| Basic Information | |
|---|---|
| Family ID | F061226 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 132 |
| Average Sequence Length | 45 residues |
| Representative Sequence | LNLAIRRALYDVSLAQLAGLDAPPARLPALEREMKAAAARTRLR |
| Number of Associated Samples | 120 |
| Number of Associated Scaffolds | 132 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 99.24 % |
| % of genes from short scaffolds (< 2000 bps) | 90.91 % |
| Associated GOLD sequencing projects | 115 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.40 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (61.364 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (28.788 % of family members) |
| Environment Ontology (ENVO) | Unclassified (29.545 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (41.667 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 41.67% β-sheet: 0.00% Coil/Unstructured: 58.33% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.40 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 132 Family Scaffolds |
|---|---|---|
| PF01458 | SUFBD | 27.27 |
| PF00005 | ABC_tran | 4.55 |
| PF14528 | LAGLIDADG_3 | 1.52 |
| PF03313 | SDH_alpha | 0.76 |
| COG ID | Name | Functional Category | % Frequency in 132 Family Scaffolds |
|---|---|---|---|
| COG0719 | Fe-S cluster assembly scaffold protein SufB | Posttranslational modification, protein turnover, chaperones [O] | 27.27 |
| COG1760 | L-serine deaminase | Amino acid transport and metabolism [E] | 0.76 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 61.36 % |
| All Organisms | root | All Organisms | 38.64 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001166|JGI12694J13545_1003043 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Tolypothrichaceae → Tolypothrix → Tolypothrix campylonemoides → Tolypothrix campylonemoides VB511288 | 2117 | Open in IMG/M |
| 3300001867|JGI12627J18819_10372371 | Not Available | 579 | Open in IMG/M |
| 3300004092|Ga0062389_101853851 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Tolypothrichaceae → Tolypothrix → Tolypothrix campylonemoides → Tolypothrix campylonemoides VB511288 | 782 | Open in IMG/M |
| 3300004479|Ga0062595_100276046 | All Organisms → cellular organisms → Bacteria | 1113 | Open in IMG/M |
| 3300004479|Ga0062595_102250519 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 536 | Open in IMG/M |
| 3300004633|Ga0066395_10671311 | Not Available | 613 | Open in IMG/M |
| 3300005364|Ga0070673_101783693 | Not Available | 583 | Open in IMG/M |
| 3300005439|Ga0070711_100573596 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Tolypothrichaceae → Tolypothrix → Tolypothrix campylonemoides → Tolypothrix campylonemoides VB511288 | 938 | Open in IMG/M |
| 3300005467|Ga0070706_101704326 | Not Available | 574 | Open in IMG/M |
| 3300005526|Ga0073909_10239476 | Not Available | 802 | Open in IMG/M |
| 3300005538|Ga0070731_10486542 | Not Available | 821 | Open in IMG/M |
| 3300005545|Ga0070695_100693209 | Not Available | 808 | Open in IMG/M |
| 3300005548|Ga0070665_101933046 | Not Available | 596 | Open in IMG/M |
| 3300005548|Ga0070665_102372785 | Not Available | 533 | Open in IMG/M |
| 3300005563|Ga0068855_102525358 | Not Available | 511 | Open in IMG/M |
| 3300005577|Ga0068857_102317583 | Not Available | 527 | Open in IMG/M |
| 3300005602|Ga0070762_10070658 | All Organisms → cellular organisms → Bacteria | 1965 | Open in IMG/M |
| 3300005764|Ga0066903_105531150 | Not Available | 666 | Open in IMG/M |
| 3300005764|Ga0066903_107220827 | Not Available | 575 | Open in IMG/M |
| 3300005841|Ga0068863_101359368 | Not Available | 718 | Open in IMG/M |
| 3300005921|Ga0070766_11305790 | Not Available | 503 | Open in IMG/M |
| 3300006172|Ga0075018_10729500 | Not Available | 538 | Open in IMG/M |
| 3300006806|Ga0079220_11537790 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 573 | Open in IMG/M |
| 3300006954|Ga0079219_11537479 | Not Available | 605 | Open in IMG/M |
| 3300007258|Ga0099793_10583357 | Not Available | 559 | Open in IMG/M |
| 3300010043|Ga0126380_10208321 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Hydrogenophaga → unclassified Hydrogenophaga → Hydrogenophaga sp. T4 | 1316 | Open in IMG/M |
| 3300010049|Ga0123356_11992197 | Not Available | 724 | Open in IMG/M |
| 3300010322|Ga0134084_10092232 | Not Available | 956 | Open in IMG/M |
| 3300010343|Ga0074044_10808426 | Not Available | 612 | Open in IMG/M |
| 3300010358|Ga0126370_10693245 | Not Available | 894 | Open in IMG/M |
| 3300010358|Ga0126370_11255243 | Not Available | 692 | Open in IMG/M |
| 3300010366|Ga0126379_11143044 | Not Available | 885 | Open in IMG/M |
| 3300010373|Ga0134128_11226047 | Not Available | 827 | Open in IMG/M |
