| Basic Information | |
|---|---|
| Family ID | F061189 |
| Family Type | Metagenome |
| Number of Sequences | 132 |
| Average Sequence Length | 50 residues |
| Representative Sequence | AGDTWHQRTVIQPTSADTMTATSYLSFGTVPEWKGVEIKYTRRIK |
| Number of Associated Samples | 107 |
| Number of Associated Scaffolds | 132 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 9.30 % |
| % of genes near scaffold ends (potentially truncated) | 86.36 % |
| % of genes from short scaffolds (< 2000 bps) | 93.94 % |
| Associated GOLD sequencing projects | 97 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.67 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (62.879 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere (6.818 % of family members) |
| Environment Ontology (ENVO) | Unclassified (46.970 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (56.818 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 38.36% Coil/Unstructured: 61.64% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.67 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 132 Family Scaffolds |
|---|---|---|
| PF01872 | RibD_C | 4.55 |
| PF04993 | TfoX_N | 4.55 |
| PF01022 | HTH_5 | 3.79 |
| PF00106 | adh_short | 3.79 |
| PF12704 | MacB_PCD | 3.03 |
| PF00232 | Glyco_hydro_1 | 2.27 |
| PF06134 | RhaA | 2.27 |
| PF07676 | PD40 | 2.27 |
| PF13424 | TPR_12 | 2.27 |
| PF02687 | FtsX | 1.52 |
| PF07883 | Cupin_2 | 1.52 |
| PF13740 | ACT_6 | 1.52 |
| PF07617 | DUF1579 | 1.52 |
| PF13840 | ACT_7 | 0.76 |
| PF07592 | DDE_Tnp_ISAZ013 | 0.76 |
| PF01261 | AP_endonuc_2 | 0.76 |
| PF13450 | NAD_binding_8 | 0.76 |
| PF07638 | Sigma70_ECF | 0.76 |
| PF00246 | Peptidase_M14 | 0.76 |
| PF13505 | OMP_b-brl | 0.76 |
| PF02550 | AcetylCoA_hydro | 0.76 |
| PF04717 | Phage_base_V | 0.76 |
| PF00326 | Peptidase_S9 | 0.76 |
| PF12867 | DinB_2 | 0.76 |
| PF01425 | Amidase | 0.76 |
| PF07519 | Tannase | 0.76 |
| PF00141 | peroxidase | 0.76 |
| PF04389 | Peptidase_M28 | 0.76 |
| PF04072 | LCM | 0.76 |
| PF13594 | Obsolete Pfam Family | 0.76 |
| PF08818 | DUF1801 | 0.76 |
| PF07075 | DUF1343 | 0.76 |
| PF13532 | 2OG-FeII_Oxy_2 | 0.76 |
| PF13472 | Lipase_GDSL_2 | 0.76 |
| PF06713 | bPH_4 | 0.76 |
| PF08281 | Sigma70_r4_2 | 0.76 |
| PF13474 | SnoaL_3 | 0.76 |
| PF03551 | PadR | 0.76 |
| PF13857 | Ank_5 | 0.76 |
| PF03449 | GreA_GreB_N | 0.76 |
| PF01177 | Asp_Glu_race | 0.76 |
| PF13847 | Methyltransf_31 | 0.76 |
| COG ID | Name | Functional Category | % Frequency in 132 Family Scaffolds |
|---|---|---|---|
| COG0262 | Dihydrofolate reductase | Coenzyme transport and metabolism [H] | 4.55 |
| COG3070 | Transcriptional regulator of competence genes, TfoX/Sxy family | Transcription [K] | 4.55 |
| COG1985 | Pyrimidine reductase, riboflavin biosynthesis | Coenzyme transport and metabolism [H] | 4.55 |
| COG2723 | Beta-glucosidase/6-phospho-beta-glucosidase/beta-galactosidase | Carbohydrate transport and metabolism [G] | 2.27 |
| COG4806 | L-rhamnose isomerase | Carbohydrate transport and metabolism [G] | 2.27 |
| COG0427 | Propionyl CoA:succinate CoA transferase | Energy production and conversion [C] | 0.76 |
| COG0782 | Transcription elongation factor, GreA/GreB family | Transcription [K] | 0.76 |
| COG1595 | DNA-directed RNA polymerase specialized sigma subunit, sigma24 family | Transcription [K] | 0.76 |
| COG1695 | DNA-binding transcriptional regulator, PadR family | Transcription [K] | 0.76 |
| COG1733 | DNA-binding transcriptional regulator, HxlR family | Transcription [K] | 0.76 |
| COG1846 | DNA-binding transcriptional regulator, MarR family | Transcription [K] | 0.76 |
| COG0376 | Catalase (peroxidase I) | Inorganic ion transport and metabolism [P] | 0.76 |
| COG0154 | Asp-tRNAAsn/Glu-tRNAGln amidotransferase A subunit or related amidase | Translation, ribosomal structure and biogenesis [J] | 0.76 |
| COG3315 | O-Methyltransferase involved in polyketide biosynthesis | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.76 |
| COG3876 | Exo-beta-N-acetylmuramidase YbbC/NamZ, DUF1343 family | Cell wall/membrane/envelope biogenesis [M] | 0.76 |
| COG4430 | Uncharacterized conserved protein YdeI, YjbR/CyaY-like superfamily, DUF1801 family | Function unknown [S] | 0.76 |
| COG4540 | Phage P2 baseplate assembly protein gpV | Mobilome: prophages, transposons [X] | 0.76 |
| COG5646 | Iron-binding protein Fra/YdhG, frataxin family (Fe-S cluster biosynthesis) | Posttranslational modification, protein turnover, chaperones [O] | 0.76 |
| COG5649 | Uncharacterized conserved protein, DUF1801 domain | Function unknown [S] | 0.76 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 63.64 % |
| Unclassified | root | N/A | 36.36 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2170459009|GA8DASG01ASRDO | All Organisms → cellular organisms → Bacteria → Acidobacteria | 503 | Open in IMG/M |
