| Basic Information | |
|---|---|
| Family ID | F061224 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 132 |
| Average Sequence Length | 43 residues |
| Representative Sequence | YDLAPTILHIYGIEQPAQMRGHVLSEIFENSDNKVAQK |
| Number of Associated Samples | 117 |
| Number of Associated Scaffolds | 132 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.76 % |
| % of genes near scaffold ends (potentially truncated) | 96.21 % |
| % of genes from short scaffolds (< 2000 bps) | 92.42 % |
| Associated GOLD sequencing projects | 111 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.30 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (96.970 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (19.697 % of family members) |
| Environment Ontology (ENVO) | Unclassified (25.758 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (44.697 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 33.33% β-sheet: 0.00% Coil/Unstructured: 66.67% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.30 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 132 Family Scaffolds |
|---|---|---|
| PF14559 | TPR_19 | 49.24 |
| PF13432 | TPR_16 | 17.42 |
| PF12867 | DinB_2 | 8.33 |
| PF00884 | Sulfatase | 4.55 |
| PF02129 | Peptidase_S15 | 2.27 |
| PF00171 | Aldedh | 1.52 |
| PF00106 | adh_short | 0.76 |
| PF13088 | BNR_2 | 0.76 |
| PF01261 | AP_endonuc_2 | 0.76 |
| PF13181 | TPR_8 | 0.76 |
| PF01663 | Phosphodiest | 0.76 |
| PF07676 | PD40 | 0.76 |
| PF13358 | DDE_3 | 0.76 |
| PF16918 | PknG_TPR | 0.76 |
| PF14686 | fn3_3 | 0.76 |
| COG ID | Name | Functional Category | % Frequency in 132 Family Scaffolds |
|---|---|---|---|
| COG0014 | Gamma-glutamyl phosphate reductase | Amino acid transport and metabolism [E] | 1.52 |
| COG1012 | Acyl-CoA reductase or other NAD-dependent aldehyde dehydrogenase | Lipid transport and metabolism [I] | 1.52 |
| COG4230 | Delta 1-pyrroline-5-carboxylate dehydrogenase | Amino acid transport and metabolism [E] | 1.52 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 97.73 % |
| Unclassified | root | N/A | 2.27 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2199352024|deeps__Contig_128341 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 761 | Open in IMG/M |
| 3300001593|JGI12635J15846_10386806 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Thermococci → Thermococcales → Thermococcaceae → Thermococcus → unclassified Thermococcus → Thermococcus sp. 4557 | 848 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_101452089 | All Organisms → cellular organisms → Bacteria | 580 | Open in IMG/M |
| 3300004082|Ga0062384_101010442 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 595 | Open in IMG/M |
| 3300004152|Ga0062386_100750574 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → Anaerolineales → Anaerolineaceae → unclassified Anaerolineaceae → Anaerolineaceae bacterium | 802 | Open in IMG/M |
| 3300004635|Ga0062388_100496009 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1091 | Open in IMG/M |
| 3300005434|Ga0070709_10608831 | All Organisms → cellular organisms → Bacteria | 842 | Open in IMG/M |
| 3300005436|Ga0070713_101856606 | All Organisms → cellular organisms → Bacteria | 585 | Open in IMG/M |
| 3300005451|Ga0066681_10961194 | All Organisms → cellular organisms → Bacteria | 510 | Open in IMG/M |
| 3300005542|Ga0070732_10450528 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 778 | Open in IMG/M |
| 3300005586|Ga0066691_10924386 | All Organisms → cellular organisms → Bacteria | 513 | Open in IMG/M |
| 3300005712|Ga0070764_10079204 | All Organisms → cellular organisms → Bacteria | 1727 | Open in IMG/M |
| 3300005952|Ga0080026_10043847 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1157 | Open in IMG/M |
| 3300006102|Ga0075015_100759872 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 579 | Open in IMG/M |
| 3300006172|Ga0075018_10754509 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 530 | Open in IMG/M |
| 3300006755|Ga0079222_10872741 | All Organisms → cellular organisms → Bacteria | 749 | Open in IMG/M |
| 3300006794|Ga0066658_10051857 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1766 | Open in IMG/M |
| 3300006800|Ga0066660_10993059 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 675 | Open in IMG/M |
| 3300006852|Ga0075433_11280861 | All Organisms → cellular organisms → Bacteria | 635 | Open in IMG/M |
| 3300006854|Ga0075425_101139806 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 887 | Open in IMG/M |
| 3300007258|Ga0099793_10114888 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1254 | Open in IMG/M |