| 3300010376|Ga0126381_101484672 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Tolypothrichaceae → Tolypothrix → Tolypothrix campylonemoides → Tolypothrix campylonemoides VB511288 | 980 | Open in IMG/M |
| 3300010376|Ga0126381_103064879 | Not Available | 663 | Open in IMG/M |
| 3300010398|Ga0126383_10576881 | Not Available | 1193 | Open in IMG/M |
| 3300010401|Ga0134121_12448075 | Not Available | 563 | Open in IMG/M |
| 3300012971|Ga0126369_13173290 | Not Available | 538 | Open in IMG/M |
| 3300012986|Ga0164304_10384305 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Tolypothrichaceae → Tolypothrix → Tolypothrix campylonemoides → Tolypothrix campylonemoides VB511288 | 992 | Open in IMG/M |
| 3300013297|Ga0157378_11449853 | Not Available | 730 | Open in IMG/M |
| 3300013307|Ga0157372_12317176 | Not Available | 617 | Open in IMG/M |
| 3300014325|Ga0163163_12725756 | Not Available | 551 | Open in IMG/M |
| 3300015054|Ga0137420_1110665 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Tolypothrichaceae → Tolypothrix → Tolypothrix campylonemoides → Tolypothrix campylonemoides VB511288 | 1296 | Open in IMG/M |
| 3300015374|Ga0132255_102487282 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Prevotellaceae → Prevotella → environmental samples → Prevotella sp. CAG:1124 | 791 | Open in IMG/M |
| 3300016294|Ga0182041_11000000 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Tolypothrichaceae → Tolypothrix → Tolypothrix campylonemoides → Tolypothrix campylonemoides VB511288 | 756 | Open in IMG/M |
| 3300016387|Ga0182040_11334302 | Not Available | 606 | Open in IMG/M |
| 3300016445|Ga0182038_11844433 | Not Available | 546 | Open in IMG/M |
| 3300017927|Ga0187824_10302148 | Not Available | 567 | Open in IMG/M |
| 3300017930|Ga0187825_10190902 | Not Available | 735 | Open in IMG/M |
| 3300017947|Ga0187785_10259284 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 783 | Open in IMG/M |
| 3300017959|Ga0187779_11188880 | Not Available | 536 | Open in IMG/M |
| 3300018007|Ga0187805_10457290 | Not Available | 596 | Open in IMG/M |
| 3300018086|Ga0187769_10108960 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1997 | Open in IMG/M |
| 3300019273|Ga0187794_1640805 | Not Available | 521 | Open in IMG/M |
| 3300020076|Ga0206355_1431584 | Not Available | 524 | Open in IMG/M |
| 3300021168|Ga0210406_10887035 | Not Available | 672 | Open in IMG/M |
| 3300021171|Ga0210405_10299121 | All Organisms → cellular organisms → Bacteria | 1272 | Open in IMG/M |
| 3300021171|Ga0210405_11041292 | Not Available | 615 | Open in IMG/M |
| 3300021402|Ga0210385_10486872 | Not Available | 934 | Open in IMG/M |
| 3300021420|Ga0210394_10249784 | All Organisms → cellular organisms → Bacteria | 1552 | Open in IMG/M |
| 3300022525|Ga0242656_1024361 | Not Available | 928 | Open in IMG/M |
| 3300022910|Ga0247768_1055669 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Tolypothrichaceae → Tolypothrix → Tolypothrix campylonemoides → Tolypothrix campylonemoides VB511288 | 1233 | Open in IMG/M |
| 3300022917|Ga0247777_1032719 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1900 | Open in IMG/M |
| 3300023169|Ga0247762_1086515 | Not Available | 870 | Open in IMG/M |
| 3300025905|Ga0207685_10701639 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 551 | Open in IMG/M |
| 3300025906|Ga0207699_10134238 | All Organisms → cellular organisms → Bacteria | 1619 | Open in IMG/M |
| 3300025910|Ga0207684_11383564 | Not Available | 576 | Open in IMG/M |
| 3300025915|Ga0207693_10781985 | Not Available | 736 | Open in IMG/M |
| 3300025928|Ga0207700_10115889 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 2164 | Open in IMG/M |
| 3300025931|Ga0207644_10078714 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 2430 | Open in IMG/M |
| 3300025939|Ga0207665_10518899 | Not Available | 922 | Open in IMG/M |
| 3300025942|Ga0207689_11147579 | Not Available | 655 | Open in IMG/M |
| 3300025981|Ga0207640_12005088 | Not Available | 524 | Open in IMG/M |
| 3300026330|Ga0209473_1330558 | Not Available | 509 | Open in IMG/M |
| 3300026333|Ga0209158_1175054 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Tolypothrichaceae → Tolypothrix → Tolypothrix campylonemoides → Tolypothrix campylonemoides VB511288 | 773 | Open in IMG/M |
| 3300026547|Ga0209156_10381461 | Not Available | 595 | Open in IMG/M |
| 3300027297|Ga0208241_1014984 | Not Available | 1122 | Open in IMG/M |
| 3300027546|Ga0208984_1025799 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Tolypothrichaceae → Tolypothrix → Tolypothrix campylonemoides → Tolypothrix campylonemoides VB511288 | 1210 | Open in IMG/M |
| 3300027821|Ga0209811_10011063 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2900 | Open in IMG/M |