| 3300000364|INPhiseqgaiiFebDRAFT_105141539 | All Organisms → cellular organisms → Bacteria | 538 | Open in IMG/M |
| 3300004114|Ga0062593_101542031 | Not Available | 718 | Open in IMG/M |
| 3300004114|Ga0062593_102591713 | All Organisms → cellular organisms → Bacteria | 576 | Open in IMG/M |
| 3300004114|Ga0062593_102964039 | Not Available | 543 | Open in IMG/M |
| 3300004153|Ga0063455_100780931 | All Organisms → cellular organisms → Bacteria | 658 | Open in IMG/M |
| 3300004153|Ga0063455_100937770 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Motilibacterales → Vallicoccaceae → Vallicoccus → Vallicoccus soli | 618 | Open in IMG/M |
| 3300004157|Ga0062590_100861909 | Not Available | 842 | Open in IMG/M |
| 3300004480|Ga0062592_102391832 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 530 | Open in IMG/M |
| 3300005093|Ga0062594_100049322 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2138 | Open in IMG/M |
| 3300005162|Ga0066814_10040433 | Not Available | 735 | Open in IMG/M |
| 3300005330|Ga0070690_100422802 | All Organisms → cellular organisms → Bacteria | 983 | Open in IMG/M |
| 3300005332|Ga0066388_100999919 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium | 1401 | Open in IMG/M |
| 3300005333|Ga0070677_10646333 | Not Available | 590 | Open in IMG/M |
| 3300005354|Ga0070675_100454641 | All Organisms → cellular organisms → Bacteria | 1149 | Open in IMG/M |
| 3300005354|Ga0070675_101211198 | Not Available | 695 | Open in IMG/M |
| 3300005365|Ga0070688_100852097 | All Organisms → cellular organisms → Bacteria | 716 | Open in IMG/M |
| 3300005366|Ga0070659_100201887 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1637 | Open in IMG/M |
| 3300005367|Ga0070667_101455022 | Not Available | 643 | Open in IMG/M |
| 3300005434|Ga0070709_10351867 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1089 | Open in IMG/M |
| 3300005444|Ga0070694_101255115 | All Organisms → cellular organisms → Bacteria | 622 | Open in IMG/M |
| 3300005455|Ga0070663_100735598 | Not Available | 841 | Open in IMG/M |
| 3300005456|Ga0070678_101244758 | Not Available | 691 | Open in IMG/M |
| 3300005456|Ga0070678_101726440 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 589 | Open in IMG/M |
| 3300005526|Ga0073909_10339264 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 693 | Open in IMG/M |
| 3300005547|Ga0070693_100916997 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 657 | Open in IMG/M |
| 3300005564|Ga0070664_101437341 | Not Available | 652 | Open in IMG/M |
| 3300005617|Ga0068859_100530163 | All Organisms → cellular organisms → Bacteria | 1272 | Open in IMG/M |
| 3300005618|Ga0068864_100067887 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3097 | Open in IMG/M |
| 3300005618|Ga0068864_101605314 | Not Available | 654 | Open in IMG/M |
| 3300005618|Ga0068864_101881354 | All Organisms → cellular organisms → Bacteria | 604 | Open in IMG/M |
| 3300005713|Ga0066905_102151732 | Not Available | 519 | Open in IMG/M |
| 3300005764|Ga0066903_102131081 | All Organisms → cellular organisms → Bacteria | 1080 | Open in IMG/M |
| 3300005764|Ga0066903_106063719 | All Organisms → cellular organisms → Bacteria | 633 | Open in IMG/M |
| 3300006046|Ga0066652_101350470 | All Organisms → cellular organisms → Bacteria | 670 | Open in IMG/M |
| 3300006173|Ga0070716_101146195 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 622 | Open in IMG/M |
| 3300006196|Ga0075422_10358183 | All Organisms → cellular organisms → Bacteria | 637 | Open in IMG/M |
| 3300006237|Ga0097621_101331160 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 679 | Open in IMG/M |
| 3300006755|Ga0079222_10670507 | All Organisms → cellular organisms → Bacteria | 812 | Open in IMG/M |
| 3300006797|Ga0066659_11237256 | Not Available | 623 | Open in IMG/M |
| 3300006852|Ga0075433_10082716 | All Organisms → cellular organisms → Bacteria | 2832 | Open in IMG/M |
| 3300006852|Ga0075433_10168872 | All Organisms → cellular organisms → Bacteria | 1947 | Open in IMG/M |
| 3300006854|Ga0075425_101267595 | Not Available | 836 | Open in IMG/M |
| 3300006854|Ga0075425_101391713 | All Organisms → cellular organisms → Bacteria | 794 | Open in IMG/M |
| 3300006871|Ga0075434_100311593 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1594 | Open in IMG/M |
| 3300006871|Ga0075434_102477301 | Not Available | 520 | Open in IMG/M |
| 3300006954|Ga0079219_11564971 | Not Available | 601 | Open in IMG/M |
| 3300009090|Ga0099827_11534302 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 580 | Open in IMG/M |
| 3300009094|Ga0111539_10325724 | All Organisms → cellular organisms → Bacteria | 1788 | Open in IMG/M |
| 3300009098|Ga0105245_10277797 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1636 | Open in IMG/M |
| 3300009100|Ga0075418_11552444 | All Organisms → cellular organisms → Bacteria | 719 | Open in IMG/M |
