Basic Information | |
---|---|
Family ID | F061202 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 132 |
Average Sequence Length | 42 residues |
Representative Sequence | LRSGKIDPTPLITRTFPLAEAEKAIRFAQQNGVMKVLLKA |
Number of Associated Samples | 112 |
Number of Associated Scaffolds | 132 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 0.00 % |
% of genes near scaffold ends (potentially truncated) | 99.24 % |
% of genes from short scaffolds (< 2000 bps) | 89.39 % |
Associated GOLD sequencing projects | 107 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.63 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (64.394 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (25.758 % of family members) |
Environment Ontology (ENVO) | Unclassified (25.758 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (55.303 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 20.59% β-sheet: 16.18% Coil/Unstructured: 63.24% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.63 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 132 Family Scaffolds |
---|---|---|
PF00731 | AIRC | 60.61 |
PF02441 | Flavoprotein | 6.82 |
PF05163 | DinB | 3.79 |
PF01040 | UbiA | 2.27 |
PF12680 | SnoaL_2 | 2.27 |
PF12705 | PDDEXK_1 | 2.27 |
PF02746 | MR_MLE_N | 0.76 |
PF00202 | Aminotran_3 | 0.76 |
PF04226 | Transgly_assoc | 0.76 |
PF12006 | DUF3500 | 0.76 |
PF08240 | ADH_N | 0.76 |
PF13560 | HTH_31 | 0.76 |
PF04055 | Radical_SAM | 0.76 |
PF12867 | DinB_2 | 0.76 |
PF00905 | Transpeptidase | 0.76 |
PF03471 | CorC_HlyC | 0.76 |
COG ID | Name | Functional Category | % Frequency in 132 Family Scaffolds |
---|---|---|---|
COG2318 | Bacillithiol/mycothiol S-transferase BstA/DinB, DinB/YfiT family (unrelated to E. coli DinB) | Secondary metabolites biosynthesis, transport and catabolism [Q] | 3.79 |
COG4948 | L-alanine-DL-glutamate epimerase or related enzyme of enolase superfamily | Cell wall/membrane/envelope biogenesis [M] | 1.52 |
COG2261 | Uncharacterized membrane protein YeaQ/YmgE, transglycosylase-associated protein family | General function prediction only [R] | 0.76 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 64.39 % |
Unclassified | root | N/A | 35.61 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300000955|JGI1027J12803_107080215 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 855 | Open in IMG/M |
3300001593|JGI12635J15846_10260406 | All Organisms → cellular organisms → Bacteria | 1107 | Open in IMG/M |
3300001593|JGI12635J15846_10632214 | All Organisms → cellular organisms → Bacteria | 620 | Open in IMG/M |
3300001867|JGI12627J18819_10434213 | All Organisms → cellular organisms → Bacteria | 536 | Open in IMG/M |
3300002245|JGIcombinedJ26739_101342828 | Not Available | 607 | Open in IMG/M |
3300002245|JGIcombinedJ26739_101746177 | Not Available | 522 | Open in IMG/M |
3300002245|JGIcombinedJ26739_101789144 | All Organisms → cellular organisms → Bacteria | 515 | Open in IMG/M |
3300004092|Ga0062389_100966590 | All Organisms → cellular organisms → Bacteria | 1036 | Open in IMG/M |
3300004479|Ga0062595_100882600 | Not Available | 750 | Open in IMG/M |
3300005167|Ga0066672_10236701 | All Organisms → cellular organisms → Bacteria | 1172 | Open in IMG/M |
3300005436|Ga0070713_100903122 | All Organisms → cellular organisms → Bacteria | 850 | Open in IMG/M |
3300005436|Ga0070713_101504941 | Not Available | 653 | Open in IMG/M |
3300005439|Ga0070711_100080322 | All Organisms → cellular organisms → Bacteria | 2322 | Open in IMG/M |
3300005446|Ga0066686_10108837 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1794 | Open in IMG/M |
3300005545|Ga0070695_101887301 | All Organisms → cellular organisms → Bacteria | 502 | Open in IMG/M |
3300005553|Ga0066695_10321837 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 973 | Open in IMG/M |
3300005555|Ga0066692_10865020 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 554 | Open in IMG/M |
3300005558|Ga0066698_10219012 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1306 | Open in IMG/M |
3300005712|Ga0070764_10169694 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1209 | Open in IMG/M |
3300006173|Ga0070716_100367179 | All Organisms → cellular organisms → Bacteria | 1024 | Open in IMG/M |
3300006174|Ga0075014_101009194 | All Organisms → cellular organisms → Bacteria | 505 | Open in IMG/M |