| 3300007258|Ga0099793_10624448 | All Organisms → cellular organisms → Bacteria | 541 | Open in IMG/M |
| 3300009787|Ga0116226_10247043 | All Organisms → cellular organisms → Bacteria | 1848 | Open in IMG/M |
| 3300010048|Ga0126373_10032776 | All Organisms → cellular organisms → Bacteria | 4509 | Open in IMG/M |
| 3300010048|Ga0126373_10333499 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1524 | Open in IMG/M |
| 3300010159|Ga0099796_10127587 | All Organisms → cellular organisms → Bacteria | 983 | Open in IMG/M |
| 3300010360|Ga0126372_10325546 | All Organisms → cellular organisms → Bacteria | 1365 | Open in IMG/M |
| 3300010375|Ga0105239_10290008 | All Organisms → cellular organisms → Bacteria | 1843 | Open in IMG/M |
| 3300010376|Ga0126381_100783152 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1368 | Open in IMG/M |
| 3300010376|Ga0126381_100789685 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1363 | Open in IMG/M |
| 3300010398|Ga0126383_10917039 | Not Available | 963 | Open in IMG/M |
| 3300011270|Ga0137391_10535820 | All Organisms → cellular organisms → Bacteria | 988 | Open in IMG/M |
| 3300011271|Ga0137393_11186483 | All Organisms → cellular organisms → Bacteria | 648 | Open in IMG/M |
| 3300012096|Ga0137389_10682373 | All Organisms → cellular organisms → Bacteria | 883 | Open in IMG/M |
| 3300012096|Ga0137389_11316200 | All Organisms → cellular organisms → Bacteria | 617 | Open in IMG/M |
| 3300012203|Ga0137399_10655336 | All Organisms → cellular organisms → Bacteria | 883 | Open in IMG/M |
| 3300012207|Ga0137381_11411185 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 588 | Open in IMG/M |
| 3300012357|Ga0137384_10787785 | All Organisms → cellular organisms → Bacteria | 769 | Open in IMG/M |
| 3300012361|Ga0137360_10799095 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 812 | Open in IMG/M |
| 3300012361|Ga0137360_10973233 | All Organisms → cellular organisms → Bacteria | 732 | Open in IMG/M |
| 3300012362|Ga0137361_10277859 | All Organisms → cellular organisms → Bacteria | 1530 | Open in IMG/M |
| 3300012469|Ga0150984_119608518 | All Organisms → cellular organisms → Bacteria | 669 | Open in IMG/M |
| 3300012494|Ga0157341_1027848 | All Organisms → cellular organisms → Bacteria | 595 | Open in IMG/M |
| 3300012918|Ga0137396_11305926 | All Organisms → cellular organisms → Bacteria | 503 | Open in IMG/M |
| 3300012925|Ga0137419_11975130 | All Organisms → cellular organisms → Bacteria | 501 | Open in IMG/M |
| 3300012927|Ga0137416_10683723 | All Organisms → cellular organisms → Bacteria | 900 | Open in IMG/M |
| 3300012927|Ga0137416_11950688 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 538 | Open in IMG/M |
| 3300012948|Ga0126375_10512806 | All Organisms → cellular organisms → Bacteria | 897 | Open in IMG/M |
| 3300012960|Ga0164301_10114683 | All Organisms → cellular organisms → Bacteria | 1578 | Open in IMG/M |
| 3300013308|Ga0157375_13292451 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 538 | Open in IMG/M |
| 3300014201|Ga0181537_10743917 | All Organisms → cellular organisms → Bacteria | 666 | Open in IMG/M |
| 3300014495|Ga0182015_10533826 | All Organisms → cellular organisms → Bacteria | 748 | Open in IMG/M |
| 3300014501|Ga0182024_10258990 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2327 | Open in IMG/M |
| 3300015051|Ga0137414_1168740 | All Organisms → cellular organisms → Bacteria | 1434 | Open in IMG/M |
| 3300015082|Ga0167662_1013692 | All Organisms → cellular organisms → Bacteria | 1014 | Open in IMG/M |
| 3300016294|Ga0182041_10196213 | All Organisms → cellular organisms → Bacteria | 1603 | Open in IMG/M |
| 3300016294|Ga0182041_11772447 | All Organisms → cellular organisms → Bacteria | 572 | Open in IMG/M |
| 3300016357|Ga0182032_10988538 | All Organisms → cellular organisms → Bacteria | 718 | Open in IMG/M |
| 3300016387|Ga0182040_10276532 | All Organisms → cellular organisms → Bacteria | 1273 | Open in IMG/M |
| 3300017930|Ga0187825_10226598 | All Organisms → cellular organisms → Bacteria | 679 | Open in IMG/M |
| 3300018060|Ga0187765_10501764 | All Organisms → cellular organisms → Bacteria | 768 | Open in IMG/M |
| 3300018482|Ga0066669_10572739 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 986 | Open in IMG/M |
| 3300019789|Ga0137408_1231985 | All Organisms → cellular organisms → Bacteria | 2529 | Open in IMG/M |
| 3300019879|Ga0193723_1128767 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 696 | Open in IMG/M |
| 3300020010|Ga0193749_1050084 | All Organisms → cellular organisms → Bacteria | 801 | Open in IMG/M |