| 3300009101|Ga0105247_11754632 | All Organisms → cellular organisms → Bacteria → Synergistetes → Synergistia → Synergistales → Synergistaceae → Cloacibacillus | 515 | Open in IMG/M |
| 3300009148|Ga0105243_12559557 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 550 | Open in IMG/M |
| 3300009174|Ga0105241_10576157 | All Organisms → cellular organisms → Bacteria | 1014 | Open in IMG/M |
| 3300009176|Ga0105242_10647160 | All Organisms → cellular organisms → Bacteria | 1027 | Open in IMG/M |
| 3300009176|Ga0105242_11064469 | All Organisms → cellular organisms → Bacteria | 821 | Open in IMG/M |
| 3300009176|Ga0105242_11923894 | Not Available | 632 | Open in IMG/M |
| 3300009545|Ga0105237_10881433 | Not Available | 902 | Open in IMG/M |
| 3300009553|Ga0105249_12568523 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium RIFCSPLOWO2_12_FULL_66_21 | 582 | Open in IMG/M |
| 3300010362|Ga0126377_11783018 | Not Available | 691 | Open in IMG/M |
| 3300010375|Ga0105239_10344112 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1683 | Open in IMG/M |
| 3300010379|Ga0136449_100676653 | Not Available | 1737 | Open in IMG/M |
| 3300010391|Ga0136847_10816611 | All Organisms → cellular organisms → Bacteria | 569 | Open in IMG/M |
| 3300010396|Ga0134126_12063245 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 623 | Open in IMG/M |
| 3300010401|Ga0134121_10279012 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1472 | Open in IMG/M |
| 3300010401|Ga0134121_11436857 | All Organisms → cellular organisms → Bacteria | 702 | Open in IMG/M |
| 3300011119|Ga0105246_11378071 | All Organisms → cellular organisms → Bacteria | 657 | Open in IMG/M |
| 3300012199|Ga0137383_10902079 | Not Available | 645 | Open in IMG/M |
| 3300012208|Ga0137376_11774273 | All Organisms → cellular organisms → Bacteria → Acidobacteria → environmental samples → uncultured Acidobacteria bacterium HF4000_26D02 | 508 | Open in IMG/M |
| 3300012212|Ga0150985_103827650 | All Organisms → cellular organisms → Bacteria | 775 | Open in IMG/M |
| 3300012923|Ga0137359_10944156 | Not Available | 742 | Open in IMG/M |
| 3300012929|Ga0137404_11268103 | Not Available | 679 | Open in IMG/M |
| 3300012948|Ga0126375_11464476 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 582 | Open in IMG/M |
| 3300012957|Ga0164303_11303334 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 537 | Open in IMG/M |
| 3300012988|Ga0164306_10761593 | Not Available | 776 | Open in IMG/M |
| 3300013307|Ga0157372_13193420 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 523 | Open in IMG/M |
| 3300013308|Ga0157375_12521473 | All Organisms → cellular organisms → Bacteria | 614 | Open in IMG/M |
| 3300014326|Ga0157380_13057764 | All Organisms → cellular organisms → Bacteria | 533 | Open in IMG/M |
| 3300014326|Ga0157380_13387775 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 510 | Open in IMG/M |
| 3300015371|Ga0132258_12476544 | Not Available | 1299 | Open in IMG/M |
| 3300015372|Ga0132256_102322089 | Not Available | 640 | Open in IMG/M |
| 3300015374|Ga0132255_101018399 | Not Available | 1243 | Open in IMG/M |
| 3300015374|Ga0132255_101139204 | All Organisms → cellular organisms → Bacteria | 1173 | Open in IMG/M |
| 3300015374|Ga0132255_102927984 | All Organisms → cellular organisms → Bacteria | 729 | Open in IMG/M |
| 3300015374|Ga0132255_105388753 | All Organisms → cellular organisms → Bacteria | 541 | Open in IMG/M |
| 3300018042|Ga0187871_10294189 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3 | 899 | Open in IMG/M |
| 3300018047|Ga0187859_10265464 | All Organisms → cellular organisms → Bacteria | 924 | Open in IMG/M |
| 3300018433|Ga0066667_11398676 | Not Available | 614 | Open in IMG/M |
| 3300021420|Ga0210394_10190366 | All Organisms → cellular organisms → Bacteria | 1788 | Open in IMG/M |
| 3300025926|Ga0207659_11129615 | All Organisms → cellular organisms → Bacteria | 674 | Open in IMG/M |
| 3300025932|Ga0207690_10205475 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1499 | Open in IMG/M |
| 3300025934|Ga0207686_10330858 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1141 | Open in IMG/M |
| 3300025934|Ga0207686_11251473 | Not Available | 608 | Open in IMG/M |
| 3300025936|Ga0207670_10748527 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 811 | Open in IMG/M |
| 3300025945|Ga0207679_10918284 | Not Available | 801 | Open in IMG/M |
| 3300025961|Ga0207712_11784101 | All Organisms → cellular organisms → Bacteria → Synergistetes → Synergistia → Synergistales → Synergistaceae → Cloacibacillus | 551 | Open in IMG/M |
| 3300025981|Ga0207640_11423265 | All Organisms → cellular organisms → Bacteria | 621 | Open in IMG/M |
| 3300025981|Ga0207640_12106597 | All Organisms → cellular organisms → Bacteria | 511 | Open in IMG/M |
| 3300025986|Ga0207658_10146642 | Not Available | 1918 | Open in IMG/M |