3300006176|Ga0070765_102112777 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 526 | Open in IMG/M |
3300006354|Ga0075021_10845072 | All Organisms → cellular organisms → Bacteria | 593 | Open in IMG/M |
3300006606|Ga0074062_11203401 | All Organisms → cellular organisms → Bacteria | 1052 | Open in IMG/M |
3300006806|Ga0079220_10929314 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 679 | Open in IMG/M |
3300006806|Ga0079220_11809094 | Not Available | 538 | Open in IMG/M |
3300006881|Ga0068865_101367069 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 631 | Open in IMG/M |
3300007258|Ga0099793_10090034 | All Organisms → cellular organisms → Bacteria | 1409 | Open in IMG/M |
3300007265|Ga0099794_10397946 | Not Available | 719 | Open in IMG/M |
3300009038|Ga0099829_10109773 | All Organisms → cellular organisms → Bacteria | 2157 | Open in IMG/M |
3300009088|Ga0099830_11172012 | Not Available | 638 | Open in IMG/M |
3300009143|Ga0099792_10800484 | Not Available | 617 | Open in IMG/M |
3300009615|Ga0116103_1036454 | All Organisms → cellular organisms → Bacteria | 1462 | Open in IMG/M |
3300009792|Ga0126374_11002669 | All Organisms → cellular organisms → Bacteria | 655 | Open in IMG/M |
3300010336|Ga0134071_10142064 | Not Available | 1163 | Open in IMG/M |
3300010359|Ga0126376_13012228 | Not Available | 521 | Open in IMG/M |
3300010360|Ga0126372_10909506 | All Organisms → cellular organisms → Bacteria | 883 | Open in IMG/M |
3300010362|Ga0126377_11490732 | Not Available | 750 | Open in IMG/M |
3300010877|Ga0126356_11159500 | All Organisms → cellular organisms → Bacteria | 551 | Open in IMG/M |
3300011269|Ga0137392_10726241 | Not Available | 822 | Open in IMG/M |
3300011271|Ga0137393_10380986 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1207 | Open in IMG/M |
3300011271|Ga0137393_11267102 | Not Available | 625 | Open in IMG/M |
3300012201|Ga0137365_10979708 | Not Available | 614 | Open in IMG/M |
3300012202|Ga0137363_10023677 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 4158 | Open in IMG/M |
3300012202|Ga0137363_10882422 | Not Available | 759 | Open in IMG/M |
3300012203|Ga0137399_10600796 | Not Available | 925 | Open in IMG/M |
3300012203|Ga0137399_10713112 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 844 | Open in IMG/M |
3300012205|Ga0137362_11323533 | Not Available | 606 | Open in IMG/M |
3300012349|Ga0137387_11280572 | Not Available | 514 | Open in IMG/M |
3300012359|Ga0137385_10332472 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1302 | Open in IMG/M |
3300012363|Ga0137390_10666925 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidipila → unclassified Acidipila → Acidipila sp. | 1004 | Open in IMG/M |
3300012582|Ga0137358_10060997 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 2521 | Open in IMG/M |
3300012917|Ga0137395_10550012 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 833 | Open in IMG/M |
3300012918|Ga0137396_10397429 | Not Available | 1021 | Open in IMG/M |
3300012918|Ga0137396_10628750 | Not Available | 794 | Open in IMG/M |
3300012922|Ga0137394_11447217 | Not Available | 547 | Open in IMG/M |
3300012924|Ga0137413_10140634 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1564 | Open in IMG/M |
3300012927|Ga0137416_10218908 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1539 | Open in IMG/M |
3300012931|Ga0153915_13088154 | All Organisms → cellular organisms → Bacteria | 542 | Open in IMG/M |
3300014501|Ga0182024_11794814 | Not Available | 686 | Open in IMG/M |
3300015203|Ga0167650_1127752 | Not Available | 531 | Open in IMG/M |
3300016341|Ga0182035_11346076 | Not Available | 640 | Open in IMG/M |
3300016404|Ga0182037_10074121 | All Organisms → cellular organisms → Bacteria | 2367 | Open in IMG/M |
3300017936|Ga0187821_10067351 | All Organisms → cellular organisms → Bacteria | 1295 | Open in IMG/M |
3300018021|Ga0187882_1234037 | Not Available | 715 | Open in IMG/M |
3300018030|Ga0187869_10176254 | Not Available | 1053 | Open in IMG/M |
3300018086|Ga0187769_10436201 | Not Available | 986 | Open in IMG/M |
3300018468|Ga0066662_11482525 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 705 | Open in IMG/M |
3300020579|Ga0210407_10362833 | All Organisms → cellular organisms → Bacteria | 1133 | Open in IMG/M |
3300020579|Ga0210407_10657562 | All Organisms → cellular organisms → Bacteria | 814 | Open in IMG/M |
