Basic Information | |
---|---|
Family ID | F061182 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 132 |
Average Sequence Length | 43 residues |
Representative Sequence | MTSGVTDTPRSGGPPAAGELAWHTLGADQVLHSEGVDGQRGLS |
Number of Associated Samples | 110 |
Number of Associated Scaffolds | 132 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 84.09 % |
% of genes near scaffold ends (potentially truncated) | 100.00 % |
% of genes from short scaffolds (< 2000 bps) | 93.18 % |
Associated GOLD sequencing projects | 107 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.24 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (59.091 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (37.121 % of family members) |
Environment Ontology (ENVO) | Unclassified (38.636 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Unclassified (41.667 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 19.72% β-sheet: 0.00% Coil/Unstructured: 80.28% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.24 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 132 Family Scaffolds |
---|---|---|
PF03729 | DUF308 | 3.79 |
PF00196 | GerE | 3.79 |
PF07992 | Pyr_redox_2 | 3.03 |
PF02770 | Acyl-CoA_dh_M | 3.03 |
PF00440 | TetR_N | 2.27 |
PF00903 | Glyoxalase | 2.27 |
PF01243 | Putative_PNPOx | 2.27 |
PF02771 | Acyl-CoA_dh_N | 2.27 |
PF06831 | H2TH | 2.27 |
PF00491 | Arginase | 1.52 |
PF01904 | DUF72 | 1.52 |
PF00005 | ABC_tran | 1.52 |
PF13193 | AMP-binding_C | 0.76 |
PF01266 | DAO | 0.76 |
PF07690 | MFS_1 | 0.76 |
PF00441 | Acyl-CoA_dh_1 | 0.76 |
PF04679 | DNA_ligase_A_C | 0.76 |
PF01058 | Oxidored_q6 | 0.76 |
PF13738 | Pyr_redox_3 | 0.76 |
PF00067 | p450 | 0.76 |
PF00589 | Phage_integrase | 0.76 |
PF00230 | MIP | 0.76 |
PF13602 | ADH_zinc_N_2 | 0.76 |
PF05239 | PRC | 0.76 |
PF00106 | adh_short | 0.76 |
PF13191 | AAA_16 | 0.76 |
COG ID | Name | Functional Category | % Frequency in 132 Family Scaffolds |
---|---|---|---|
COG1960 | Acyl-CoA dehydrogenase related to the alkylation response protein AidB | Lipid transport and metabolism [I] | 6.06 |
COG3247 | Acid resistance membrane protein HdeD, DUF308 family | General function prediction only [R] | 3.79 |
COG0266 | Formamidopyrimidine-DNA glycosylase | Replication, recombination and repair [L] | 2.27 |
COG0010 | Arginase/agmatinase family enzyme | Amino acid transport and metabolism [E] | 1.52 |
COG1801 | Sugar isomerase-related protein YecE, UPF0759/DUF72 family | General function prediction only [R] | 1.52 |
COG0377 | NADH:ubiquinone oxidoreductase 20 kD subunit (chain B) or related Fe-S oxidoreductase | Energy production and conversion [C] | 0.76 |
COG0580 | Glycerol uptake facilitator or related aquaporin (Major Intrinsic protein Family) | Carbohydrate transport and metabolism [G] | 0.76 |
COG1740 | Ni,Fe-hydrogenase I small subunit | Energy production and conversion [C] | 0.76 |
COG1793 | ATP-dependent DNA ligase | Replication, recombination and repair [L] | 0.76 |
COG1941 | Coenzyme F420-reducing hydrogenase, gamma subunit | Energy production and conversion [C] | 0.76 |
COG2124 | Cytochrome P450 | Defense mechanisms [V] | 0.76 |
COG3260 | Ni,Fe-hydrogenase III small subunit | Energy production and conversion [C] | 0.76 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 59.09 % |
Unclassified | root | N/A | 40.15 % |
Renibacterium salmoninarum | species | Renibacterium salmoninarum | 0.76 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300000364|INPhiseqgaiiFebDRAFT_100638273 | Not Available | 500 | Open in IMG/M |
3300000550|F24TB_11030537 | Not Available | 597 | Open in IMG/M |
3300003218|JGI26339J46600_10153805 | Not Available | 533 | Open in IMG/M |
3300004092|Ga0062389_100574110 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1288 | Open in IMG/M |
3300005329|Ga0070683_100166222 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Saccharopolyspora → Saccharopolyspora erythraea | 2093 | Open in IMG/M |
3300005341|Ga0070691_10717253 | Not Available | 602 | Open in IMG/M |
3300005354|Ga0070675_100716418 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 912 | Open in IMG/M |