| 3300027867|Ga0209167_10249750 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Tolypothrichaceae → Tolypothrix → Tolypothrix campylonemoides → Tolypothrix campylonemoides VB511288 | 952 | Open in IMG/M |
| 3300028379|Ga0268266_10576679 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Tolypothrichaceae → Tolypothrix → Tolypothrix campylonemoides → Tolypothrix campylonemoides VB511288 | 1079 | Open in IMG/M |
| 3300028379|Ga0268266_11838753 | Not Available | 580 | Open in IMG/M |
| 3300028380|Ga0268265_11572258 | Not Available | 662 | Open in IMG/M |
| 3300030490|Ga0302184_10271130 | Not Available | 689 | Open in IMG/M |
| 3300030617|Ga0311356_11459298 | Not Available | 620 | Open in IMG/M |
| 3300031231|Ga0170824_101741708 | Not Available | 527 | Open in IMG/M |
| 3300031231|Ga0170824_105834946 | Not Available | 518 | Open in IMG/M |
| 3300031564|Ga0318573_10099523 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Tolypothrichaceae → Tolypothrix → Tolypothrix campylonemoides → Tolypothrix campylonemoides VB511288 | 1490 | Open in IMG/M |
| 3300031573|Ga0310915_10925340 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 610 | Open in IMG/M |
| 3300031590|Ga0307483_1011385 | Not Available | 789 | Open in IMG/M |
| 3300031640|Ga0318555_10718966 | Not Available | 539 | Open in IMG/M |
| 3300031679|Ga0318561_10547400 | Not Available | 637 | Open in IMG/M |
| 3300031680|Ga0318574_10377928 | Not Available | 827 | Open in IMG/M |
| 3300031713|Ga0318496_10035935 | Not Available | 2524 | Open in IMG/M |
| 3300031718|Ga0307474_10099238 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans | 2176 | Open in IMG/M |
| 3300031723|Ga0318493_10107685 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Tolypothrichaceae → Tolypothrix → Tolypothrix campylonemoides → Tolypothrix campylonemoides VB511288 | 1406 | Open in IMG/M |
| 3300031747|Ga0318502_10098484 | Not Available | 1618 | Open in IMG/M |
| 3300031751|Ga0318494_10572712 | Not Available | 660 | Open in IMG/M |
| 3300031763|Ga0318537_10047730 | All Organisms → cellular organisms → Bacteria | 1549 | Open in IMG/M |
| 3300031769|Ga0318526_10372884 | Not Available | 583 | Open in IMG/M |
| 3300031771|Ga0318546_10731299 | Not Available | 696 | Open in IMG/M |
| 3300031779|Ga0318566_10014375 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3382 | Open in IMG/M |
| 3300031781|Ga0318547_10663509 | Not Available | 648 | Open in IMG/M |
| 3300031798|Ga0318523_10089472 | Not Available | 1500 | Open in IMG/M |
| 3300031805|Ga0318497_10822528 | Not Available | 521 | Open in IMG/M |
| 3300031819|Ga0318568_10588786 | Not Available | 693 | Open in IMG/M |
| 3300031833|Ga0310917_10543316 | Not Available | 790 | Open in IMG/M |
| 3300031846|Ga0318512_10092582 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium | 1412 | Open in IMG/M |
| 3300031890|Ga0306925_10017787 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans | 7031 | Open in IMG/M |
| 3300031890|Ga0306925_10543846 | All Organisms → cellular organisms → Bacteria | 1232 | Open in IMG/M |
| 3300031910|Ga0306923_11342273 | Not Available | 756 | Open in IMG/M |
| 3300031941|Ga0310912_10090836 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2233 | Open in IMG/M |
| 3300031941|Ga0310912_10275597 | Not Available | 1299 | Open in IMG/M |
| 3300031962|Ga0307479_10341902 | All Organisms → cellular organisms → Bacteria | 1479 | Open in IMG/M |
| 3300031981|Ga0318531_10185548 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Tolypothrichaceae → Tolypothrix → Tolypothrix campylonemoides → Tolypothrix campylonemoides VB511288 | 936 | Open in IMG/M |
| 3300032010|Ga0318569_10065218 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Tolypothrichaceae → Tolypothrix → Tolypothrix campylonemoides → Tolypothrix campylonemoides VB511288 | 1603 | Open in IMG/M |
| 3300032035|Ga0310911_10192227 | Not Available | 1159 | Open in IMG/M |
| 3300032051|Ga0318532_10035786 | All Organisms → cellular organisms → Bacteria | 1672 | Open in IMG/M |
| 3300032051|Ga0318532_10159295 | Not Available | 802 | Open in IMG/M |
| 3300032052|Ga0318506_10052927 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans | 1643 | Open in IMG/M |
| 3300032063|Ga0318504_10463154 | Not Available | 606 | Open in IMG/M |
| 3300032064|Ga0318510_10174588 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Tolypothrichaceae → Tolypothrix → Tolypothrix campylonemoides → Tolypothrix campylonemoides VB511288 | 858 | Open in IMG/M |
| 3300032066|Ga0318514_10021734 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 2923 | Open in IMG/M |
| 3300032066|Ga0318514_10547103 | Not Available | 616 | Open in IMG/M |
| 3300032076|Ga0306924_10660024 | All Organisms → cellular organisms → Bacteria | 1178 | Open in IMG/M |