3300020579|Ga0210407_11239737 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 559 | Open in IMG/M |
3300020580|Ga0210403_10087867 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2512 | Open in IMG/M |
3300020580|Ga0210403_10874287 | All Organisms → cellular organisms → Bacteria | 710 | Open in IMG/M |
3300020581|Ga0210399_11342188 | All Organisms → cellular organisms → Bacteria | 561 | Open in IMG/M |
3300020583|Ga0210401_10622978 | Not Available | 940 | Open in IMG/M |
3300021088|Ga0210404_10466836 | All Organisms → cellular organisms → Bacteria | 711 | Open in IMG/M |
3300021168|Ga0210406_10143684 | All Organisms → cellular organisms → Bacteria | 2005 | Open in IMG/M |
3300021170|Ga0210400_10061346 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2932 | Open in IMG/M |
3300021171|Ga0210405_10250286 | All Organisms → cellular organisms → Bacteria | 1402 | Open in IMG/M |
3300021180|Ga0210396_10450488 | Not Available | 1129 | Open in IMG/M |
3300021180|Ga0210396_11113841 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 664 | Open in IMG/M |
3300021401|Ga0210393_10145498 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1903 | Open in IMG/M |
3300021401|Ga0210393_10350157 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1202 | Open in IMG/M |
3300021405|Ga0210387_10608270 | Not Available | 971 | Open in IMG/M |
3300021405|Ga0210387_10708535 | All Organisms → cellular organisms → Bacteria | 892 | Open in IMG/M |
3300021407|Ga0210383_10953677 | All Organisms → cellular organisms → Bacteria | 729 | Open in IMG/M |
3300021433|Ga0210391_10236640 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Paludibaculum → Paludibaculum fermentans | 1434 | Open in IMG/M |
3300021433|Ga0210391_11491565 | All Organisms → cellular organisms → Bacteria | 519 | Open in IMG/M |
3300021474|Ga0210390_10143279 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2011 | Open in IMG/M |
3300021474|Ga0210390_11540550 | Not Available | 525 | Open in IMG/M |
3300021475|Ga0210392_10932615 | Not Available | 649 | Open in IMG/M |
3300021478|Ga0210402_10819933 | Not Available | 856 | Open in IMG/M |
3300021479|Ga0210410_10516164 | Not Available | 1066 | Open in IMG/M |
3300024249|Ga0247676_1073161 | Not Available | 566 | Open in IMG/M |
3300025464|Ga0208076_1067421 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 620 | Open in IMG/M |
3300025922|Ga0207646_10714953 | Not Available | 895 | Open in IMG/M |
3300025939|Ga0207665_10416873 | Not Available | 1025 | Open in IMG/M |
3300026320|Ga0209131_1181853 | Not Available | 1012 | Open in IMG/M |
3300026328|Ga0209802_1268499 | Not Available | 574 | Open in IMG/M |
3300026536|Ga0209058_1329658 | All Organisms → cellular organisms → Bacteria | 527 | Open in IMG/M |
3300026537|Ga0209157_1375462 | All Organisms → cellular organisms → Bacteria | 512 | Open in IMG/M |
3300026557|Ga0179587_10618489 | Not Available | 713 | Open in IMG/M |
3300027042|Ga0207766_1028063 | All Organisms → cellular organisms → Bacteria | 632 | Open in IMG/M |
3300027070|Ga0208365_1025183 | All Organisms → cellular organisms → Bacteria | 774 | Open in IMG/M |
3300027173|Ga0208097_1006630 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1217 | Open in IMG/M |
3300027590|Ga0209116_1013088 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 1673 | Open in IMG/M |
3300027775|Ga0209177_10144034 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 802 | Open in IMG/M |
3300027783|Ga0209448_10199149 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 664 | Open in IMG/M |
3300027857|Ga0209166_10022042 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3961 | Open in IMG/M |
3300027867|Ga0209167_10059607 | All Organisms → cellular organisms → Bacteria | 1890 | Open in IMG/M |
3300027867|Ga0209167_10471065 | All Organisms → cellular organisms → Bacteria | 687 | Open in IMG/M |
3300027875|Ga0209283_10073521 | All Organisms → cellular organisms → Bacteria | 2205 | Open in IMG/M |
3300027879|Ga0209169_10272485 | Not Available | 888 | Open in IMG/M |
3300027903|Ga0209488_10662681 | All Organisms → cellular organisms → Bacteria | 751 | Open in IMG/M |
3300029636|Ga0222749_10168880 | Not Available | 1076 | Open in IMG/M |
3300030730|Ga0307482_1182523 | Not Available | 629 | Open in IMG/M |
3300030844|Ga0075377_11550686 | Not Available | 1022 | Open in IMG/M |