| 3300020140|Ga0179590_1066306 | All Organisms → cellular organisms → Bacteria | 947 | Open in IMG/M |
| 3300020140|Ga0179590_1118128 | All Organisms → cellular organisms → Bacteria | 719 | Open in IMG/M |
| 3300020579|Ga0210407_10777566 | All Organisms → cellular organisms → Bacteria | 739 | Open in IMG/M |
| 3300020580|Ga0210403_11465688 | All Organisms → cellular organisms → Bacteria | 515 | Open in IMG/M |
| 3300020581|Ga0210399_10255308 | All Organisms → cellular organisms → Bacteria | 1462 | Open in IMG/M |
| 3300020581|Ga0210399_11189129 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 606 | Open in IMG/M |
| 3300020582|Ga0210395_11065998 | All Organisms → cellular organisms → Bacteria | 597 | Open in IMG/M |
| 3300020583|Ga0210401_10820489 | All Organisms → cellular organisms → Bacteria | 790 | Open in IMG/M |
| 3300021180|Ga0210396_10114723 | All Organisms → cellular organisms → Bacteria | 2432 | Open in IMG/M |
| 3300021405|Ga0210387_10345626 | All Organisms → cellular organisms → Bacteria | 1314 | Open in IMG/M |
| 3300021405|Ga0210387_10553692 | All Organisms → cellular organisms → Bacteria | 1023 | Open in IMG/M |
| 3300021420|Ga0210394_10841525 | All Organisms → cellular organisms → Bacteria | 800 | Open in IMG/M |
| 3300021432|Ga0210384_10844031 | All Organisms → cellular organisms → Bacteria | 815 | Open in IMG/M |
| 3300021433|Ga0210391_10740517 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 769 | Open in IMG/M |
| 3300021475|Ga0210392_10272500 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1206 | Open in IMG/M |
| 3300021478|Ga0210402_11358646 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 638 | Open in IMG/M |
| 3300021560|Ga0126371_10454096 | All Organisms → cellular organisms → Bacteria | 1427 | Open in IMG/M |
| 3300022532|Ga0242655_10052349 | All Organisms → cellular organisms → Bacteria | 1010 | Open in IMG/M |
| 3300024288|Ga0179589_10367193 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 656 | Open in IMG/M |
| 3300025544|Ga0208078_1080021 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 672 | Open in IMG/M |
| 3300025612|Ga0208691_1160879 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 506 | Open in IMG/M |
| 3300025900|Ga0207710_10507143 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 626 | Open in IMG/M |
| 3300025906|Ga0207699_10910076 | All Organisms → cellular organisms → Bacteria | 649 | Open in IMG/M |
| 3300025907|Ga0207645_11189383 | All Organisms → cellular organisms → Bacteria | 512 | Open in IMG/M |
| 3300025915|Ga0207693_11312604 | All Organisms → cellular organisms → Bacteria | 541 | Open in IMG/M |
| 3300025922|Ga0207646_11500699 | All Organisms → cellular organisms → Bacteria | 584 | Open in IMG/M |
| 3300026088|Ga0207641_11459134 | All Organisms → cellular organisms → Bacteria | 685 | Open in IMG/M |
| 3300026326|Ga0209801_1222131 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 739 | Open in IMG/M |
| 3300026329|Ga0209375_1249366 | All Organisms → cellular organisms → Bacteria | 597 | Open in IMG/M |
| 3300026557|Ga0179587_11195295 | All Organisms → cellular organisms → Bacteria | 500 | Open in IMG/M |
| 3300027562|Ga0209735_1081376 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 703 | Open in IMG/M |
| 3300027576|Ga0209003_1089236 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 577 | Open in IMG/M |
| 3300027587|Ga0209220_1055215 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1059 | Open in IMG/M |
| 3300027676|Ga0209333_1026740 | All Organisms → cellular organisms → Bacteria | 1621 | Open in IMG/M |
| 3300027894|Ga0209068_10847959 | All Organisms → cellular organisms → Bacteria | 539 | Open in IMG/M |
| 3300027903|Ga0209488_10093635 | All Organisms → cellular organisms → Bacteria | 2247 | Open in IMG/M |
| 3300027908|Ga0209006_10340085 | All Organisms → cellular organisms → Bacteria | 1273 | Open in IMG/M |
| 3300028138|Ga0247684_1064917 | All Organisms → cellular organisms → Bacteria | 596 | Open in IMG/M |
| 3300028536|Ga0137415_10578788 | All Organisms → cellular organisms → Bacteria | 933 | Open in IMG/M |
| 3300028536|Ga0137415_10870834 | All Organisms → cellular organisms → Bacteria | 711 | Open in IMG/M |
| 3300029943|Ga0311340_11274521 | All Organisms → cellular organisms → Bacteria | 587 | Open in IMG/M |
| 3300030054|Ga0302182_10504816 | All Organisms → cellular organisms → Bacteria | 502 | Open in IMG/M |
| 3300030058|Ga0302179_10377453 | All Organisms → cellular organisms → Bacteria | 624 | Open in IMG/M |
| 3300030503|Ga0311370_10389545 | All Organisms → cellular organisms → Bacteria | 1757 | Open in IMG/M |