| 3300026023|Ga0207677_10124105 | Not Available | 1948 | Open in IMG/M |
| 3300026023|Ga0207677_11272980 | Not Available | 675 | Open in IMG/M |
| 3300026035|Ga0207703_11856451 | All Organisms → cellular organisms → Bacteria | 579 | Open in IMG/M |
| 3300026088|Ga0207641_10515221 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Caulobacterales → Caulobacteraceae → Caulobacter | 1163 | Open in IMG/M |
| 3300026095|Ga0207676_10150954 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2001 | Open in IMG/M |
| 3300026095|Ga0207676_11723063 | All Organisms → cellular organisms → Bacteria | 625 | Open in IMG/M |
| 3300026095|Ga0207676_12472404 | All Organisms → cellular organisms → Bacteria | 516 | Open in IMG/M |
| 3300027821|Ga0209811_10258365 | Not Available | 666 | Open in IMG/M |
| 3300031231|Ga0170824_120411923 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 574 | Open in IMG/M |
| 3300031234|Ga0302325_11396893 | Not Available | 911 | Open in IMG/M |
| 3300031366|Ga0307506_10274311 | All Organisms → cellular organisms → Bacteria | 650 | Open in IMG/M |
| 3300031474|Ga0170818_110831061 | Not Available | 618 | Open in IMG/M |
| 3300031668|Ga0318542_10162178 | Not Available | 1115 | Open in IMG/M |
| 3300031716|Ga0310813_10740330 | Not Available | 881 | Open in IMG/M |
| 3300031716|Ga0310813_11676755 | All Organisms → cellular organisms → Bacteria | 595 | Open in IMG/M |
| 3300031879|Ga0306919_10997854 | Not Available | 640 | Open in IMG/M |
| 3300031910|Ga0306923_10516026 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1350 | Open in IMG/M |
| 3300031912|Ga0306921_10622182 | All Organisms → cellular organisms → Bacteria | 1247 | Open in IMG/M |
| 3300031940|Ga0310901_10495297 | All Organisms → cellular organisms → Bacteria | 547 | Open in IMG/M |
| 3300032001|Ga0306922_11809017 | Not Available | 601 | Open in IMG/M |
| 3300032039|Ga0318559_10449528 | All Organisms → cellular organisms → Bacteria | 601 | Open in IMG/M |
| 3300032044|Ga0318558_10578064 | Not Available | 561 | Open in IMG/M |
| 3300032075|Ga0310890_10977248 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 680 | Open in IMG/M |
| 3300032089|Ga0318525_10563597 | Not Available | 582 | Open in IMG/M |
| 3300032421|Ga0310812_10306095 | Not Available | 707 | Open in IMG/M |
| 3300032770|Ga0335085_11634362 | Not Available | 666 | Open in IMG/M |
| 3300032782|Ga0335082_10345281 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1357 | Open in IMG/M |
| 3300032828|Ga0335080_11884115 | Not Available | 582 | Open in IMG/M |
| 3300033412|Ga0310810_10001853 | All Organisms → cellular organisms → Bacteria | 22409 | Open in IMG/M |
| 3300033475|Ga0310811_10651865 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Caulobacterales → Caulobacteraceae → Caulobacter | 1037 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 6.82% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 6.82% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 6.06% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 6.06% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 4.55% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 4.55% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 3.79% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.79% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 3.79% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 3.79% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 3.03% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 3.03% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 3.03% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 2.27% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 2.27% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 2.27% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 2.27% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 2.27% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 2.27% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 1.52% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 1.52% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.52% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.52% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.52% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 1.52% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 1.52% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.52% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.52% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 1.52% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 1.52% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.52% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.52% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Sediment | 0.76% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.76% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 0.76% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.76% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 0.76% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 0.76% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.76% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.76% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.76% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.76% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2170459009 | Grass soil microbial communities from Rothamsted Park, UK - July 2009 indirect DNA Tissue lysis 0-10cm | Environmental | Open in IMG/M |