3300031231|Ga0170824_104324991 | All Organisms → cellular organisms → Bacteria | 698 | Open in IMG/M |
3300031708|Ga0310686_118542388 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2335 | Open in IMG/M |
3300031753|Ga0307477_10197028 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1402 | Open in IMG/M |
3300031770|Ga0318521_10866437 | All Organisms → cellular organisms → Bacteria | 551 | Open in IMG/M |
3300031771|Ga0318546_10197948 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1371 | Open in IMG/M |
3300031798|Ga0318523_10552859 | All Organisms → cellular organisms → Bacteria | 568 | Open in IMG/M |
3300031947|Ga0310909_10277101 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1403 | Open in IMG/M |
3300031962|Ga0307479_12123369 | All Organisms → cellular organisms → Bacteria | 509 | Open in IMG/M |
3300032055|Ga0318575_10139829 | Not Available | 1198 | Open in IMG/M |
3300032063|Ga0318504_10050475 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1746 | Open in IMG/M |
3300032893|Ga0335069_10005670 | All Organisms → cellular organisms → Bacteria | 18302 | Open in IMG/M |
3300032893|Ga0335069_11391729 | Not Available | 759 | Open in IMG/M |
3300032893|Ga0335069_11988531 | All Organisms → cellular organisms → Bacteria | 613 | Open in IMG/M |
3300033134|Ga0335073_10001083 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 36097 | Open in IMG/M |
3300033983|Ga0371488_0257527 | Not Available | 851 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 25.76% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 20.45% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 6.82% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 6.82% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 5.30% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 3.03% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 3.03% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 2.27% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 2.27% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.27% |
Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 2.27% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 1.52% |
Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 1.52% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.52% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.52% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.52% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 0.76% |
Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 0.76% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.76% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.76% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.76% |
Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 0.76% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.76% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.76% |
Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 0.76% |
Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.76% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.76% |
Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 0.76% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.76% |
Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.76% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.76% |
Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 0.76% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
3300001867 | Texas A ecozone_OM1H0_M2 (Combined assembly for Texas A ecozone Site metagenome samples, ASSEMBLY_DATE=20130705) | Environmental | Open in IMG/M |
3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
3300005167 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 | Environmental | Open in IMG/M |
3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
3300005446 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 | Environmental | Open in IMG/M |
3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Environmental | Open in IMG/M |
3300005553 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 | Environmental | Open in IMG/M |
3300005555 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 | Environmental | Open in IMG/M |
3300005558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 | Environmental | Open in IMG/M |
3300005712 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 | Environmental | Open in IMG/M |