| 3300032090|Ga0318518_10462619 | Not Available | 650 | Open in IMG/M |
| 3300032126|Ga0307415_102466012 | Not Available | 512 | Open in IMG/M |
| 3300032180|Ga0307471_100561333 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Tolypothrichaceae → Tolypothrix → Tolypothrix campylonemoides → Tolypothrix campylonemoides VB511288 | 1297 | Open in IMG/M |
| 3300032895|Ga0335074_10536382 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Tolypothrichaceae → Tolypothrix → Tolypothrix campylonemoides → Tolypothrix campylonemoides VB511288 | 1197 | Open in IMG/M |
| 3300032898|Ga0335072_10138894 | All Organisms → cellular organisms → Bacteria | 3007 | Open in IMG/M |
| 3300032955|Ga0335076_10410265 | All Organisms → cellular organisms → Bacteria | 1239 | Open in IMG/M |
| 3300033134|Ga0335073_10178091 | All Organisms → cellular organisms → Bacteria | 2663 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 28.79% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 6.82% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 6.06% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 5.30% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 4.55% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 3.03% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 3.03% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 3.03% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 3.03% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 2.27% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 2.27% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 2.27% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 2.27% |
| Plant Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter | 2.27% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 2.27% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 1.52% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.52% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.52% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.52% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.52% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 1.52% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 1.52% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.52% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.76% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.76% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.76% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.76% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.76% |
| Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 0.76% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.76% |
| Termite Gut | Host-Associated → Arthropoda → Digestive System → Gut → Unclassified → Termite Gut | 0.76% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.76% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.76% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 0.76% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.76% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.76% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.76% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001166 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_O2 | Environmental | Open in IMG/M |
| 3300001867 | Texas A ecozone_OM1H0_M2 (Combined assembly for Texas A ecozone Site metagenome samples, ASSEMBLY_DATE=20130705) | Environmental | Open in IMG/M |
| 3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300004633 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio | Environmental | Open in IMG/M |
| 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005526 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 | Environmental | Open in IMG/M |
| 3300005538 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 | Environmental | Open in IMG/M |
| 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Environmental | Open in IMG/M |
| 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Host-Associated | Open in IMG/M |
| 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Host-Associated | Open in IMG/M |
| 3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
| 3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
| 3300006172 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2014 | Environmental | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Host-Associated | Open in IMG/M |
| 3300010322 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010343 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012986 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG | Environmental | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
| 3300015054 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300017927 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_4 | Environmental | Open in IMG/M |