| 3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
| 3300004153 | Grasslands soil microbial communities from Hopland, California, USA (version 2) | Environmental | Open in IMG/M |
| 3300004157 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2 | Environmental | Open in IMG/M |
| 3300004480 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4 | Environmental | Open in IMG/M |
| 3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
| 3300005162 | Soil and rhizosphere microbial communities from Laval, Canada - mgLAB | Environmental | Open in IMG/M |
| 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Host-Associated | Open in IMG/M |
| 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Environmental | Open in IMG/M |
| 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
| 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Environmental | Open in IMG/M |
| 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Host-Associated | Open in IMG/M |
| 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005526 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 | Environmental | Open in IMG/M |
| 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Environmental | Open in IMG/M |
| 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
| 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Host-Associated | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006196 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 | Host-Associated | Open in IMG/M |
| 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) | Host-Associated | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
| 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
| 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300010391 | Freshwater sediment microbial communities from Lake Superior, USA - Station SU-17. Combined Assembly of Gp0155404, Gp0155335, Gp0155336, Gp0155336, Gp0155403, Gp0155406 | Environmental | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Host-Associated | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
| 3300012988 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MG | Environmental | Open in IMG/M |
| 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
| 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Host-Associated | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300018042 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_10 | Environmental | Open in IMG/M |
| 3300018047 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_10 | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027821 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031234 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2 | Environmental | Open in IMG/M |
| 3300031366 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 25_S | Environmental | Open in IMG/M |
| 3300031474 | Fir Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031668 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23 | Environmental | Open in IMG/M |
| 3300031716 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3 | Environmental | Open in IMG/M |
| 3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031940 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D2 | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032039 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f21 | Environmental | Open in IMG/M |
| 3300032044 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f20 | Environmental | Open in IMG/M |
| 3300032075 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D3 | Environmental | Open in IMG/M |
| 3300032089 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f23 | Environmental | Open in IMG/M |
| 3300032421 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NN3 | Environmental | Open in IMG/M |
| 3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
| 3300032782 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1 | Environmental | Open in IMG/M |
| 3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
| 3300033412 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NC | Environmental | Open in IMG/M |
| 3300033475 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YC | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| F47_11290630 | 2170459009 | Grass Soil | MGADTWHQRTVIQTPSADAMTATSYLSFSAVPEWKGAEIKYTRRSK |