3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
3300006174 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014 | Environmental | Open in IMG/M |
3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
3300006354 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 | Environmental | Open in IMG/M |
3300006606 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMA (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Host-Associated | Open in IMG/M |
3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
3300009615 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_4_100 | Environmental | Open in IMG/M |
3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
3300010336 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09082015 | Environmental | Open in IMG/M |
3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
3300010877 | Boreal forest soil eukaryotic communities from Alaska, USA - W3-2 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012931 | Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 3 metaG | Environmental | Open in IMG/M |
3300014501 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
3300015203 | Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Sample st-3c, vegetated patch on medial moraine) | Environmental | Open in IMG/M |
3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
3300017936 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_1 | Environmental | Open in IMG/M |
3300018021 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_150 | Environmental | Open in IMG/M |
3300018030 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_100 | Environmental | Open in IMG/M |
3300018086 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MG | Environmental | Open in IMG/M |
3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
3300021475 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O | Environmental | Open in IMG/M |
3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
3300024249 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK17 | Environmental | Open in IMG/M |
3300025464 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-3 shallow-072012 (SPAdes) | Environmental | Open in IMG/M |
3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300026320 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_40cm (SPAdes) | Environmental | Open in IMG/M |
3300026328 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 (SPAdes) | Environmental | Open in IMG/M |
3300026536 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 (SPAdes) | Environmental | Open in IMG/M |
3300026537 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 (SPAdes) | Environmental | Open in IMG/M |
3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
3300027042 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 68 (SPAdes) | Environmental | Open in IMG/M |
3300027070 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF004 (SPAdes) | Environmental | Open in IMG/M |
3300027173 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF036 (SPAdes) | Environmental | Open in IMG/M |
3300027590 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_O1 (SPAdes) | Environmental | Open in IMG/M |
3300027775 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control (SPAdes) | Environmental | Open in IMG/M |
3300027783 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM2 (SPAdes) | Environmental | Open in IMG/M |
3300027857 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300027867 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027879 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 (SPAdes) | Environmental | Open in IMG/M |
3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
3300029636 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300030730 | Metatranscriptome of hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300030844 | Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - FA11 EcM (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
3300031770 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17 | Environmental | Open in IMG/M |
3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
3300031798 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f19 | Environmental | Open in IMG/M |
3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
3300032055 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f23 | Environmental | Open in IMG/M |