| 3300031234|Ga0302325_10021356 | All Organisms → cellular organisms → Bacteria | 13557 | Open in IMG/M |
| 3300031236|Ga0302324_100381127 | All Organisms → cellular organisms → Bacteria | 2114 | Open in IMG/M |
| 3300031525|Ga0302326_13030938 | Not Available | 572 | Open in IMG/M |
| 3300031546|Ga0318538_10520412 | Not Available | 645 | Open in IMG/M |
| 3300031640|Ga0318555_10693011 | All Organisms → cellular organisms → Bacteria | 551 | Open in IMG/M |
| 3300031668|Ga0318542_10558226 | All Organisms → cellular organisms → Bacteria | 597 | Open in IMG/M |
| 3300031708|Ga0310686_119020185 | All Organisms → cellular organisms → Bacteria | 1096 | Open in IMG/M |
| 3300031719|Ga0306917_10854073 | All Organisms → cellular organisms → Bacteria | 713 | Open in IMG/M |
| 3300031720|Ga0307469_10232480 | All Organisms → cellular organisms → Bacteria | 1468 | Open in IMG/M |
| 3300031720|Ga0307469_11886695 | All Organisms → cellular organisms → Bacteria | 578 | Open in IMG/M |
| 3300031771|Ga0318546_10414158 | All Organisms → cellular organisms → Bacteria | 942 | Open in IMG/M |
| 3300031793|Ga0318548_10562364 | All Organisms → cellular organisms → Bacteria | 555 | Open in IMG/M |
| 3300031823|Ga0307478_11177550 | All Organisms → cellular organisms → Bacteria | 639 | Open in IMG/M |
| 3300031823|Ga0307478_11465242 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 565 | Open in IMG/M |
| 3300031912|Ga0306921_10931852 | All Organisms → cellular organisms → Bacteria | 984 | Open in IMG/M |
| 3300031962|Ga0307479_10010702 | All Organisms → cellular organisms → Bacteria | 8532 | Open in IMG/M |
| 3300031962|Ga0307479_10128617 | All Organisms → cellular organisms → Bacteria | 2476 | Open in IMG/M |
| 3300031962|Ga0307479_11076157 | All Organisms → cellular organisms → Bacteria | 771 | Open in IMG/M |
| 3300032160|Ga0311301_10694708 | All Organisms → cellular organisms → Bacteria | 1432 | Open in IMG/M |
| 3300032174|Ga0307470_10083321 | All Organisms → cellular organisms → Bacteria | 1773 | Open in IMG/M |
| 3300032180|Ga0307471_103491578 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 556 | Open in IMG/M |
| 3300032892|Ga0335081_10012971 | All Organisms → cellular organisms → Bacteria | 13485 | Open in IMG/M |
| 3300033158|Ga0335077_11351707 | All Organisms → cellular organisms → Bacteria | 689 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 19.70% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 15.91% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 6.82% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 6.06% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 5.30% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 5.30% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 4.55% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 4.55% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.79% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.03% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 2.27% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 2.27% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.52% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.52% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.76% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 0.76% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.76% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.76% |
| Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 0.76% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.76% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 0.76% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.76% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 0.76% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.76% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.76% |
| Permafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil | 0.76% |
| Palsa | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa | 0.76% |
| Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 0.76% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 0.76% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.76% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere | 0.76% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.76% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.76% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.76% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.76% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 0.76% |
| Host-Associated | Host-Associated → Plants → Peat Moss → Unclassified → Unclassified → Host-Associated | 0.76% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2199352024 | Bare-fallow DEEP SOIL | Environmental | Open in IMG/M |