| INPhiseqgaiiFebDRAFT_1051415391 | 3300000364 | Soil | LKASHMLAGDPWTQRTVIQPTSADTMVVASYLSFGKVPEWKAVEIRYTRRAK* |
| Ga0062593_1015420311 | 3300004114 | Soil | MSLESKSRVGADYPLAGDTWHQRTVIQPMSADAMIVASYLSFGSVPEWKGVEIKYTRKSK |
| Ga0062593_1025917131 | 3300004114 | Soil | SQQFELKADYPLAGDTWHQRTVIQQASKDTMIAASYLSFGAVPEWKAVEIKYTRK* |
| Ga0062593_1029640392 | 3300004114 | Soil | MPWTASYFSFSPLAGDTWHQRTVIQPLTADTMTAASYLSFGTVPEWKSVEITYTRRTK* |
| Ga0063455_1007809311 | 3300004153 | Soil | AGDTWHQRTVIQPTSADTMTATSYLSFGTVPEWKGVEIKYTRRIK* |
| Ga0063455_1009377702 | 3300004153 | Soil | KQFVLKADYALAGDTWHQRTVFQMVSQDAMVATSYLSFGTVPEWKAVEIKYGRKAR* |
| Ga0062590_1008619092 | 3300004157 | Soil | MSLESKGRVGSYYPLAGDTWHQRTVIQPMSADAMIVASYLSFGSVPEWKVEIKYTRKSK* |
| Ga0062592_1023918322 | 3300004480 | Soil | YPLAGDTWHQRTVIQPMSADAMIVASYLSFGSVPEWKGVEIKYTRKSK* |
| Ga0062594_1000493223 | 3300005093 | Soil | MSLESKSRVGADYPLAGDTWHQRTVIQPMSADAMIVANYLSFGSVPEWKGVEIKYTRKSK |
| Ga0066814_100404332 | 3300005162 | Soil | YDDKARQFEMTADYPLAGETWHQRTVIQPVSNDAMVAASYLSFGTVPEWKSVEIKYTRRTQ* |
| Ga0070690_1004228023 | 3300005330 | Switchgrass Rhizosphere | TRQFELKADYALAGDTWHQRTVIQLLSANTMVATSYLSFGTVPEWKAVEIKYTRKQ* |
| Ga0066388_1009999192 | 3300005332 | Tropical Forest Soil | RQFELKADYPLGGETWHQRTVIQPVSNDAMVAASYLSFGQVPEWKGMEIKYTRRAP* |
| Ga0070677_106463331 | 3300005333 | Miscanthus Rhizosphere | KQFELKADYPLAGDTWHQRTVIQPTTADTMTAASYLSFGTVPEWKSVEIKYTRRTK* |
| Ga0070675_1004546413 | 3300005354 | Miscanthus Rhizosphere | ADYQLAGETWHQRTVIQQPSADAMTATSYLSFGAVPEWKGAEIKYTRRK* |
| Ga0070675_1012111981 | 3300005354 | Miscanthus Rhizosphere | DLNAAYPMAGDTWRQRTVIHIESADAMTATSYLSFGTVPEWKAVEMRYTRKQ* |
| Ga0070688_1008520971 | 3300005365 | Switchgrass Rhizosphere | LRADYAMSGDTWHQRTVIEQASADAMTAASYLSFGAVPEWKGVEIKYARRSK* |
| Ga0070659_1002018874 | 3300005366 | Corn Rhizosphere | TWHQRTVIQPMSADAMIVASYLSFGSVPEWKGVEIKYTRKSK* |
| Ga0070667_1014550222 | 3300005367 | Switchgrass Rhizosphere | HQRTTILPQSANSMVATSYLSFGRVPEWKAVEIKYTRRP* |
| Ga0070709_103518671 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | GDTWHQRTVIERKSADTMVTVSYLSFGKVPEWKGVEIKYTRRGK* |
| Ga0070694_1012551151 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | QARRFELKGSYKLAGDTWTQRTVIQPASADSMVATSYLSFGTVPEWKAVEITYKRTGK* |
| Ga0070663_1007355982 | 3300005455 | Corn Rhizosphere | MSLESKGRVGADYPLAGDTWHQRTVIQPMSADAMIVASYLSFGSVPEWKGVEIKYTRKSK |
| Ga0070678_1012447582 | 3300005456 | Miscanthus Rhizosphere | SACLLSLAGDTWHQRTVIQPTTADTMTAASYLSFGTVPEWKSVEIKYTRRTK* |
| Ga0070678_1017264401 | 3300005456 | Miscanthus Rhizosphere | FVSPQSTDELGESKGRVGADYPLAGDTWHQRTVIQPMSADAMIVASYLSFGSVPEWKGVEIKYTRKSK* |
| Ga0073909_103392641 | 3300005526 | Surface Soil | KADYPLAGDTWHQRTVIQQTSGDAMTAASYLSFGAVPEWKAVEIKYTGKR* |
| Ga0070693_1009169971 | 3300005547 | Corn, Switchgrass And Miscanthus Rhizosphere | WHQRTVIQPMSADAMIVASYLSFGSVPEWKGVEIKYTRKSK* |
| Ga0070664_1014373411 | 3300005564 | Corn Rhizosphere | QDAGDTWHQRTTILPQSANSMVATSYLSFGRVPEWKAVEIKYTRRP* |
| Ga0068859_1005301633 | 3300005617 | Switchgrass Rhizosphere | VIQPTTADTMTAASYLSFGTVPEWKSVEIKYTRRAK* |
| Ga0068864_1000678874 | 3300005618 | Switchgrass Rhizosphere | KADYASGGDTWHQRTVIQPTTPDTMIAVSYLSFGNVPEWKAVEIKYTRRVK* |
| Ga0068864_1016053142 | 3300005618 | Switchgrass Rhizosphere | FELKAEYPMAGDTWRQRTVIEITSADAMTATSYLSFGAVPEWKGVEIKYKRRSESRP* |
| Ga0068864_1018813541 | 3300005618 | Switchgrass Rhizosphere | QADYPLAGDTWHQRTVIQQASKDTMIAASYLSFGAVPEWKAVEIKYTRK* |
| Ga0066905_1021517321 | 3300005713 | Tropical Forest Soil | QFELKADYPLAGDTWHQRTVIQPATADTMVAASYLSFGAVPEWKSVEIKYTRRTK* |
| Ga0066903_1021310811 | 3300005764 | Tropical Forest Soil | WHQRTVIEPTSTDAMTAASYLSFGAVPEWKGVEIKYTRRARCSTAAP* |
| Ga0066903_1060637192 | 3300005764 | Tropical Forest Soil | DEKTKTFELKADYRLAGDTWHQRTVITQTAADAMTAASYLSFGTVPEWKAVEIKYIRRSR |
| Ga0066652_1013504701 | 3300006046 | Soil | DYPLAGETWHQRTVIQPLSADTMIATSYLSFGSIPEWKGVEIKYTRRAK* |
| Ga0070716_1011461951 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | DYPLAGDTWHQRTVITQTSAEVMVAASYLSFGKVPEWKAVEIKYTGKR* |
| Ga0070712_1016503121 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | AESGVWNEQDRRFELKATFTLAGDMWTQRTVIEPTSPDAMVASSYLSFGAVPEWKAVEIRYTRRSK* |
| Ga0075422_103581831 | 3300006196 | Populus Rhizosphere | TVIQQPSPDAMTAASYLSFGNVPEWKAVELKYTRGK* |
| Ga0097621_1013311601 | 3300006237 | Miscanthus Rhizosphere | ADYALAGETWHQRTIIQPTSADAMVAISYLSFGTVAEWKGVEISYTRRER* |
| Ga0097621_1020755912 | 3300006237 | Miscanthus Rhizosphere | FELKAEYPMGADLWTQRTVIEVTSSDKMTASSFLAFGGVPEWKAVEIRYARRTK* |
| Ga0079222_106705073 | 3300006755 | Agricultural Soil | LAGDMWTQRTVIGPTSPDAMVASSYLSFGAVPEWKAVEIRYTRRSK* |
| Ga0066659_112372562 | 3300006797 | Soil | RQRTVIQIVSADAMIATSYLSFGKVPEWKAVEIKYTRRAK* |
| Ga0075433_100827163 | 3300006852 | Populus Rhizosphere | GETWHQRTVIQPVSNDAMIAAGYLSFGQVPEWKGMEIKYTRRAP* |
| Ga0075433_101688723 | 3300006852 | Populus Rhizosphere | MAGDTWHQRTVIRASSADAMTATSFLSFGTVPEWKAVEITYARKK* |
| Ga0075425_1012675952 | 3300006854 | Populus Rhizosphere | MAGDTWHQRTVIRASSADAMTATSFLSFGTVPEWKA |
| Ga0075425_1013917132 | 3300006854 | Populus Rhizosphere | KRFELKADYPLAGDTWHQRTVIQPTSADTMIAASYLSFGTVPEWKSVEIKYTRRAK* |
| Ga0075434_1003115932 | 3300006871 | Populus Rhizosphere | MAGDTWHQRTLIHASSADAMTATSFLSFGTVPEWKAVEITYARKK* |
| Ga0075434_1024773011 | 3300006871 | Populus Rhizosphere | VRSSSRAPWSPARHFELKATYVLAGDTWSQRAVIEPTSSNTMVVASYLSFGKVPEWKAVEIRYTKRT* |
| Ga0079219_115649712 | 3300006954 | Agricultural Soil | DYLLAGDTWHQRTVIKMSSSETMQATSYLSFGTVPEWKGVEIKYSKSTK* |
| Ga0099827_115343021 | 3300009090 | Vadose Zone Soil | VAPAHVIQPTSADAMIATSYLSFGKVPEWKGVEIK* |
| Ga0111539_103257243 | 3300009094 | Populus Rhizosphere | QFELKADYALAGDTWHQRTVIQQPSPDAMTAASYLSFGNVPEWKAVELKYTRGK* |
| Ga0105245_102777971 | 3300009098 | Miscanthus Rhizosphere | TWHQRTIIQPTSADAMVAISYLSFGTVAEWKGVEISYTRRER* |
| Ga0075418_115524441 | 3300009100 | Populus Rhizosphere | HQRTVIQPTSADVMTATSYLSFGAVPEWKGVEIKYTRRAR* |
| Ga0105247_117546321 | 3300009101 | Switchgrass Rhizosphere | DTWHQRTVIQPTTADTMTAASYLSFGTVPEWKSVEIKYTRRAK* |
| Ga0105243_125595572 | 3300009148 | Miscanthus Rhizosphere | LKAEYPVAGDLWHQRTVIQPISADTMIAASYLSFGTVPEWKGVEIKYTRGAK* |
| Ga0105241_105761571 | 3300009174 | Corn Rhizosphere | MAGDTWTQRTLIEPTSPNTMVVASYLSFGKVPEWKAVEIRYTRRAGAQ* |
| Ga0105242_106471602 | 3300009176 | Miscanthus Rhizosphere | SYPLAGETWTQRTVIQPTSPNTMVADSYLSFGTVPEWKAVEIKYARRPK* |
| Ga0105242_110644691 | 3300009176 | Miscanthus Rhizosphere | YPLAGDTWHQRTVIQQTSKDTMMAASYLSFGAVPEWKGVEIKYTRK* |
| Ga0105242_119238942 | 3300009176 | Miscanthus Rhizosphere | QQFELKADYPFAGDTWHQRTVIRMTSADAMVAASYLSFGQVPEWKGVEIKYARRH* |
| Ga0105237_108814332 | 3300009545 | Corn Rhizosphere | LLSLAGDTWHQRTVIQPTTADTMTAASYLSFGTVAEWKSVEIKYTRRAK* |
| Ga0105249_125685232 | 3300009553 | Switchgrass Rhizosphere | LAGETWHQRTVIQQPSADAMTATSYLSFGTVPEWKGAEIKYTRRK* |
| Ga0126377_117830182 | 3300010362 | Tropical Forest Soil | WDEAARHFELKGSYQMAGETWRQRTVIEPTSANTMIAVSYLSFGTVPEWKALEIRYTRRAK* |
| Ga0105239_103441122 | 3300010375 | Corn Rhizosphere | DESTGQFELKADYALAGETWHQRTIIQPTSADAMVAISYLSFGTVAEWKGVEISYTRRER |
| Ga0136449_1006766531 | 3300010379 | Peatlands Soil | KQFELKAEYPLAGDTWRQRTVIQPTSSDAMLVASYLSFGKVPEWKGVEIKYTRRSSTK* |
| Ga0136847_108166111 | 3300010391 | Freshwater Sediment | IQPTSADVMTATSYLSFGAVPEWKAVEIRYTRRAK* |
| Ga0134126_120632451 | 3300010396 | Terrestrial Soil | DYPLAGDTWHQRTVIQPMSADAMIVASYLSFGSVPEWKGVEIKYTRKSK* |
| Ga0134121_102790121 | 3300010401 | Terrestrial Soil | HQRTVIQPASADAMTAVSYLSFGSVPEWKGIEIKYVRRAKCDTAVR* |
| Ga0134121_114368572 | 3300010401 | Terrestrial Soil | YPLGGDTWHQRTVIQPTSADAMTVTSYLSFGKVPEWKGVEMKYSRKSG* |
| Ga0105246_113780712 | 3300011119 | Miscanthus Rhizosphere | LKAEYPVAGDLWHQRTVIQPISADTMIAASYLSFGTVHEWKGVEI |
| Ga0137383_109020792 | 3300012199 | Vadose Zone Soil | LKADYPLAGETWHQRTVILPLSADAMMATSYLSFGNVPEWKGVEIKYTRRAK* |
| Ga0137376_117742732 | 3300012208 | Vadose Zone Soil | VIQPMSADTMIATSYLSFGKVPEWKGVEIKYTRRAK* |
| Ga0150985_1038276501 | 3300012212 | Avena Fatua Rhizosphere | GDSWTQRTVIQPTSADTMVATSYLSFGKVPEWKAVEIKYARRSK* |
| Ga0137359_109441561 | 3300012923 | Vadose Zone Soil | TKQFELKAEYPMAGETWRQRTVIQPLTADTMIATSYLSFGKVPEWKGVEIKYTRRAK* |
| Ga0137404_112681031 | 3300012929 | Vadose Zone Soil | KTGQFELKAEYPLAGETWRQRTVIQPMSADTMIATSYLSFGNVPEWKGVEIKYTR* |
| Ga0126375_114644761 | 3300012948 | Tropical Forest Soil | HQRTVIQPTSADTMIATSYLSFGTVPEWKGVEIKYRRRAK* |
| Ga0164303_113033341 | 3300012957 | Soil | TWHQRTVIQSTSADTMTAASYLSFGTVPEWKGVELKYARRTK* |
| Ga0164306_107615931 | 3300012988 | Soil | LKADYALAGDTWHQRTVIQLLSANTMVATSYLSFGTVPEWKAVEIKYTRKQ* |
| Ga0157372_131934202 | 3300013307 | Corn Rhizosphere | GADYPLAGDTWHQRTVIQPMSADAMIVASYLSFGSVPEWKGVEIKYTRKSK* |
| Ga0157375_125214731 | 3300013308 | Miscanthus Rhizosphere | EQVKQFELKADYPLAGDIWHQRTVIQQTSNDTMIAASYLSFGAVPEWKAVEIKYTRK* |
| Ga0157380_130577642 | 3300014326 | Switchgrass Rhizosphere | LKADYALAGDTWHQRTVIQQPSPDAMTAASYLSFGNVPEWKAVEIKYTRRK* |
| Ga0157380_133877751 | 3300014326 | Switchgrass Rhizosphere | EKTKQFELKADYSLAGDTWHQRTVIQQTSPDAMIATSYLSFGTVAEWKAVEIKYTRRAK* |
| Ga0132258_124765442 | 3300015371 | Arabidopsis Rhizosphere | AFDEKTGQFELKGDYQLAGQTWHQRTVIQPGPGSAMTATSYLSFGTVPEWKAVNISYTRQTK* |
| Ga0132256_1023220892 | 3300015372 | Arabidopsis Rhizosphere | WHQRTVIEVTSADAMTATSYLSFGTVPEWKAVEIKYRRTQKTR* |
| Ga0132255_1010183993 | 3300015374 | Arabidopsis Rhizosphere | WHQRTVIQATSADAMVAASYLSFGQVAEWKGVEIKYTRRK* |
| Ga0132255_1011392041 | 3300015374 | Arabidopsis Rhizosphere | DENAKRFELKADYPLAGDTWHQRTVIQPTSADTMIAASYLSFGTVPEWKSVEIKYTRRAK |
| Ga0132255_1029279841 | 3300015374 | Arabidopsis Rhizosphere | TKQFELKADYPLAGQTWHQRTVIAPISAEAMLATSYLSFGTVPEWKAVEIKYTRKQ* |