3300005435|Ga0070714_100708513 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 971 | Open in IMG/M |
3300005468|Ga0070707_100132301 | All Organisms → cellular organisms → Bacteria | 2426 | Open in IMG/M |
3300005549|Ga0070704_100347773 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Saccharopolyspora → Saccharopolyspora erythraea | 1250 | Open in IMG/M |
3300005602|Ga0070762_10453045 | Not Available | 835 | Open in IMG/M |
3300006052|Ga0075029_100908305 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 604 | Open in IMG/M |
3300006052|Ga0075029_101040095 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 567 | Open in IMG/M |
3300006102|Ga0075015_100711512 | Not Available | 597 | Open in IMG/M |
3300006173|Ga0070716_101316368 | All Organisms → cellular organisms → Bacteria | 584 | Open in IMG/M |
3300006175|Ga0070712_100944662 | All Organisms → cellular organisms → Bacteria | 745 | Open in IMG/M |
3300006796|Ga0066665_10162392 | All Organisms → cellular organisms → Bacteria | 1704 | Open in IMG/M |
3300006854|Ga0075425_102134472 | All Organisms → cellular organisms → Bacteria | 625 | Open in IMG/M |
3300006914|Ga0075436_100130555 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1762 | Open in IMG/M |
3300010047|Ga0126382_11033489 | Renibacterium salmoninarum → Renibacterium salmoninarum ATCC 33209 | 723 | Open in IMG/M |
3300010048|Ga0126373_10647510 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1112 | Open in IMG/M |
3300010341|Ga0074045_10077944 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2325 | Open in IMG/M |
3300010358|Ga0126370_12551572 | Not Available | 510 | Open in IMG/M |
3300010373|Ga0134128_10738760 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1092 | Open in IMG/M |
3300010376|Ga0126381_100186278 | All Organisms → cellular organisms → Bacteria | 2762 | Open in IMG/M |
3300010379|Ga0136449_103459701 | Not Available | 602 | Open in IMG/M |
3300010396|Ga0134126_10927234 | Not Available | 978 | Open in IMG/M |
3300010396|Ga0134126_12341576 | Not Available | 582 | Open in IMG/M |
3300010398|Ga0126383_13056384 | Not Available | 546 | Open in IMG/M |
3300012203|Ga0137399_10263004 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1417 | Open in IMG/M |
3300012487|Ga0157321_1026169 | Not Available | 568 | Open in IMG/M |
3300012957|Ga0164303_10022804 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2445 | Open in IMG/M |
3300012971|Ga0126369_12425902 | Not Available | 610 | Open in IMG/M |
3300012984|Ga0164309_11022929 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 682 | Open in IMG/M |
3300012987|Ga0164307_10160760 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1490 | Open in IMG/M |
3300015200|Ga0173480_11006510 | Not Available | 549 | Open in IMG/M |
3300016270|Ga0182036_10534898 | Not Available | 932 | Open in IMG/M |
3300016357|Ga0182032_11330255 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 621 | Open in IMG/M |
3300016387|Ga0182040_11327231 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 608 | Open in IMG/M |
3300016422|Ga0182039_10445150 | Not Available | 1109 | Open in IMG/M |
3300017926|Ga0187807_1278879 | Not Available | 552 | Open in IMG/M |
3300017937|Ga0187809_10187831 | Not Available | 729 | Open in IMG/M |
3300017942|Ga0187808_10380710 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 643 | Open in IMG/M |
3300017942|Ga0187808_10540447 | All Organisms → cellular organisms → Bacteria | 542 | Open in IMG/M |
3300017959|Ga0187779_10954166 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 593 | Open in IMG/M |
3300017999|Ga0187767_10228707 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → unclassified Chloroflexia → Chloroflexia bacterium | 602 | Open in IMG/M |
3300018025|Ga0187885_10390613 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 624 | Open in IMG/M |
3300018046|Ga0187851_10226127 | Not Available | 1103 | Open in IMG/M |
3300020070|Ga0206356_10689411 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 805 | Open in IMG/M |
3300020082|Ga0206353_10689822 | Not Available | 582 | Open in IMG/M |
3300021432|Ga0210384_10329238 | Not Available | 1375 | Open in IMG/M |