| 3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300004082 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3 | Environmental | Open in IMG/M |
| 3300004152 | Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3 | Environmental | Open in IMG/M |
| 3300004635 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
| 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
| 3300005451 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 | Environmental | Open in IMG/M |
| 3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
| 3300005586 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 | Environmental | Open in IMG/M |
| 3300005712 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 | Environmental | Open in IMG/M |
| 3300005952 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-045 | Environmental | Open in IMG/M |
| 3300006102 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013 | Environmental | Open in IMG/M |
| 3300006172 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2014 | Environmental | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006794 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 | Environmental | Open in IMG/M |
| 3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
| 3300009787 | Host-associated microbial communities from peat moss isolated from Minnesota, USA - S1T2_Fa - Sphagnum fallax MG | Host-Associated | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
| 3300012494 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.yng.030610 | Host-Associated | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
| 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014201 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_10_metaG | Environmental | Open in IMG/M |
| 3300014495 | Permafrost microbial communities from Stordalen Mire, Sweden - 712P3M metaG | Environmental | Open in IMG/M |
| 3300014501 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300015051 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015082 | Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Sample st-11c, vegetated hydrological feature) | Environmental | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300017930 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_5 | Environmental | Open in IMG/M |
| 3300018060 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MG | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300019789 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300019879 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2m2 | Environmental | Open in IMG/M |
| 3300020010 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1s2 | Environmental | Open in IMG/M |
| 3300020140 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
| 3300021475 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300022532 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-4-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300024288 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300025544 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 53-2 deep-072012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025612 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_10 (SPAdes) | Environmental | Open in IMG/M |
| 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 (SPAdes) | Environmental | Open in IMG/M |
| 3300026329 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 (SPAdes) | Environmental | Open in IMG/M |
| 3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300027562 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027576 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM3H0_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027587 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027676 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_O3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027894 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027908 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300028138 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK25 | Environmental | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300029943 | I_Palsa_N3 coassembly | Environmental | Open in IMG/M |
| 3300030054 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_N3_1 | Environmental | Open in IMG/M |
| 3300030058 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_1 | Environmental | Open in IMG/M |
| 3300030503 | III_Palsa_E3 coassembly | Environmental | Open in IMG/M |