| Ga0132255_1053887531 | 3300015374 | Arabidopsis Rhizosphere | DTWHQRTVIQQPSPDAMTAASYLSFGNVPEWKAVEIKYTRRK* |
| Ga0187871_102941891 | 3300018042 | Peatland | SQFELKAEYPFAGDTWHQRTVIETKSANAMLVRSYLSVGKTPEWKGVEIRYQRRTR |
| Ga0187859_102654641 | 3300018047 | Peatland | ANRFELKADYPLGGDTWRQRTVIEAKSADTMIVRSYLSFGTVPEWLGVEIKYQRRTK |
| Ga0066667_113986762 | 3300018433 | Grasslands Soil | WRQRTVIQIVSAEAMIATSYLSFGKVPEWKAVEIKYTRKAK |
| Ga0210401_104152351 | 3300020583 | Soil | ESGSYDEKAKQFELKAEYPMAGDTWRQRTVIQPTLPDAMLVSSYLTFGNVPEWKGVEIKYTRKGK |
| Ga0210394_101903662 | 3300021420 | Soil | MAGDTWRQRTVIQPMLPDAMLVASYLSLGKVPEWKGVEIKYTRKGK |
| Ga0207659_111296152 | 3300025926 | Miscanthus Rhizosphere | MPWTASYFSFSPLAGDTWHQRTVIQPLTADTMTAASYLSFGTVPEWKSVEITYTRRTK |
| Ga0207690_102054751 | 3300025932 | Corn Rhizosphere | VIQPMSADAMIVASYLSFGSVPEWKGVEIKYTRKSK |
| Ga0207686_103308581 | 3300025934 | Miscanthus Rhizosphere | ASYPLAGETWTQRTVIQPTSPNTMVADSYLSFGTVPEWKAVQIKYTRRPK |
| Ga0207686_112514732 | 3300025934 | Miscanthus Rhizosphere | AGDTWHQRTVIQLLSANTMVATSYLSFGTVPEWKAVEIKYTRKQ |
| Ga0207670_107485273 | 3300025936 | Switchgrass Rhizosphere | KASYPLAGETWTQRTVIQPTSPNTMVADSYLSFGTVPEWKAVQIKYTRRPK |
| Ga0207679_109182842 | 3300025945 | Corn Rhizosphere | GHFDELAKAFDLKADYQDAGDTWHQRTTILPQSANSMVATSYLSFGRVPEWKAVEIKYTRRP |
| Ga0207712_117841011 | 3300025961 | Switchgrass Rhizosphere | DETAKQFELKAEYPLGGDTWHQRTVIQPTTADTMTAASYLSFGTVPEWKSVEIKYTRRAK |
| Ga0207640_114232652 | 3300025981 | Corn Rhizosphere | AGDTWHQRTVIQQGSGDTMTATSYLSFGAVPEWKGVEIKYTRQTK |
| Ga0207640_121065972 | 3300025981 | Corn Rhizosphere | KANRFELEADYSLAGDTWHQRTVIQPASSDSMTATSYLRFGAVPEWKAVEIKYTRRAK |
| Ga0207658_101466422 | 3300025986 | Switchgrass Rhizosphere | FELKADYALAGETWHQRTIIQPTSADAMVAISYLSFGTVAEWKGVEISYTRRER |
| Ga0207677_101241051 | 3300026023 | Miscanthus Rhizosphere | LAGETWHQRTIIQPTSADAMVAISYLSFGTVAEWKGVEISYTRRER |
| Ga0207677_112729801 | 3300026023 | Miscanthus Rhizosphere | AEYPLGGDTWHQRTVIQPTTADTMTAASYLSFGTVPEWKSVEIKYTRRAK |
| Ga0207703_118564511 | 3300026035 | Switchgrass Rhizosphere | EKANQFNLKADYPLAGDTWHQRTVIEPKSAGTMVVTSYLSFGSTPEWKAVEIAYKRRTGP |
| Ga0207641_105152213 | 3300026088 | Switchgrass Rhizosphere | QFELKADYASGGDTWHQRTVIQPTTPDTMIAVSYLSFGNVPEWKAVEIKYTRRVK |
| Ga0207676_101509541 | 3300026095 | Switchgrass Rhizosphere | YPLGGDTWHQRTVIQPTTADTMTAASYLSFGTVPEWKSVEIKYTRRTK |
| Ga0207676_117230631 | 3300026095 | Switchgrass Rhizosphere | QQFELQADYPLAGDTWHQRTVIQQASKDTMIAASYLSFGAVPEWKAVEIKYTRK |
| Ga0207676_124724041 | 3300026095 | Switchgrass Rhizosphere | KADYASGGDTWHQRTVIQPTTPDTMIAVSYLSFGNVPEWKAVEIKYTRRVK |
| Ga0209811_102583651 | 3300027821 | Surface Soil | HQRTVIQLLSANTMVATSYLSFGTVPEWKAVEIKYTRKQ |
| Ga0170824_1204119231 | 3300031231 | Forest Soil | QRTVIQQTTADAMTAASYLSFGAVPEWKAVEIKYAGKK |
| Ga0302325_113968931 | 3300031234 | Palsa | KAEYPLAGDTWRQRTVIQPTSSDAMLVASYLSVGKVPEWKGVEIKYTRRSSTK |
| Ga0307506_102743111 | 3300031366 | Soil | RQFELKADYAMAGDTWHQRTVIQPQSADTMTAASYLSFGAVPEWKAVQIRYTRVSP |
| Ga0170818_1108310611 | 3300031474 | Forest Soil | TKQFELNADYPLAGDTWHQRTVIQQTAADAMKATSYLRFGSVPEWKAVEMRYTLRAK |
| Ga0318542_101621781 | 3300031668 | Soil | ETWHQRTVIQQSSPDAMTATSYLSFGSVPEWKAVEIKYSRK |
| Ga0310813_107403301 | 3300031716 | Soil | QTKQFELKADYPLAGETWHQRTVIRQLSPTSMIATSYLSFGGVPEWKGVEITYTRRP |
| Ga0310813_116767551 | 3300031716 | Soil | WHQRTVIQTIAADAMIAASYLSFATVPEWKGVEIKYTRRAK |
| Ga0306919_109978542 | 3300031879 | Soil | LKADYPLGGDTWHQRTVIQQASPDAMTATSYLSFGTVAEWKAVEMKYTRRR |
| Ga0306923_105160261 | 3300031910 | Soil | LIEVRSPESMIATSYLSFGQVPEWKGVEIKYARRTK |
| Ga0306921_106221822 | 3300031912 | Soil | HQRTVIEQTSADAMIARSFLSFGKVPEWMAVEIQYSRRTK |
| Ga0310901_104952971 | 3300031940 | Soil | QFELKADYALAGDTWHQRTVIQQPSPDAMTAASYLSFGNVPEWKAVELKYTRGK |
| Ga0306922_118090172 | 3300032001 | Soil | LAGDTWHQRTVIEIVSADAMVATSYLSFGAVPEWKAVEIKYTRRP |
| Ga0318559_104495282 | 3300032039 | Soil | LKADYPLAGDTWHQRTVIQQTSADTMTATSYLSFGNVPEWKGVEITYARRAR |
| Ga0318558_105780641 | 3300032044 | Soil | SFGGDTWHQRTLIEVRSPESMIATSYLSFGQVPEWKGVEIKYARRTK |
| Ga0310890_109772482 | 3300032075 | Soil | ARQFELKADYPLAGETWHQRTVIQPVSNDSMAAISYLSFGNVPEWKSVEIKYTRRTQ |
| Ga0318525_105635972 | 3300032089 | Soil | AGDTWHQRTVIQQSSPDAMTAESYLSFGKVPEWRAVEIKYARRK |
| Ga0310812_103060951 | 3300032421 | Soil | ELKADYALGGDTWHQRTVIQPSSADAMIATSYLSFGQVPEWKAVEIKYTRKAN |
| Ga0335085_116343621 | 3300032770 | Soil | KQFELKADYPMAGDTWHQRTVIQAKSADEMTVSSYLGFGTTPEWKGVEISYRRRAK |
| Ga0335082_103452811 | 3300032782 | Soil | TWRQRTVIKVLSPDAMLATSYLSFGAVPEWKAVEIKYSRQ |
| Ga0335080_118841152 | 3300032828 | Soil | VIQPVSSDAMVATSYLSFGKVPEWKGVEIKYTRKEK |
| Ga0310810_1000185317 | 3300033412 | Soil | MPWTASYFSFSPLAGDTWHQRTVIQPLTADIMTAASYLSFGTVPEWKSVEITYTRRTK |
| Ga0310811_106518653 | 3300033475 | Soil | FDENANQFELEADYPLAGDTWHQRTVIQPASSDSMTATSYLRFGAVPEWKAVEIKYTRRA |
| ⦗Top⦘ |