3300021474|Ga0210390_11090765 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 649 | Open in IMG/M |
3300021475|Ga0210392_11154481 | Not Available | 580 | Open in IMG/M |
3300021478|Ga0210402_10801653 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 867 | Open in IMG/M |
3300021479|Ga0210410_10806076 | All Organisms → cellular organisms → Bacteria | 824 | Open in IMG/M |
3300021560|Ga0126371_11774878 | Not Available | 739 | Open in IMG/M |
3300021560|Ga0126371_13144843 | Not Available | 558 | Open in IMG/M |
3300024232|Ga0247664_1045960 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1012 | Open in IMG/M |
3300025898|Ga0207692_11188895 | Not Available | 506 | Open in IMG/M |
3300025904|Ga0207647_10760181 | Not Available | 524 | Open in IMG/M |
3300025915|Ga0207693_10755050 | All Organisms → cellular organisms → Bacteria | 751 | Open in IMG/M |
3300025916|Ga0207663_10082188 | All Organisms → cellular organisms → Bacteria | 2112 | Open in IMG/M |
3300025917|Ga0207660_10970340 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → unclassified Pseudonocardiaceae → Pseudonocardiaceae bacterium | 693 | Open in IMG/M |
3300025929|Ga0207664_10624838 | Not Available | 968 | Open in IMG/M |
3300026078|Ga0207702_11030414 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 817 | Open in IMG/M |
3300026118|Ga0207675_101398796 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → unclassified Pseudonocardiaceae → Pseudonocardiaceae bacterium | 720 | Open in IMG/M |
3300027698|Ga0209446_1069110 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 899 | Open in IMG/M |
3300027703|Ga0207862_1163572 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 664 | Open in IMG/M |
3300027703|Ga0207862_1196276 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 599 | Open in IMG/M |
3300027905|Ga0209415_10685124 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 738 | Open in IMG/M |
3300028146|Ga0247682_1040813 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 832 | Open in IMG/M |
3300030399|Ga0311353_10792909 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 809 | Open in IMG/M |
3300030520|Ga0311372_11791874 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 733 | Open in IMG/M |
3300031234|Ga0302325_12860550 | Not Available | 563 | Open in IMG/M |
3300031545|Ga0318541_10603323 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 614 | Open in IMG/M |
3300031546|Ga0318538_10456565 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 692 | Open in IMG/M |
3300031549|Ga0318571_10446953 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 512 | Open in IMG/M |
3300031572|Ga0318515_10366196 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 772 | Open in IMG/M |
3300031572|Ga0318515_10394154 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 741 | Open in IMG/M |
3300031680|Ga0318574_10108189 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1549 | Open in IMG/M |
3300031681|Ga0318572_10140561 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1390 | Open in IMG/M |
3300031681|Ga0318572_10939664 | All Organisms → cellular organisms → Bacteria | 513 | Open in IMG/M |
3300031723|Ga0318493_10216293 | Not Available | 1015 | Open in IMG/M |
3300031723|Ga0318493_10450111 | Not Available | 708 | Open in IMG/M |
3300031724|Ga0318500_10431785 | All Organisms → cellular organisms → Bacteria | 657 | Open in IMG/M |
3300031747|Ga0318502_10306647 | All Organisms → cellular organisms → Bacteria | 934 | Open in IMG/M |
3300031747|Ga0318502_10364551 | Not Available | 856 | Open in IMG/M |
3300031747|Ga0318502_11034499 | Not Available | 501 | Open in IMG/M |
3300031763|Ga0318537_10301747 | Not Available | 593 | Open in IMG/M |
3300031764|Ga0318535_10119606 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1163 | Open in IMG/M |
3300031764|Ga0318535_10543623 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 515 | Open in IMG/M |
3300031765|Ga0318554_10295547 | Not Available | 921 | Open in IMG/M |
3300031765|Ga0318554_10382144 | Not Available | 800 | Open in IMG/M |
3300031765|Ga0318554_10569548 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 639 | