQDEMRRSEPN |
| Ga0209219_10411731 | 3300027565 | Forest Soil | HHYHIVALALEELQRELGSPDRAALLAKLLDEMHNDSPN |
| Ga0209733_11623282 | 3300027591 | Forest Soil | YHIVALALEELRRELNSDTRAEVLAKLLDEMHRDEAPKNLPIKPSS |
| Ga0209581_11707123 | 3300027706 | Surface Soil | YHIVALALEELQRELSTEQRAQLLQKLHDEMNRPNQQ |
| Ga0209580_100647962 | 3300027842 | Surface Soil | YHVMALALEELQRELSTEQRGQLLQKLHDEMNRSNPN |
| Ga0209517_100518331 | 3300027854 | Peatlands Soil | YAAAHHYHIVALALEELQRELTTEQRAALLQKLQEEMNGPNPQ |
| Ga0209167_101988841 | 3300027867 | Surface Soil | PKYAGAHHYHIVALALEELQRELSTEQRAQLLAKLQEEMNRLKPQ |
| Ga0209167_102779531 | 3300027867 | Surface Soil | HYHIVALALEELQRELTTEQRAQLLQKLHDEMNRSIQQ |
| Ga0209380_107809571 | 3300027889 | Soil | YAGAHHYHIVALALEELKRELTTEQREELLAKLLDEMHRDLPEC |
| Ga0209415_103199781 | 3300027905 | Peatlands Soil | HYHIVALALEELQRELKCEQRAALLAKLLDEMHRDDSASKAN |
| Ga0209415_109678972 | 3300027905 | Peatlands Soil | HHYHVVALALEELKRELTTEQRAALLAKLLDEMHRDSGAN |
| Ga0209698_106465962 | 3300027911 | Watersheds | HHYHIVALALEELKRELSTEQRAELLQKLSEEMGRPDVPASGKPN |
| Ga0302226_104128071 | 3300028801 | Palsa | PKFAGAHHYHIVALALEELQRELSTEQRAQLLQKLQEEMNRSGDKSGPPN |
| Ga0302278_101161993 | 3300028866 | Bog | HHYHIVALALEELQRELTTEQRAGLLQKLLEEMRRSETE |
| Ga0308309_101631864 | 3300028906 | Soil | KFAGAHHYHVVALALEELQRELSTDQRAELLQKLLEEMNHPKPS |
| Ga0308309_104773452 | 3300028906 | Soil | VHHYHIVALALEELRRELSTEQRTDLLQKLQEEMRRSEPN |
| Ga0311340_102909291 | 3300029943 | Palsa | PKFAGAHHYHIVALALEELQRELSTEQRTQLLQKLQEEMKGPNSQ |
| Ga0311331_109227691 | 3300029954 | Bog | IVALALEELQRELTTEQRAGLLQKLQEEMRRSETE |
| Ga0302179_100402794 | 3300030058 | Palsa | AHHYHIVALALEELQRELSTEQRAELLQKLQEEMNRSSPD |
| Ga0302179_101983371 | 3300030058 | Palsa | ALALEELQRELSTEQRAQLLQKLQEEMNGPDSQCQ |
| Ga0311355_116686261 | 3300030580 | Palsa | AGAHHYHIVALALEELQRELGTEERAQLLAKLQEEIDRSGPTGSTST |
| Ga0311345_102569931 | 3300030688 | Bog | ADPKYSAAHHYHIVALALEELQRELTTEQRAGLLQKLQEEMRRSETE |
| Ga0302313_102337582 | 3300030693 | Palsa | GAHHYHIVALALEELQRELSTEQRAELLQKLLEEMRRSDHASGSSN |
| Ga0170834_1004157132 | 3300031057 | Forest Soil | AGAHHYHIVALALEELQRELSTEQRTELLQKLKEEMTRSESN |
| Ga0170824_1084542813 | 3300031231 | Forest Soil | AHHYHIVALALEELQRELTTDQRAQLLAKLQEEMNRAKPQ |
| Ga0302325_128186603 | 3300031234 | Palsa | IVALALEELQRELSTEQRAQLLAKLHEEIDRSMPSGSA |
| Ga0265325_105172621 | 3300031241 | Rhizosphere | KYAGAHHYHVVALALEELKRELTTEQRDQLLAKLLDEMHRDLPQC |
| Ga0302318_106523182 | 3300031258 | Bog | PKYSSAHHYHIVALALEELQRELTTEQRAGLLQKLQEEMRRSETE |
| Ga0302326_100706451 | 3300031525 | Palsa | TDPKFAGAHHYHIVALALEELQRELSTEQRTQLLQKLQEEMNGPNSQGQ |
| Ga0310686_1096890271 | 3300031708 | Soil | ITTDPRFAGAHHYHIVALALEELQRELSTEQRAQLLDKLQEEMRRSNPH |
| Ga0307474_100781071 | 3300031718 | Hardwood Forest Soil | IMALALEELKRELTTEQRAQLLQKLHDEMNPPNPK |
| Ga0307478_115425782 | 3300031823 | Hardwood Forest Soil | YHVMALALEELQRELSTEQRAQLLQKLQDEINRSTPTGSALE |
| Ga0306921_109013581 | 3300031912 | Soil | DPKFAGAHHYHIVALALEELKRELSTEQRAQLLEKLHEEMNRLNPQ |
| Ga0307479_116893062 | 3300031962 | Hardwood Forest Soil | NITTDPKFAGAHHYHIVALALEELQRELTTDQRTQLLEKLQEEMRRSNPN |
| Ga0307479_117000731 | 3300031962 | Hardwood Forest Soil | AHHYHVVALALEELQRELSTEQRAELLHKLQEEINRTSPSEPC |
| Ga0311301_122489231 | 3300032160 | Peatlands Soil | IVALALEELQRELTTEQRAALLQKLQEEMNGPNPQ |
| Ga0307471_1020117123 | 3300032180 | Hardwood Forest Soil | PKFAGAHHYHVVALALEELQRELSTEQRTQLLQKLHDEMNRSNPS |
| Ga0335085_104078511 | 3300032770 | Soil | DPKFAGAHHYHIVALALEELKQELSSDQRAQLLQKLHEEMERPNQQ |
| Ga0335082_114932931 | 3300032782 | Soil | HHYHIVALALEELKRELNTDQRNELLAKLTDEMNRDVPPKTDT |
| Ga0335078_112463154 | 3300032805 | Soil | HYHIVALALEELRRELSTEQRAELLEKLHEEMNRTRLQ |
| Ga0335078_116616841 | 3300032805 | Soil | DITTDPKFAGAHHYHIVALALEELQRELTTEQRAQLLQKLQEEMNRPNQQ |
| Ga0335081_102213691 | 3300032892 | Soil | TTDPKFAGAHHYHIVALALEELKRELSTEQRAELLQKLHDEMNRTDQQ |
| Ga0335083_104090623 | 3300032954 | Soil | DPKYAGAHHYHIVALALEELKRELNTDQRNELLAKLTDEMNRDVPPKTDT |
| Ga0335083_109944862 | 3300032954 | Soil | TADPKFAGAHHYHIVALALEELQRELTTEERAQLLQKLQEEMNRPNQQ |
| Ga0335084_104392704 | 3300033004 | Soil | HHYHIVALALEELQRELTSEQRAQLLQKLHDEMNRSNPQ |
| Ga0335077_116034873 | 3300033158 | Soil | HYHIVALALEELQRELTTEQRAQLLEKLHEEMNRSNPQ |
| Ga0335077_118914983 | 3300033158 | Soil | KDPKFAGAHHYHIVALALEELKRELTSEERIQLLEKLHEEMNRPNQ |
| Ga0370515_0084962_1225_1371 | 3300034163 | Untreated Peat Soil | FAGAHHYHIVALALEELQRELSTEQRAQLLQKLQEEIDRSGDTSCPTN |
| ⦗Top⦘ |