| 3300017930 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_5 | Environmental | Open in IMG/M |
| 3300017947 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_4_20_MG | Environmental | Open in IMG/M |
| 3300017959 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG | Environmental | Open in IMG/M |
| 3300018007 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_5 | Environmental | Open in IMG/M |
| 3300018086 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MG | Environmental | Open in IMG/M |
| 3300019273 | Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021402 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300022525 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-4-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022910 | Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L016-104C-6 | Environmental | Open in IMG/M |
| 3300022917 | Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L154-409C-5 | Environmental | Open in IMG/M |
| 3300023169 | Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L081-202R-4 | Environmental | Open in IMG/M |
| 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026330 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 (SPAdes) | Environmental | Open in IMG/M |
| 3300026333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 (SPAdes) | Environmental | Open in IMG/M |
| 3300026547 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 (SPAdes) | Environmental | Open in IMG/M |
| 3300027297 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF047 (SPAdes) | Environmental | Open in IMG/M |
| 3300027546 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM3_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027821 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027867 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300030490 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_N3_3 | Environmental | Open in IMG/M |
| 3300030617 | II_Palsa_N2 coassembly | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031564 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21 | Environmental | Open in IMG/M |
| 3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
| 3300031590 | Metatranscriptome of hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031640 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23 | Environmental | Open in IMG/M |
| 3300031679 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23 | Environmental | Open in IMG/M |
| 3300031680 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22 | Environmental | Open in IMG/M |
| 3300031713 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22 | Environmental | Open in IMG/M |
| 3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
| 3300031723 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23 | Environmental | Open in IMG/M |
| 3300031747 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22 | Environmental | Open in IMG/M |
| 3300031751 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24 | Environmental | Open in IMG/M |
| 3300031763 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f29 | Environmental | Open in IMG/M |
| 3300031769 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f24 | Environmental | Open in IMG/M |
| 3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
| 3300031779 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f22 | Environmental | Open in IMG/M |
| 3300031781 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20 | Environmental | Open in IMG/M |
| 3300031798 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f19 | Environmental | Open in IMG/M |
| 3300031805 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23 | Environmental | Open in IMG/M |
| 3300031819 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21 | Environmental | Open in IMG/M |
| 3300031833 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178 | Environmental | Open in IMG/M |
| 3300031846 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f19 | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300031981 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f25 | Environmental | Open in IMG/M |
| 3300032010 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f22 | Environmental | Open in IMG/M |
| 3300032035 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170 | Environmental | Open in IMG/M |
| 3300032051 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f26 | Environmental | Open in IMG/M |
| 3300032052 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f19 | Environmental | Open in IMG/M |
| 3300032063 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f17 | Environmental | Open in IMG/M |