| 3300031234 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2 | Environmental | Open in IMG/M |
| 3300031236 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1 | Environmental | Open in IMG/M |
| 3300031525 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3 | Environmental | Open in IMG/M |
| 3300031546 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23 | Environmental | Open in IMG/M |
| 3300031640 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23 | Environmental | Open in IMG/M |
| 3300031668 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
| 3300031793 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f21 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
| 3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| deeps_02327700 | 2199352024 | Soil | EASVYDLTPTILHLYGIEQPKQMHGHVLTEIFQTSTDKVAQK |
| JGI12635J15846_103868061 | 3300001593 | Forest Soil | TFFAMGPNIKHDLRLMGLEASVYDITPTILSLYGIEQPKQMHGHVLTQIFEGSGNVVAQK |
| JGIcombinedJ26739_1014520892 | 3300002245 | Forest Soil | LGVIVYDVTPTLLRIYGIEKPKQMRGRVLSQTFENADSKVAAKQ* |
| Ga0062384_1010104422 | 3300004082 | Bog Forest Soil | PGIKHDLRLMGFEVSVYDIAPTILHLYGIEQPAQMRGRVVSAIFESPGGTVAQK* |
| Ga0062386_1007505741 | 3300004152 | Bog Forest Soil | AASVYDIAPTVLHIYGIEQPAQMRGHVLTNIFVSADKKQASNH* |
| Ga0062388_1004960092 | 3300004635 | Bog Forest Soil | FEVSVYDIAPTILHLYGIEQPVQMRGHVLSEIFESSRGTVAQK* |
| Ga0070709_106088312 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | ASVYDIAPTLLHIYGIEQPKQMRGRVLTEVFAAPENNKVAAKN* |
| Ga0070713_1018566062 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | YDIAPTLLHIYGIEQPKQMRGRVLTEVFAAPENNKVAAKN* |
| Ga0066681_109611942 | 3300005451 | Soil | MGFEASVYDVAPTILHLYGIEQPKQMRGHVLSEIFETSRDRVAQK* |
| Ga0070732_104505281 | 3300005542 | Surface Soil | PTILHIYGIEQPAQMRGHVLTEIFERSDNKVAQK* |
| Ga0066691_109243861 | 3300005586 | Soil | DVAPTLLHLYGIEQPKQMRGRILTEIFENSDNKVAVKK* |
| Ga0070764_100792041 | 3300005712 | Soil | AASVYDIAPTILHIYGIEQPKQMRGHVLRDIFVEPERKAGQQ* |
| Ga0080026_100438472 | 3300005952 | Permafrost Soil | KHDLRLMGFQASVYDIAPTILHIYGIEQPAQMRGHVLTEIFEGSPSKVAQK* |
| Ga0075015_1007598722 | 3300006102 | Watersheds | DIAPTILHIYGIEQPAQMRGHVLSTIFENSEGTVAQK* |
| Ga0075018_107545092 | 3300006172 | Watersheds | LRLMGFEASVYDLAPTILHLYGIEQSKQMRGHVLSEIFENPDDKLVQK* |
| Ga0079222_108727413 | 3300006755 | Agricultural Soil | MSVFDIAPTILHLYGISAPAQMKRRVLTEIFAGSGAS |
| Ga0066658_100518571 | 3300006794 | Soil | VAPTILHVYGIEQPKQMRGHVLSEIFENAENKVALQK* |
| Ga0066660_109930591 | 3300006800 | Soil | IAPTVLHIYGIEPPKQMRGHVLSEIFESSENKVALQK* |
| Ga0075433_112808611 | 3300006852 | Populus Rhizosphere | IKRDFRVMGLAASVYDIAPTILSIYGIDQPKQMHGHALSEIFEKRETKAAAGN* |
| Ga0075425_1011398062 | 3300006854 | Populus Rhizosphere | LRLMGFEASVYDIAPTILRIYQVDPPKQMRGHVLEEIFETKQGKPSQN* |
| Ga0099793_101148882 | 3300007258 | Vadose Zone Soil | MGFEASVYDIAPTILHIYGVEPPKQMRGHVLDEIFGTPGDQAAQR* |
| Ga0099793_106244481 | 3300007258 | Vadose Zone Soil | TLLHIYGIEQPKQMRGRVLTEIFESSDNKVAAEK* |
| Ga0116226_102470432 | 3300009787 | Host-Associated | PTILHLYGIQQPSQMHGHVLTQIFETSEKNLAQK* |
| Ga0126373_100327761 | 3300010048 | Tropical Forest Soil | TVLHIYGIEQPKQMRGRVLTEIFEQSDPKSAAKQ* |
| Ga0126373_103334993 | 3300010048 | Tropical Forest Soil | GFEASVYDITPTILHLYGIEQPKQMRGHVLTEIFQNSGEKVAQK* |
| Ga0099796_101275871 | 3300010159 | Vadose Zone Soil | DIAPTLLHIYGIEQPKQMRGRVLTEVFEGAENKVAASK* |
| Ga0126372_103255462 | 3300010360 | Tropical Forest Soil | VYDLAPTILHLYGIDPAKQMRGRVLNEIFENSDGKVAQK* |
| Ga0105239_102900081 | 3300010375 | Corn Rhizosphere | VYDIAPTILHIYGINVPGQMRGHFLSDIFEREETRAAN* |
| Ga0126381_1007831521 | 3300010376 | Tropical Forest Soil | SVFDIAPTILHLYGIEQPAQMEGHVLTEIFENSDNRVARK* |
| Ga0126381_1007896851 | 3300010376 | Tropical Forest Soil | APTILHIYGIEQPAQMEGHVLTEIFENSDNKVALQK* |
| Ga0126383_109170392 | 3300010398 | Tropical Forest Soil | EASVYDIAPTILSIYGIQPPQQMRGRVLVEIFENPPSNAAAQ* |
| Ga0137391_105358201 | 3300011270 | Vadose Zone Soil | LRLMGFEASVYDIAPTILSLYGIAEPTQMHGHVLTQIFEGSANNVAQK* |
| Ga0137393_111864832 | 3300011271 | Vadose Zone Soil | YDVAPTLLHIYGIEQPKQMRGRVLTEIFESSDNKVAAKK* |
| Ga0137389_106823731 | 3300012096 | Vadose Zone Soil | SVYDVAPTLLHLYGIEQPKQMRGRILTEIFENSDNKVAVKK* |
| Ga0137389_113162001 | 3300012096 | Vadose Zone Soil | KHDLRLRGFEATVYDVAPTILHVYGIAQPKQMHGHVLSEIFENAENKVALQK* |
| Ga0137399_106553361 | 3300012203 | Vadose Zone Soil | KHDLRLMGLAASVYDVAPTLLYLYGIEQPKQMRGRVLTEIFESSDNKVAVKK* |
| Ga0137381_114111851 | 3300012207 | Vadose Zone Soil | IKHDLRLMGFEATVYDIAPTILHLYGIEQPKQMRGHVLSVIFENSPNKVAQK* |
| Ga0137384_107877852 | 3300012357 | Vadose Zone Soil | RLMGLGASVYDVAPTLLYIYGIEQPKQMRGRVLTEIFDGSENKVAMQK* |
| Ga0137360_107990951 | 3300012361 | Vadose Zone Soil | KHGLRLMGFEVSVYDIAPTILHIYGIEQPLQMRGHVVSDIFENSDKAIAQK* |
| Ga0137360_109732332 | 3300012361 | Vadose Zone Soil | APTLLHIYGIEQPKQMRGRVLTEVFEGAENKVAASK* |
| Ga0137361_102778592 | 3300012362 | Vadose Zone Soil | LRLMGFEATVYDVAPTILHLYGIEQPKQMRGHVLSVIFENSPNKVAQE* |
| Ga0150984_1196085182 | 3300012469 | Avena Fatua Rhizosphere | MGFEASVYDVAPTILHLYGIDQPKQMRGRVLTEIFDNAGSTTAVQN* |
| Ga0157341_10278482 | 3300012494 | Arabidopsis Rhizosphere | YDLAPTILHLYGIDPSKQMRGRVLSEIFEKFDGKVAQKE* |
| Ga0137396_113059261 | 3300012918 | Vadose Zone Soil | LMGFEASVYDIAPTILHIYGVEPPKQMRGHVLDEIFGTPGDQAAQR* |
| Ga0137419_119751302 | 3300012925 | Vadose Zone Soil | YDIAPTILHIYRVEPPKQMRGHVLDGIFETPGNKVAQK* |
| Ga0137416_106837231 | 3300012927 | Vadose Zone Soil | LRLMGFEATVYDVAPTILHVYGIEQPKQMRGHVLSEIFENAENKVALQK* |
| Ga0137416_119506881 | 3300012927 | Vadose Zone Soil | PTILHIYLVEPPKQMRGHVLDEIFETPGNKVAQK* |
| Ga0126375_105128062 | 3300012948 | Tropical Forest Soil | YDIAPTILHIYGIEQPKQMHGHLLSEIFEKRETKAAAGN* |
| Ga0164301_101146831 | 3300012960 | Soil | VFDIAPTILRIYGIEQPKQMQGHVLTEVFESGARRAAGGGGK* |
| Ga0157375_132924511 | 3300013308 | Miscanthus Rhizosphere | ASVYDIAPTLLRIYQVDPPKQLRGHVLEEIFATKEGKPTRN* |
| Ga0181537_107439171 | 3300014201 | Bog | MGPNIKHDLRLMGFEASVYDITPTILYLYGIQQPPQMHGHVLTQIFEGSANTVAQK* |
| Ga0182015_105338262 | 3300014495 | Palsa | MGFAASVYDIAPTILHLYGIEQPPQMRGHVLSDIFVNAGKTVAER* |
| Ga0182024_102589901 | 3300014501 | Permafrost | RLMGLDASVYDIAPTILSLYGIEQPKQMHGHVLTQIFEGSGNVVAQK* |
| Ga0137414_11687402 | 3300015051 | Vadose Zone Soil | MGFEASVYDIAPTILRIYQVDPPKQMRGHVLDEIFEPKQSKSTLN* |
| Ga0167662_10136921 | 3300015082 | Glacier Forefield Soil | DITPTILHIYGIEQPKQMRGRVLTEIFEGGGNKTVSTSSK* |
| Ga0182041_101962131 | 3300016294 | Soil | DVAPTVLHIYGIEQPKQMRGRVLTEIFEKADNKVAAKQ |
| Ga0182041_117724471 | 3300016294 | Soil | MGLAASVYDIAPTILHIYGLEQPLQMRGRVLTEIFAHAENKVAAQK |
| Ga0182032_109885382 | 3300016357 | Soil | LMGFEASVYDITPTILHIYGIEQPKQMRGHVLSEIFESASDKVAMQK |
| Ga0182040_102765322 | 3300016387 | Soil | YDVAPTVLYIYGIEQPKQMRGRVLTEIFEKSDNKVTAKQ |
| Ga0187825_102265981 | 3300017930 | Freshwater Sediment | SVYDLAPTILHLYGIDPSKQMRGRVLSEIFENSDGKVAQK |
| Ga0187765_105017641 | 3300018060 | Tropical Peatland | YDITPTILHLYGIEQPKQMRGHVLTAIFESSENKVAQK |
| Ga0066669_105727391 | 3300018482 | Grasslands Soil | SVYDVAPTILHIYGIAQPEQMHGHVLSEIFEAGDSKVAKK |
| Ga0137408_12319851 | 3300019789 | Vadose Zone Soil | MGLAASVYDVAPTLLHIYGIEQPKQMRGRILTEIFEGSGTKVAAKQ |
| Ga0193723_11287671 | 3300019879 | Soil | HDLRLMGFEASVYDVAPTILHLYGIQQPTQMRGHVLSEIFENSPNKVAQK |
| Ga0193749_10500841 | 3300020010 | Soil | PGIKHNSRLMGFEASVYDITPTILHIYGIEQPKQMRWRALTEIFDNSQNKALSGSSK |
| Ga0179590_10663062 | 3300020140 | Vadose Zone Soil | RLMGFEASVYDLAPTILRIYQVDPPKQMRGHVLEEIFETKEGKPSRN |
| Ga0179590_11181282 | 3300020140 | Vadose Zone Soil | PTILHIYGVEKPKQMRGRVLTEIFENPDNKVATKQ |
| Ga0210407_107775661 | 3300020579 | Soil | VYDVAPTLLHIYGLEQPKQMRGRILTEIFENADNKVAAKQ |
| Ga0210403_114656881 | 3300020580 | Soil | DITPTILHLYGIEQPKQMRGHVLTEIFENSPEKVAQK |
| Ga0210399_102553081 | 3300020581 | Soil | QRLMGFQASVYDIAPTILHLYGIEQPKQMRGHVLSEIFEASTDRVAMQK |
| Ga0210399_111891292 | 3300020581 | Soil | LAPTILHLYGIEQPKQMRGHVLSEIFENPDDKLVQK |
| Ga0210395_110659981 | 3300020582 | Soil | SVYDVAPTIFHIYGIEQPKQMRGHVLTQIFEDSDKKVALKQ |
| Ga0210401_108204891 | 3300020583 | Soil | LMGLDASVYDIAPTVLHIYGIAQPPQMHGRILDEIFLSSENKTAQR |
| Ga0210396_101147231 | 3300021180 | Soil | TILHIYGIEQPKQMRGRVLTEIFDNSQNKALSGSSK |
| Ga0210387_103456261 | 3300021405 | Soil | LMGFEASVYDITPTILHLYGIEQPKQMRGHVLTELFENSSANVAEK |
| Ga0210387_105536923 | 3300021405 | Soil | MGFEASVYDIAPTILHVYGIDPPKQMRGHVLSEIFEASTDKVAMQK |
| Ga0210394_108415251 | 3300021420 | Soil | DLRLMGLGASVYDVAPTLLYIYGIEQPKQMRGRILTEIFENANNKVAAKQ |
| Ga0210384_108440312 | 3300021432 | Soil | LAPTLLHLYGIEQSKQMRGHVLTEIFENSSDRVAQK |
| Ga0210391_107405172 | 3300021433 | Soil | TPTILHIYGIEQPSQMRGHVLTEIFEASDNKVAQN |
| Ga0210392_102725001 | 3300021475 | Soil | VYDLAPTLLHLYGIEQSKQMRGHVLTEIFENSSDRVAQK |
| Ga0210402_113586462 | 3300021478 | Soil | DLAPTILHLYGIEQSKQMRGHVLSEIFENPDDKLVQK |
| Ga0126371_104540961 | 3300021560 | Tropical Forest Soil | IAPTILHIYGIEQPKQMRGRVLTEIFDASESKVALQK |
| Ga0242655_100523491 | 3300022532 | Soil | DITPTILHLYGIEQPKQMRGHVLTEIFETSPNKVAQK |
| Ga0179589_103671931 | 3300024288 | Vadose Zone Soil | ASVYDIAPTILSLYGIAEPTQMHGHVLTQIFEGSANNVAQK |
| Ga0208078_10800211 | 3300025544 | Arctic Peat Soil | YDITPTILHIYGIEQPKQMRGRVLTEIFENNQNKALSGSSR |
| Ga0208691_11608791 | 3300025612 | Peatland | VYDIAPTILHIYGIDQPAQMHGHVLTEIFENSDKVVAQK |