3300032063 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f17 | Environmental | Open in IMG/M |
3300032893 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1 | Environmental | Open in IMG/M |
3300033134 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2 | Environmental | Open in IMG/M |
3300033983 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB23AN SIP fraction | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
JGI1027J12803_1070802152 | 3300000955 | Soil | LRSGKVDPTPLITKTFPLEQAPEAIQFAQKRGVMKVLLKP* |
JGI12635J15846_102604062 | 3300001593 | Forest Soil | SLLHTGKVDPHQLITRTFPLSEAPAAIQFAQQPGVMKVLLKPE* |
JGI12635J15846_106322141 | 3300001593 | Forest Soil | SEKVDPRPLITRTFPLSEAPTAIKFAQQPGVMKVLLKPE* |
JGI12627J18819_104342132 | 3300001867 | Forest Soil | FDKAIALLRSGKVDPRALVTRTFSLSEARAAIRFAPQPGVMKVLLKAV* |
JGIcombinedJ26739_1013428281 | 3300002245 | Forest Soil | KVDPTALITRTFPLAEAGKAIQFVQENKVMKVLLKA* |
JGIcombinedJ26739_1017461771 | 3300002245 | Forest Soil | TAMALLRSGKVDPAPLITRTFPMSEAPQAIRFAQKPGVMKVLLKA* |
JGIcombinedJ26739_1017891441 | 3300002245 | Forest Soil | LITRTFPLSEAPAAIQDAQQPGVMKVLLKPESSL* |
Ga0062389_1009665901 | 3300004092 | Bog Forest Soil | DKAIALLYSGKVDLTSLVTRTFSMKGAAAAIRFAQKPGVMKVLLKT* |
Ga0062595_1008826002 | 3300004479 | Soil | DKALALLRSGKVDPTPLITRTLPLASVQKAITFAQQSGVMKVLLKPDAVRS* |
Ga0066672_102367011 | 3300005167 | Soil | LHSGAVDLKPLITRTFALKEAQKAMAFAESSGVLKVLLKP* |
Ga0070713_1009031222 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | PAALALLRSGRVDPRPLVSRVFSLKDAAEAIRSAQESSMMKVLLH* |
Ga0070713_1015049412 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | RRAIALLRSGKIDPIPLVTRTFPLAEAPAAIQFAQHPGVMKVLLKVAG* |
Ga0070711_1000803221 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | GPFVQAIALLRSGKVNPTPLISRVVPLKDAPKAIIYAQKPGVMKVLLKS* |
Ga0066686_101088371 | 3300005446 | Soil | KAIALLRAGKVDPRSLVTRTFPLQEAPAAIAFAQKPAVMKVLLKSEYKSLKA* |
Ga0070695_1018873011 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | GKVDPTPLVTQTFPLAAAPQAIEFAQRRDVMKVLLSPAG* |
Ga0066695_103218372 | 3300005553 | Soil | LALLRASKVDPRPLISRTFSLAEAPRAVVHGQRSGVLKVLLKT* |
Ga0066692_108650202 | 3300005555 | Soil | IALLRSRKVDPRPLITRRFPLAEAPTAIRFAQQSGVMKVLLKS* |
Ga0066698_102190123 | 3300005558 | Soil | RAGKVDPRSLVTRTFPLQEAPAAIAFAQKPAVMKVLLKSEYKSLKA* |
Ga0070764_101696941 | 3300005712 | Soil | AIRLLREGKLDPSPLITRTFPLAEAAAAMAYAQEKDVMKVLLKP* |
Ga0070716_1003671793 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | RKIDPTLLITRGFPLAQAPSAMLFAQKRGVMKVLLRNEN* |
Ga0075014_1010091941 | 3300006174 | Watersheds | AKAIALLRSGQVDPTPLISRTFALADAAEAIAYAQGRGVMKVLLRAG* |
Ga0070765_1021127772 | 3300006176 | Soil | TKVDPRPLITRTFPLSEAPTAIDYAQQKDVMKVLLKP* |
Ga0075021_108450723 | 3300006354 | Watersheds | VNPTPLVTRTYPLAAAQQAVAFAQQTGVMKVLLKA* |
Ga0074062_112034011 | 3300006606 | Soil | KVDPVPLITMTFPLADAPKAIRFAQQHGVMKVLLKP* |
Ga0079220_109293142 | 3300006806 | Agricultural Soil | RSGQTNPASLITKTFPLAQAAEAIRFAQKPGVMKVLLRP* |
Ga0079220_118090942 | 3300006806 | Agricultural Soil | RFEQAIALLRAGTVDPRALITRVFSLDEAERAIEFAQRRGVMKVVLRCC* |
Ga0068865_1013670692 | 3300006881 | Miscanthus Rhizosphere | AIALLSSGKVDPRPLITRVFPLGEAPSAIRFGQQPDVMKVLLANG* |
Ga0099793_100900341 | 3300007258 | Vadose Zone Soil | VDPRPLITRRFPLAEAPAAIRFAQQSGVMKVLLKS* |
Ga0099794_103979461 | 3300007265 | Vadose Zone Soil | KIDLTPLITRAFPLSDAPAAIHFAQARGVMKVLLKPDSGTE* |
Ga0099829_101097735 | 3300009038 | Vadose Zone Soil | LRSGRVDPGPLISRIFELKNATDAIRYAQQPGVMKVLLHS* |
Ga0099830_111720121 | 3300009088 | Vadose Zone Soil | IDPTPLIIGTFPLSEAQTAIQFAQKKGVMKVLLKP* |
Ga0099792_108004842 | 3300009143 | Vadose Zone Soil | TFLRSGKIDLTPLITRTFTLSDAPAAIHFAQWRDAMKVLLKPDSGTE* |
Ga0116103_10364543 | 3300009615 | Peatland | PFAKAITLLRSGKVDPTPLISRTFALKAAPQAIAYAQKRGVMKVLLAAASPS* |
Ga0126374_110026691 | 3300009792 | Tropical Forest Soil | LGSGQVDPRPLVTCALPLSEAPSAIRYAQQAGVMKVLLENS* |
Ga0134071_101420641 | 3300010336 | Grasslands Soil | ALLRSRKVDPRPLITRRFPLAEAPTAIRFAQQSGVMKVLLKS* |
Ga0126376_130122281 | 3300010359 | Tropical Forest Soil | FAKAIALLRSGKVDPTPMISRVFELREAATAILFAQRKGTVKVLLQS* |
Ga0126372_109095063 | 3300010360 | Tropical Forest Soil | ALLRAGKVDPRPLITRSFSLGEAAAAIRFAQRRGVMKVLLRP* |
Ga0126377_114907321 | 3300010362 | Tropical Forest Soil | RLGKVDPRPLITRSFSLGEAAAAIRFAQRRGVMKVLLRP* |
Ga0126356_111595001 | 3300010877 | Boreal Forest Soil | KVDPTPQISRTFALKDAPAAIAHAQERGVMKVLLRND* |
Ga0137392_107262413 | 3300011269 | Vadose Zone Soil | DPTPLITRKFALAEAPTAIRFAQRPDVMKVLLSS* |
Ga0137393_103809861 | 3300011271 | Vadose Zone Soil | EVEPRPLITRIFSLADLSKAIQFAQKHGVMKVLLKP* |
Ga0137393_112671022 | 3300011271 | Vadose Zone Soil | PLITRTFSLSNAPAAMHFAQKSGVMKVLLKGHEG* |
Ga0137365_109797081 | 3300012201 | Vadose Zone Soil | KAIALLRAGKVDPRSLVTRTFPLQQAPAAIAFAQKPAVMKVLLTSEYKSLKA* |
Ga0137363_100236776 | 3300012202 | Vadose Zone Soil | SGKVDPAPLITRTFPLNDAPAALRFAQKSGVMKVLLKGHEG* |
Ga0137363_108824222 | 3300012202 | Vadose Zone Soil | EVDPAPLITRTFPLAEAAAAIRFAQQPGVMKVLLRA* |
Ga0137399_106007961 | 3300012203 | Vadose Zone Soil | SGEVDPTPLITRTFPLAQAQKAIVFAQKPGVMKVLLKP* |
Ga0137399_107131122 | 3300012203 | Vadose Zone Soil | GKVDPTPLITRTFPLKDAAAAIAFAQQYGVMKVLLRT* |
Ga0137362_113235331 | 3300012205 | Vadose Zone Soil | IDPTPHITRIFPLAEAEKAIRFAQQNGVMKVLLKA* |
Ga0137387_112805721 | 3300012349 | Vadose Zone Soil | RSGKVDPTPLITRTFPLTDAPAAVAFAQQPGVMKVLLHS* |
Ga0137385_103324721 | 3300012359 | Vadose Zone Soil | SGKVDPRPLITRRFPLAEASTAIRFAQQSGVMKVLLKS* |
Ga0137390_106669251 | 3300012363 | Vadose Zone Soil | GKIDPTPLITRKFALAEAPTAIRFAQRPDVMKVLLSS* |
Ga0137358_100609975 | 3300012582 | Vadose Zone Soil | RSLKIDPRPLITRTFALQEASAAMAFAQKPGVMKVLLRGENSQ* |
Ga0137395_105500121 | 3300012917 | Vadose Zone Soil | KVDPTPLITRTFPLTDAPAAVAFAQQPGVMKVLLHS* |
Ga0137396_103974291 | 3300012918 | Vadose Zone Soil | GEVDPTPLITRTFPLADAQKAIAFAQRTGVMKILLKP* |
Ga0137396_106287501 | 3300012918 | Vadose Zone Soil | SGEVDPTPLITCTFPLAEAQKAIAFAQRTGVMKILLKP* |
Ga0137394_114472172 | 3300012922 | Vadose Zone Soil | KIDPTPLITRTFPLAEAEKAIRFAQQNGVMKVLLKA* |
Ga0137413_101406343 | 3300012924 | Vadose Zone Soil | QAVALLRSGKIDPTALITRTFLLSDAPAAIRFAQEPGVMKVLLKPGSEKG* |
Ga0137416_102189083 | 3300012927 | Vadose Zone Soil | RSGKVDPRPLIMHILPLADAQKAMAIAQQSSVMKVLLKS* |
Ga0153915_130881542 | 3300012931 | Freshwater Wetlands | SGQVDPTPLISRTFPLAEAPAAIAYAQKPGVMKVLLKRN* |
Ga0182024_117948141 | 3300014501 | Permafrost | GKVDPQPLITRTFPLNEAPKAIKFAQEPGVMKVLLKADC* |
Ga0167650_11277522 | 3300015203 | Glacier Forefield Soil | AIALLRSQKVDPTLLITRVFPLRDAAKAIRYAQNSGVMKVLLRT* |
Ga0182035_113460762 | 3300016341 | Soil | TLLRSGKVDPTPLITRTFAMREAPQAIRYAQQPNVMKVLLRNEERTTKAG |
Ga0182037_100741211 | 3300016404 | Soil | RAKLIDPRPLITRTFSLSDASKAVEFAQRKGVLKVLLKP |
Ga0187821_100673511 | 3300017936 | Freshwater Sediment | LLRSGKVDPAPLITRRFSMKEAPAAIRFAQEPGVMKVLLNA |
Ga0187882_12340371 | 3300018021 | Peatland | LLRSGKVDPTPLISRTFALKAAPQAIAYAQKRGVMKVLLAAASPS |
Ga0187869_101762541 | 3300018030 | Peatland | KAITLLRSGKVDPTPLISRTFALKAAPQAIAYAQKRGVMKVLLTTSSPS |
Ga0187769_104362013 | 3300018086 | Tropical Peatland | RSGNVDPTPLISRTFALKDAPQAIAFAQRPSVLKVLLKT |
Ga0066662_114825252 | 3300018468 | Grasslands Soil | GAVDLKPLITRTFALKEAQKAMAFAESSGVLKVLLKP |
Ga0210407_103628331 | 3300020579 | Soil | LRAKLIDPRTLVTRTFPLSEASKAIKFAQKKGVLKVLLKP |
Ga0210407_106575622 | 3300020579 | Soil | VDPRTLVTRTFPLSEASKAIKFAQKKGVLKVLLKP |
Ga0210407_112397371 | 3300020579 | Soil | TPLITRTFSLRDAQRAIDFAQRPGVMKVLLHSPSEPL |
Ga0210403_100878671 | 3300020580 | Soil | LHSEEVDPRALVTHTFPMNEAPKAIRFAQKPGVMKVLLKA |
Ga0210403_108742871 | 3300020580 | Soil | AKAIALLRSGKVDPTPLITRMFPLAEAPAAIEFAQEANVMKVLLKAGPGKRSGAS |
Ga0210399_113421882 | 3300020581 | Soil | FAKSIALLRNGKVDPAPLVTRTFPLAEAAKAIEFAQQRDVMKVLLKP |
Ga0210401_106229781 | 3300020583 | Soil | GPFARALALLHSEEVDPRALVTHTFPMNEAPKAIRFAQKPGVMKVLLKA |
Ga0210404_104668361 | 3300021088 | Soil | KVNPTPLISRVVPLKDAPKAIIYAQKPGVMKVLLKS |
Ga0210406_101436841 | 3300021168 | Soil | AKLVDPRTLVTRTFPLSEASKAIKFAQKKGVLKVLLKP |
Ga0210400_100613465 | 3300021170 | Soil | SGEVDPTPLITRTFPLDQAPAAIQFARRAGIMKVLLQP |
Ga0210405_102502861 | 3300021171 | Soil | AIALLRSGKVDPTALISRAFALKNAPVAIVHAQKRGVMKVLLKA |
Ga0210396_104504883 | 3300021180 | Soil | LLPAGKVDPTPLISRTFELRDAPAAIKHAQKPGVMKVLLRNS |
Ga0210396_111138411 | 3300021180 | Soil | ALLRSGKVDPTPLISRTFALKDAPAAIKHAQKRGVMKVLLKA |
Ga0210393_101454983 | 3300021401 | Soil | VGPASLITRTFPMSEAAAAIRFAQKPGVMKILLKA |
Ga0210393_103501571 | 3300021401 | Soil | LLRSGKLDPTPLIARTFKMDEAPAAIRFAQKPGVMKVLLKAD |
Ga0210387_106082702 | 3300021405 | Soil | LLRAKKVDPRPLIARTYPLAEATAAMKFAQERGVLKVLLKP |
Ga0210387_107085351 | 3300021405 | Soil | AKLVDPRPLITRTFPLSEASKAMKFAQHDGVLKVLLKS |
Ga0210383_109536772 | 3300021407 | Soil | RSGKVVPAPLITKTFPMSEAPAAIRFAQKPGVMKVLLKA |
Ga0210391_102366403 | 3300021433 | Soil | LTLLRTGKIDPRQLISHTFPLAEAKEAMKFAQQRGVLKVLLKP |
Ga0210391_114915652 | 3300021433 | Soil | AKLVDPRPLITRTFPLSEASKAMKFAQKKGILKVLLKP |
Ga0210390_101432791 | 3300021474 | Soil | LRTGRVDPTPLISRVFPLQDAAAAIHYAQQRGVMKVLLKVEVRV |
Ga0210390_115405501 | 3300021474 | Soil | ALLRSGKVDPTPLISRTFSMKDAPTAILYAQQPNVMKVLLKKTDGATND |
Ga0210392_109326152 | 3300021475 | Soil | GPFAKAIGLLRSGKVDPTLLVSRTFALKNAPAAITYAQKHGVMKVLLKNA |
Ga0210402_108199331 | 3300021478 | Soil | GKLDPKPLIARTFKMDEAPAAIRFAQKPGVMKVLLKAC |
Ga0210410_105161642 | 3300021479 | Soil | AIAMLRSGKVDPTPLISRVFELKDAPAAIAHAQKRGVMKVLLRNT |
Ga0247676_10731612 | 3300024249 | Soil | IALLRTGKVDPTPLISRVFALKDAPAAIAFAQRRGVMKVLLKP |
Ga0208076_10674212 | 3300025464 | Arctic Peat Soil | DPRPLITRTFPLAQAPAAIQYAQRPGVVKVLLTPK |
Ga0207646_107149532 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | LLRAGKVDPRSLVTRTFPLQEAPAAIAFAQKPAVMKVLLKSEYKSLKA |
Ga0207665_104168731 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | RKIDPTLLITRGFPLAQAPSAMLFAQKRGVMKVLLRNEN |
Ga0209131_11818531 | 3300026320 | Grasslands Soil | IDPTPLITRTFPLLDAPAAIAFAQKSGVMKVVLKA |
Ga0209802_12684992 | 3300026328 | Soil | ANAIGLLRSCKIDPTPLITRKFALAEAPTAIRFAQRPGVMKVLLSS |
Ga0209058_13296582 | 3300026536 | Soil | ALLRAGKVDPRSLVTRTFPLQEAPAAIAFAQKPAVMKVLLKSEYKSLKA |
Ga0209157_13754621 | 3300026537 | Soil | ALLRSRKVDPRPLITRRFPLAEAPTAIRFAQQSGVMKVLLKS |
Ga0179587_106184891 | 3300026557 | Vadose Zone Soil | PRPLIARTFPLHEASAAIVFAQKSGVMKVLLKKEG |
Ga0207766_10280632 | 3300027042 | Tropical Forest Soil | LLRSGKIEPTALISRTFALKDAPKAIDYAQQSGVLKVLLKANSTL |
Ga0208365_10251832 | 3300027070 | Forest Soil | RKGIALLRSGKVDPRPLVTRVFPLAEADKAIQFAKKKGVMKVLLKA |
Ga0208097_10066301 | 3300027173 | Forest Soil | GKIDPTPLITHTFPLAEAAKAIDLAQRPGVMKVLLKPETERN |
Ga0209116_10130881 | 3300027590 | Forest Soil | VDPRPLITRTFPLSEAPAAMAYAQEKDAMKVLLKP |
Ga0209177_101440343 | 3300027775 | Agricultural Soil | QSGKLDLAPLITRTFPLSQAADAIQFAQRRGVMKVLLRN |
Ga0209448_101991492 | 3300027783 | Bog Forest Soil | PLISRVFPLKNAAKAIRYAQQPGVMKVLIKITPDEN |
Ga0209166_100220425 | 3300027857 | Surface Soil | AIALLHTLKVDPRPLITQAFPLKDASTAIAFAQESGVMKVLLTAD |
Ga0209167_100596074 | 3300027867 | Surface Soil | GKVDPRPLITRTFSLAETSAAIRFAQQPGVMKVLLKNV |
Ga0209167_104710653 | 3300027867 | Surface Soil | AIALLHTLKVDPRPLITQAFPLKDASTAIAFAQESGVMKVLLKANAQA |
Ga0209283_100735214 | 3300027875 | Vadose Zone Soil | LRSGKIDPTPLITRTFPLAEAEKAIRFAQQNGVMKVLLKA |
Ga0209169_102724852 | 3300027879 | Soil | KLDPSPLITRTFPLAEAAAAMAYAQEKDVMKVLLKP |
Ga0209488_106626811 | 3300027903 | Vadose Zone Soil | TFLRSGKIDLTPLITRTFTLSDAPAAIHFAQWRDAMKVLLKPDSGTE |
Ga0222749_101688803 | 3300029636 | Soil | EEVDPRALVTHTFPMNEAPKAIRFAQKPGVMKVLLKA |
Ga0307482_11825232 | 3300030730 | Hardwood Forest Soil | RSGKVDPTPLISRTFVLHDADAAIARAQKRGVMKVLLRNT |
Ga0075377_115506863 | 3300030844 | Soil | AIALLRSGKVDPTPLITRVFPLKDAPKDIVYAQKPGVMKVLLKS |
Ga0170824_1043249911 | 3300031231 | Forest Soil | REPKVDPRPLITRTFPLDEAPAAIAYAQEKNVMKVLLKP |
Ga0310686_1185423885 | 3300031708 | Soil | RSGRVDPRPLITRIFPLKDAAKAIRHAQERGVMKVLLKPAHQRE |
Ga0307477_101970283 | 3300031753 | Hardwood Forest Soil | KVDPRPLITRTFPLEEASAAVALAQKSGVMKVLLKNAAK |
Ga0318521_108664372 | 3300031770 | Soil | LRSGTIEPTALISRTFALKDAPKAIDYAQQSGVLKVLLKANSTL |
Ga0318546_101979483 | 3300031771 | Soil | ELLRSGKVDPRVLISRTFSLNDAAKALAYAQKRGVLKVLLKANQRSL |
Ga0318523_105528592 | 3300031798 | Soil | FEKAIALLQAGKVDPRPLITRSFSLGEAAAAVRFAQRRGVMKVLLRA |
Ga0310909_102771013 | 3300031947 | Soil | LRAKLIDPRPLITRTFSLSDASKAVEFAQRKGVLKVLLKP |
Ga0307479_121233691 | 3300031962 | Hardwood Forest Soil | AIALLTSGKIDPASLITRTFPLSDAPAAIRFAQKSGVMKVLLKSK |
Ga0318575_101398293 | 3300032055 | Soil | VELLRSGKVDPRVLISRTFSLNDAAKALAYAQKRGVLKVLLKANQRSL |
Ga0318504_100504751 | 3300032063 | Soil | VELLRSGKVDPKLLISRTFSLSDAAKALAYAQKRGVLKVLLKANQRSL |
Ga0335069_100056701 | 3300032893 | Soil | SDKVDPTPLISRTFSLADVPKAITYAQQPGVMKVILSNS |
Ga0335069_113917291 | 3300032893 | Soil | IELLRSGKVDPTPLISRTFSLEEAPEAVRYAQVRGVLKVLLKNEAR |
Ga0335069_119885311 | 3300032893 | Soil | DPSPLITKIFPLAKAAKAIEFAQKSGVMKVLLENRNEKI |
Ga0335073_100010831 | 3300033134 | Soil | KAIALLRSGRVDATPLITRTFPLAEAPQAIQFAQKPGVMKVLLKTDMKG |
Ga0371488_0257527_731_850 | 3300033983 | Peat Soil | DPTPLISRTFALKDAPQAIAYAQQSGVLKVLLAASSSVG |
⦗Top⦘ |