| 3300032064 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f17 | Environmental | Open in IMG/M |
| 3300032066 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f18 | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032090 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f22 | Environmental | Open in IMG/M |
| 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Host-Associated | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032895 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.3 | Environmental | Open in IMG/M |
| 3300032898 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.1 | Environmental | Open in IMG/M |
| 3300032955 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5 | Environmental | Open in IMG/M |
| 3300033134 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI12694J13545_10030431 | 3300001166 | Forest Soil | VSLAQLAGLDAAPARLPALEREMKAVATRAPARS* |
| JGI12627J18819_103723711 | 3300001867 | Forest Soil | RRALYDVSLAQLAGLDTPPGRLPTLEREMKAAAARTRLR* |
| Ga0062389_1018538511 | 3300004092 | Bog Forest Soil | RVWQRLNLAIRRALYDISLAQLAGLDAPPARLPTLEREMKAAASRTPVRS* |
| Ga0062595_1002760462 | 3300004479 | Soil | LAIRRSLNDVSLAQLAGLEAAPARLPTLEREMKAVGSRTPVRS* |
| Ga0062595_1022505191 | 3300004479 | Soil | GQCEIEETCRVGRVWQRLNLAIRRALYDVTLAQLAGLDAPPARLPTLEREMKAAAARTPLRQRTEFNT* |
| Ga0066395_106713111 | 3300004633 | Tropical Forest Soil | VWQRLNLAIRRALYDVSLAQLAGLDAAPARLPALEREMKAAATRTPVRS* |
| Ga0070673_1017836932 | 3300005364 | Switchgrass Rhizosphere | RRSLNDVSLAQLAGLEAAPARLPTLEREMKAVGSRTPVRS* |
| Ga0070711_1005735961 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | VGRVWQRLNLAIRRALYDVTLAQLAGLDAPPARLPTLEREMKAAALRTRLR* |
| Ga0070706_1017043262 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | RLNLAIRRSLHDVSLAQLAGLDAAPARLPALERDMKAAAARPPVRS* |
| Ga0073909_102394762 | 3300005526 | Surface Soil | WQRLNLAILRTLHDVSLAQLAGLDAPPARLATLEREMKAAAARTPLR* |
| Ga0070731_104865422 | 3300005538 | Surface Soil | LYDVNLAQLAGLESAPARLPTLEREMKAGTRTPARS* |
| Ga0070695_1006932091 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | VWQRLNLAILRALHDVSLAQLAGLDAPPARLATLEREMKAAAARTPLR* |
| Ga0070665_1019330461 | 3300005548 | Switchgrass Rhizosphere | KSCRVGHAWQRLNLTIRRSLHEVTLAQLAGIDQSQPRVLALERDMKAAAARAQSRSS* |
| Ga0070665_1023727852 | 3300005548 | Switchgrass Rhizosphere | RRSLHEVSLAQLAGLAAEPPRVLALERDMKAAAARPLSRS* |
| Ga0068855_1025253581 | 3300005563 | Corn Rhizosphere | RLNLAIRRSLYDVSLAQLAGIDPTQVTLPALERDMKAAATRAPVRA* |
| Ga0068857_1023175831 | 3300005577 | Corn Rhizosphere | VGHAWQRLNLTIRRSLHEVSLAQLAGLAVEPPRVLALERDMKAAAARPLSRS* |
| Ga0070762_100706581 | 3300005602 | Soil | SLNDVSLAQLAGLDAAPSRLPTLEREMKLAASRHPVRS* |
| Ga0066903_1055311502 | 3300005764 | Tropical Forest Soil | LAMRRALYEVSLAQLAGLDATPARLPGLEREMKAAATRTQVRS* |
| Ga0066903_1072208271 | 3300005764 | Tropical Forest Soil | LNLAIRRALYDVSLAQLAGLDAPPARLPSLERDMKAAASRTRVPS* |
| Ga0068863_1013593681 | 3300005841 | Switchgrass Rhizosphere | HEVSLAQLAGIDQSTLRVLALERDMKAAAARAQSRST* |
| Ga0070766_113057901 | 3300005921 | Soil | SLYDVSLAQLAGLEAAPARLPALEREMKAAASRTPVRA* |
| Ga0075018_107295001 | 3300006172 | Watersheds | VWQRLNLAIRRALYDVSLAQLAGLDAAPARFMTLEREMKTVGTRPPSRT* |
| Ga0079220_115377902 | 3300006806 | Agricultural Soil | EETCRVGRVWQRLNLAIRRSLYDVSLAQLAGIDPTQVTLPALERDMKAAATRTLVRS* |
| Ga0079219_115374791 | 3300006954 | Agricultural Soil | NLTIRRSLHEVSLAQLAGLAAEPPRVLALERDMKAAAARPLSRS* |
| Ga0099793_105833571 | 3300007258 | Vadose Zone Soil | LYEVSLAQLAGLEAAPARLPALEREMKAAAARAPVRS* |
| Ga0126380_102083212 | 3300010043 | Tropical Forest Soil | RVRRVWQRLNLAIRRALYDVSLAQLAGLDAPPARLPALEREMKAAARTPLR* |
| Ga0123356_119921971 | 3300010049 | Termite Gut | RLNLAIRRALYDVSLAQLAGLDAPPARLPTLERDMKAAATRTPFVSDRSHE* |
| Ga0134084_100922322 | 3300010322 | Grasslands Soil | EVSLAQLAGLEAAPARLPALEREMKAAAARAPVRS* |
| Ga0074044_108084261 | 3300010343 | Bog Forest Soil | CRVGRVWQRLNLAIRRALYDISLAQLAGLDAPPVRLPTLEREMKAAASRAPVRS* |
| Ga0126370_106932451 | 3300010358 | Tropical Forest Soil | RVGRVWQRLNLAIRRALYDVSLAQLAGLDAPPARLATLEREMKAAGARTPLR* |
| Ga0126370_112552432 | 3300010358 | Tropical Forest Soil | ALYDVSLAQLAGLDAPPARLPALEREMKAAARTPLR* |
| Ga0126379_111430442 | 3300010366 | Tropical Forest Soil | NLAIRRALYEVSLAQLAGLDAPPARLATLEREMKAAGARTPVR* |
| Ga0134128_112260471 | 3300010373 | Terrestrial Soil | RLNVTIRRSLHEVTLAQLAGLDVAQPRVLAHERDMKAAAARPVSRS* |
| Ga0126381_1014846722 | 3300010376 | Tropical Forest Soil | RALYEVSLAQLAGLDAPPARLPALEREMKAAAARTPLRQERIQRNE* |
| Ga0126381_1030648791 | 3300010376 | Tropical Forest Soil | GRVWQRLNLAIRRALYDVSLAQLAGLDSAPARLPSLERDMKAAASRTRASS* |
| Ga0126383_105768811 | 3300010398 | Tropical Forest Soil | IRRALYEVSLAQLAGLDAPPARLATLEREMKAAGARTPVR* |