| Ga0207710_105071431 | 3300025900 | Switchgrass Rhizosphere | GPGIKHGLRLMGFEASVYDIAPTILRIYQVDPPKQMRGHVLEEIFATKEGKPTRN |
| Ga0207699_109100762 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | VSVYDVAPTILHLYGIEPTKQMHGHVLTQIFENADAKVAQK |
| Ga0207645_111893831 | 3300025907 | Miscanthus Rhizosphere | ASVYDIAPTILHIYGINVPGQMRGHFLSDIFEREETRAAN |
| Ga0207693_113126042 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | SVYDIAPTVLYIYGIDQPKQMRGHGLKAIFDGSQENAAQLSSPQ |
| Ga0207646_115006992 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | YDVAPTILHVYGIAQPKQMRGHVLSEIFENAENKVALQK |
| Ga0207641_114591342 | 3300026088 | Switchgrass Rhizosphere | IAPTILHIYGIAQPPQMHGRVLTEIFEGNNGNVAEK |
| Ga0209801_12221311 | 3300026326 | Soil | LRLMGFEASVYDIAPTILHIYGIGQPKQMRGHVLTEIFESSENKVASDR |
| Ga0209375_12493661 | 3300026329 | Soil | PTILHLYGIEQPKQMHGHVLTEIFENPDNKVALQK |
| Ga0179587_111952951 | 3300026557 | Vadose Zone Soil | SVYDVTPTILHIYGIDQPKQMRGRVLTEIFEKTDNKVAAKQ |
| Ga0209735_10813762 | 3300027562 | Forest Soil | FEASVYDIAPTILHIYRVEPPKQMRGHVLDEIFETPENKIAKE |
| Ga0209003_10892362 | 3300027576 | Forest Soil | GFEASVYDIAPTILHIYGIGQPEQMRGHVLSEIFESSENKVALQK |
| Ga0209220_10552151 | 3300027587 | Forest Soil | DLAPTILHIYGIEQPAQMRGHVLSEIFENSDNKVAQK |
| Ga0209333_10267402 | 3300027676 | Forest Soil | AASVYDIAPTVLHLYGIEQPPQMRGHVLSDIFVNAGKTVAER |
| Ga0209068_108479592 | 3300027894 | Watersheds | VWDIAPTILHIYGIEQPKQMRGRVITEIFEAGGAKVAQK |
| Ga0209488_100936351 | 3300027903 | Vadose Zone Soil | DLRLMGFEASVYDLAPTILHIYGIEQPVQMRGHVLSEIFENSDKAIAKK |
| Ga0209006_103400851 | 3300027908 | Forest Soil | TILHIYGIEQPKQMRGRVLTEIFDTNQSKALSGSSK |
| Ga0247684_10649172 | 3300028138 | Soil | DVTPTILHLYGIQQPKQMRGRVLTEIFETSTGTTAAKGGK |
| Ga0137415_105787881 | 3300028536 | Vadose Zone Soil | LRLMGFEATVYDVAPTILHVYGIEQPKQMRGHVLSEIFENAENKVALQK |
| Ga0137415_108708341 | 3300028536 | Vadose Zone Soil | ASVYDVAPTLLYLYGIEQPKQMRGRVLTEIFESSDNKVAVKK |
| Ga0311340_112745211 | 3300029943 | Palsa | FAMGPNIKHDLRLMGFEASVYDITPTILSLYGIEQPKQMHGHVLTQIFEGSGNVVAQK |
| Ga0302182_105048162 | 3300030054 | Palsa | ASVYDITPTILHIYGIEQTTQMRGHVLTEIFEKTPAAD |
| Ga0302179_103774531 | 3300030058 | Palsa | MGPNIKHDLRLMGLEASVYDLAPTILSLYGIAEPAQMHGHVLSQIFVGSGDAVASK |
| Ga0311370_103895451 | 3300030503 | Palsa | GPNIKHDLRLMGFEASVYDITPTILSLYGIEQPKQMHGHVLTQIFEGSGNVVAQK |
| Ga0302325_100213561 | 3300031234 | Palsa | VYDITPTILHIYGIEQTTQMRGHVLTEIFEKTPAAD |
| Ga0302324_1003811272 | 3300031236 | Palsa | GLRLMGFEASVYDIAPTILHLYGIAQPPQMRGHVLSDIFDDAEKAVAQK |
| Ga0302326_130309381 | 3300031525 | Palsa | TILSLYGIEQPKQMHGHVLTQIFAGSGDVVAQKQLP |
| Ga0318538_105204121 | 3300031546 | Soil | VYDIAPTILRIFGIEQPMQMHGHALSEIFEKRETKATAGN |
| Ga0318555_106930112 | 3300031640 | Soil | YDIAPTILRIYGIEQPKQMHGHALSEIFEKRETKATAGN |
| Ga0318542_105582262 | 3300031668 | Soil | MGLAASVYDIAPTILRIYGIEQPKQMHGHALSEIFEKRETKATAGN |
| Ga0310686_1190201852 | 3300031708 | Soil | PGTFFAMGPNIKHDLRLMGFEASVYDLAPTILSLYGIDQPKQMHGHVLTQIFEGSANTLAQK |
| Ga0306917_108540733 | 3300031719 | Soil | MGFEASVYDITPTILHIYGIEQPKQMRGHVLSEIFESASDKVAMQK |
| Ga0307469_102324802 | 3300031720 | Hardwood Forest Soil | RLMGLAASVYDVAPTLLHIYGVEQPKQMRGRVLTEIFESPGTKVVAKD |
| Ga0307469_118866952 | 3300031720 | Hardwood Forest Soil | IAPTLLHIYGIEQPKQMRGRVLSEVFTGTENKVAANQ |
| Ga0318546_104141582 | 3300031771 | Soil | YDIAPTILHIYGIEQPKQMRGRVLTEIFDTSESKVALQK |
| Ga0318548_105623642 | 3300031793 | Soil | IKRDFRVMGLAASVYDIAPTILRIYGIEQPKQMHGHALSEIFEKRETKATAGN |
| Ga0307478_111775501 | 3300031823 | Hardwood Forest Soil | FDASVYDIAPTLLRIYGIEQPKQMRGRILAEVFEAHDSKVAAKN |
| Ga0307478_114652422 | 3300031823 | Hardwood Forest Soil | SVYDIAPTILHLYGIEQPAQMRGHVLSAIFENSEGTVAQK |
| Ga0306921_109318521 | 3300031912 | Soil | GFEVSVYDVAPTLLHIYGIEEPKQMHGRVLTEIFEGSESKVSARN |
| Ga0307479_100107025 | 3300031962 | Hardwood Forest Soil | MGFEASVYDIAPTILHIYRVEPPKQMRGHVLDEIFETPGDKAAQR |
| Ga0307479_101286173 | 3300031962 | Hardwood Forest Soil | LMGFEASVYDIAPTILRIYGIEQPAPMRGHVLSEIFENSDKAIAQK |
| Ga0307479_110761572 | 3300031962 | Hardwood Forest Soil | KHGLRLMGFEASVYDLAPTVLHIYGVEQPKQMRGRVLSEIFEGAEGKVAQK |
| Ga0311301_106947082 | 3300032160 | Peatlands Soil | EVSVYDIAPTILHIYGIEQPAHMHGHVLTEIFDGSDSKVAQK |
| Ga0307470_100833212 | 3300032174 | Hardwood Forest Soil | MGFEASVYDIAPTILHRYGIEQPKQTGGHFLEQLFESANGAVATKTE |
| Ga0307471_1034915781 | 3300032180 | Hardwood Forest Soil | YDLAPTILHIYGIEQPAQMRGHVLSEIFENSDNKVAQK |
| Ga0335081_1001297112 | 3300032892 | Soil | YDIAPTILHLYGIDPPKQMRGHVLTAIFDNSENKVAQK |
| Ga0335077_113517072 | 3300033158 | Soil | ASVYDIAPTILHIYGIEQPKQMHGHVLSAIFESPENKVAQK |
| ⦗Top⦘ |