| Ga0134121_124480752 | 3300010401 | Terrestrial Soil | FEKSCRVGHAWQRLNLTIRRSLHEVSLAQLAGIDQSSLRVLALERDMKAAAARAQSRST* |
| Ga0126369_131732902 | 3300012971 | Tropical Forest Soil | SRVWQRLNLAMRRALYDVSLAQLAGLDAAPARLPGLEREMKAAATRTQVRS* |
| Ga0164304_103843052 | 3300012986 | Soil | LNLAIRRSLNDVSLAQLAGLEAAPARLPTLEREMKAVGSRSPVRS* |
| Ga0157378_114498532 | 3300013297 | Miscanthus Rhizosphere | QRLNLTIRRSLHEVSLAQLAGLAAEPPRVLALERDMKAAAARPLSRS* |
| Ga0157372_123171762 | 3300013307 | Corn Rhizosphere | LYEISLAQLAGIDATQVRLPALEREMKITASRAPVR* |
| Ga0163163_127257562 | 3300014325 | Switchgrass Rhizosphere | GHAWQRLNLTIRRSLHEVSLAQLAGIDQSTLRVLALERDMKAAAARAQSRST* |
| Ga0137420_11106652 | 3300015054 | Vadose Zone Soil | SLYEVSLAQLAGLDAAPARLPALEREMKAAAARAPVRS* |
| Ga0132255_1024872822 | 3300015374 | Arabidopsis Rhizosphere | LNDVSLAQLAGLEAAPARLPTLEREMKAVGSRTPVRS* |
| Ga0182041_110000002 | 3300016294 | Soil | RRALYEVSLAQLAGLDAPPARLPALEREMKAAAARSPLR |
| Ga0182040_113343022 | 3300016387 | Soil | VWQRLNLAIRRALYDVSLAQLAGLDAPPARLPALEREMKAAAARTRLR |
| Ga0182038_118444331 | 3300016445 | Soil | ALYDVSLAQLAGLDAPPARLPALEREMKAAAARTRLR |
| Ga0187824_103021482 | 3300017927 | Freshwater Sediment | DIAPTLAQLAGLEGAPARLPALEREMKAAASRAPAR |
| Ga0187825_101909021 | 3300017930 | Freshwater Sediment | SRVWQRLNLAMRRALYDVSLAQLAGLDAAPARLPALEREMKAAAGRTQARS |
| Ga0187785_102592841 | 3300017947 | Tropical Peatland | EIEETCRVGRVWQRLNLAIRRALYEVTLAQLAGLDAPPARLPTLEREMKSAALRTRLR |
| Ga0187779_111888801 | 3300017959 | Tropical Peatland | LNLAIRRGLYDVSLAQLAGLDAAPSRLPALEREMKAAAGRSPARS |
| Ga0187805_104572901 | 3300018007 | Freshwater Sediment | ALYEVSLAQLAGLDAAPARLPALEREMKSVASRAPLR |
| Ga0187769_101089603 | 3300018086 | Tropical Peatland | RALYDVSLAQLAGLDAAPARLPALEREMKAAAGRTPARS |
| Ga0187794_16408052 | 3300019273 | Peatland | RVWQRLNLAMRRALYDVSLAQLAGLDTTPARLPGLEREMKAAAGRTQVRS |
| Ga0206355_14315841 | 3300020076 | Corn, Switchgrass And Miscanthus Rhizosphere | IEETCRVGRVWQRLNLAIRRSLYDVSLAQLAGIDTTHLALPALERDLKAAATRAPVRP |
| Ga0210406_108870351 | 3300021168 | Soil | EIEETCRVGRVWQRLNLAIRRSLYDVSLAQLAGIDSSHVRLPALEREVKLATPRTPVRS |
| Ga0210405_102991211 | 3300021171 | Soil | ETCRVSRVWQRLNLAIRRALYDVSLAQLAGLEGAPTRLPTLERDMKAAGRAPVRS |
| Ga0210405_110412921 | 3300021171 | Soil | RLNLAIRRSLYDVSLAQLAGLEAAPARLPALEREMKAAASRTPVRA |
| Ga0210385_104868721 | 3300021402 | Soil | CRVSRVWQRLNLAIRRALYDVSLAQLAGLEGAPTRLPTLERDMKAAAGRAPVRS |
| Ga0210394_102497841 | 3300021420 | Soil | VSRVWQRLSLALRRGLYDVSLAQLAGLDAVPARLPALEREMKAAASRTQARS |
| Ga0242656_10243611 | 3300022525 | Soil | SLYEVSLAQLAGLDAAPARLPALEREMKAAAARAPVRS |
| Ga0247768_10556692 | 3300022910 | Plant Litter | EVSLAQLAGIDHSQPRVLALERDMKAAAARAQSRSS |
| Ga0247777_10327193 | 3300022917 | Plant Litter | GHAWQRLNVTIRRSLREVSLAQLAGFDSNQPRVLALERDMKAAAARAQSRS |
| Ga0247762_10865152 | 3300023169 | Plant Litter | GYEKSCRVGHAWQRLNLTIRRSLHEVSLAQLAGIDASQPRVLALERDMKAAAARAQSRS |
| Ga0207685_107016392 | 3300025905 | Corn, Switchgrass And Miscanthus Rhizosphere | GHGQCEIEETCRVGRVWQRLNLAIRRALYDVTLAQLAGLDAPPARLPTLEREMKAAALRTRLR |
| Ga0207699_101342381 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | RVWQRLNLAIRRSLNDVSLAQLAGLEAAPARLPTLEREMKAVGSRTPVRS |
| Ga0207684_113835641 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | RLNLAIRRSLHDVSLAQLAGLDAAPARLPALERDMKAAAARPPVRS |
| Ga0207693_107819852 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | LNLAILRALHDVSLAQLAGLDAPPARLATLEREMKAAAARTPLR |
| Ga0207700_101158893 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | TVSLAQLAGLEAAPARLPTLEREMKAVGSRTPVRS |
| Ga0207644_100787141 | 3300025931 | Switchgrass Rhizosphere | AIRRSLNDVSLAQLAGLEAAPARLPTLEREMKAVGSRTPVRS |
| Ga0207665_105188992 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | TCRVGRVWQRLNLAIRRALYDVTLAQLAGLDAPPARLPTLEREMKAAALRTPLR |
| Ga0207689_111475792 | 3300025942 | Miscanthus Rhizosphere | LHEVSLAQLAGIDQSTLRVLALERDMKAAAARAQSRST |
| Ga0207640_120050882 | 3300025981 | Corn Rhizosphere | SLHEVSLAQLAGLDPTQPRVLAHERDMKAAAARPVSRS |
| Ga0209473_13305581 | 3300026330 | Soil | NLAFRRSLYEVSLAQLAGLEAAPARLPALEREMKAAARS |
| Ga0209158_11750542 | 3300026333 | Soil | RALYDVSLAQLAGLDAAPARLPALEREMKAAASRAPSRS |
| Ga0209156_103814612 | 3300026547 | Soil | VWQRLNLAIRRALYDVSLAQLAGLDAAPARLPALEREMKAAAARAPSRS |
| Ga0208241_10149842 | 3300027297 | Forest Soil | LAIRRALYDVTLAQLAGIDAAPARLPALEREMKAAAGRVPAR |
| Ga0208984_10257991 | 3300027546 | Forest Soil | LNLAFRRSLYEVSLAQLAGLDAPPARLPALEREMKVAAARAPVRS |
| Ga0209811_100110632 | 3300027821 | Surface Soil | VWQRLNLAIRRSLNDVSLAQLAGLEAAPARLPTLEREMKAVGSRTPVRS |
| Ga0209167_102497501 | 3300027867 | Surface Soil | IRRSLHEVSLAQLAGLDVAPVRWPTLEREMKAAAVRPPVRS |
| Ga0268266_105766791 | 3300028379 | Switchgrass Rhizosphere | LNLAIRRSLNDVSLAQLAGLEAAPARLPTLEREMKAVGSRTPVRS |
| Ga0268266_118387532 | 3300028379 | Switchgrass Rhizosphere | LTIRRSLHEVSLAQLAGLAAEPPRVLALERDMKAAAARPLSRS |
| Ga0268265_115722581 | 3300028380 | Switchgrass Rhizosphere | CRVGHAWQRLNLTIRRSLHEVSLAQLAGLAAEPPRVLALERDMKAAASRPLSRS |
| Ga0302184_102711302 | 3300030490 | Palsa | RRALYDVSLAQLAGLDAVPARLPTLEREMKAATSRPPART |
| Ga0311356_114592982 | 3300030617 | Palsa | CRVGRVWQRLNLAIRRALYDVSLAQLAGLDAPPARLPTLEREMKSAASRTPARS |
| Ga0170824_1017417082 | 3300031231 | Forest Soil | DVSLAQLAGLEAAPARLPALEREMKAAASRTAVRA |
| Ga0170824_1058349461 | 3300031231 | Forest Soil | GRVWQRLNLAIRKSLYDITLAQLAGIDTTLIDSPQAPLPALEREMKAVASTRAPVR |
| Ga0318573_100995232 | 3300031564 | Soil | GRVWQRLNLAIRRALYDVSLAQLAGLDAPPARLPALEREMKAAATRTRLR |
| Ga0310915_109253401 | 3300031573 | Soil | GQCDIEESCRVGRVWQRLNLAIRRALYEVTLAQLAGLDAPPARLPALEREMKAAATRTPL |
| Ga0307483_10113851 | 3300031590 | Hardwood Forest Soil | GSCRVSRVWQRLNLAIRRALYDVSLAQLAGLDAAPARLPALEREMKAAASRAPARS |
| Ga0318555_107189661 | 3300031640 | Soil | VGRVWQRLNLAIRRALYEVTLAQLAGLDAPPARLPALEREMKAAATRTPLR |
| Ga0318561_105474001 | 3300031679 | Soil | YEVSLAQLAGLDAPPARLPALEREMKAAAARNPLR |
| Ga0318574_103779281 | 3300031680 | Soil | NLAIRRALYDVSLAQLAGLDAPPARLPALEREMKAAAARTRLR |
| Ga0318496_100359354 | 3300031713 | Soil | VWQRLNLAIRRALYEVTLAQLAGLDAPPARLPALEREMKAAATRTPLR |
| Ga0307474_100992383 | 3300031718 | Hardwood Forest Soil | LNLAIRRALYDVSLAQLAGLDAPPARLPTLERDMKAAARTPVRS |
| Ga0318493_101076852 | 3300031723 | Soil | AMRRALYEVSLAQLAGLDAPPARLPALEREMKAAAARSPLR |
| Ga0318502_100984841 | 3300031747 | Soil | ALYEVSLAQLAGLDAPPARLPALEREMKAAAARNPLR |
| Ga0318494_105727121 | 3300031751 | Soil | RALYEVSLAQLAGLDAPPARLPALEREMKAAAARSPLR |
| Ga0318537_100477302 | 3300031763 | Soil | ALYDVSLAQLAGLDAPPARLTALEREMKAAATRTPLR |
| Ga0318526_103728842 | 3300031769 | Soil | QRLNLAIRRALYDVSLAQLAGLDAPPARLTALEREMKAAATRTPLR |
| Ga0318546_107312992 | 3300031771 | Soil | LNLAIRRALYDVSLAQLAGLDAAPARLPSLERDMKAAAARTRLR |
| Ga0318566_100143754 | 3300031779 | Soil | LYEVSLAQLAGLDAPPARLPALEREMKAAAARSPLR |
| Ga0318547_106635091 | 3300031781 | Soil | ALYDVSLAQLAGLDTAPARLPSLERDMKAAASRTRVSS |
| Ga0318523_100894722 | 3300031798 | Soil | YEVSLAQLAGLDAPPARLPALEREMKAAGARSPLR |
| Ga0318497_108225281 | 3300031805 | Soil | RVGRVWQRLNLAIRRALYDVSLAQLAGLDAAPARLPSLEREMKAAAVRTPLR |
| Ga0318568_105887862 | 3300031819 | Soil | IRRALYDVSLAQLAGLDAPPARLATLEREMKAAAARTPVR |
| Ga0310917_105433162 | 3300031833 | Soil | NLAIRRALYDVSLAQLAGLDAAPARLPSLERDMKAAAARTRLR |
| Ga0318512_100925823 | 3300031846 | Soil | LYDVSLAQLAGLDAPPARLPALEREMKAAAARTRLR |
| Ga0306925_100177871 | 3300031890 | Soil | LNLAIRRALYDVSLAQLAGLDAPPARLTALEREMKAAATRTPLR |
| Ga0306925_105438461 | 3300031890 | Soil | ALYDVSLAQLAGLDAAPARLPSLEREMKAAAVRTPLR |
| Ga0306923_113422731 | 3300031910 | Soil | RALYDVSLAQLAGLDAPPARLPALEREMKAAAARTRLR |
| Ga0310912_100908361 | 3300031941 | Soil | LNLAIRRALYDVSLAQLAGLDAPPARLPALEREMKAAAARTRLR |
| Ga0310912_102755972 | 3300031941 | Soil | RALYEVSLAQLAGLDAPPARLPALEREMKAAAARNPLR |
| Ga0307479_103419022 | 3300031962 | Hardwood Forest Soil | RRALYDVSLAQLAGIDAAPARLPALEREMKAAAGRTQARS |
| Ga0318531_101855482 | 3300031981 | Soil | YEVSLAQLAGLDAPPARLPALEREMKAAAARSPLR |
| Ga0318569_100652181 | 3300032010 | Soil | YDVSLAQLAGLDAPPARLPALEREMKAAATRTRLR |
| Ga0310911_101922272 | 3300032035 | Soil | ALYEVSLAQLAGLDAPPARLPALEREMKAAAARTPVR |
| Ga0318532_100357862 | 3300032051 | Soil | IRRALYDVSLAQLAGLDAPPARLTALEREMKAAATRTPLR |
| Ga0318532_101592952 | 3300032051 | Soil | VGRVWQRLNLAIRRALYDVSLAQLAGLDAAPARLPSLERDMKAAAARTRLR |
| Ga0318506_100529271 | 3300032052 | Soil | CDIEESCRVGRVWQRLNLAIRRALYEVTLAQLAGLDAPPARLPALEREMKAAATRTPLR |
| Ga0318504_104631542 | 3300032063 | Soil | IRRALYDVSLAQLAGLDAAPARLPSLEREMKAAAVRTPLR |
| Ga0318510_101745882 | 3300032064 | Soil | WQRLNLAIRRALYDVSLAQLAGLDAPPARLPALEREMKAAATRTRLR |
| Ga0318514_100217341 | 3300032066 | Soil | RALYEVTLAQLAGLDAPPARLPALEREMKAAATRTPLR |
| Ga0318514_105471031 | 3300032066 | Soil | LYDVSLAQLAGLDAPPARLATLEREMKAAAARTPVR |
| Ga0306924_106600242 | 3300032076 | Soil | RLNLAIRRALYDVSLAQLAGLDAAPARLPSLEREMKAAAVRTPLR |
| Ga0318518_104626192 | 3300032090 | Soil | YEVTLAQLAGLDAPPARLPALEREMKAAATRTPLR |
| Ga0307415_1024660122 | 3300032126 | Rhizosphere | LTIRRSLHEVSLAQLAGLDASQPRVLALERDMKAAAARAQSRS |
| Ga0307471_1005613332 | 3300032180 | Hardwood Forest Soil | GRVWQRLNLAILRALHDVSLAQLAGLDAPPARLATLEREMKAAAARTPLR |
| Ga0335074_105363821 | 3300032895 | Soil | LNLAIRRSLYDVSLAQLAGIDTTQVTLPALERDMKAAAARTPVRS |
| Ga0335072_101388941 | 3300032898 | Soil | HGNCEIEESCRVSRVWQRLNLAIRRALYDVTLAQLAGLEGAPARLPALEREMKAAASRAPAR |
| Ga0335076_104102651 | 3300032955 | Soil | GNCEIEESCRVSRVWQRLNLAIRRALYDVTLAQLAGLEGAPARLPALEREMKAAASRAPA |
| Ga0335073_101780912 | 3300033134 | Soil | HDVSLAQLAGIDPTQVTLPALERDMKAAATRTPIRS |
| ⦗Top⦘ |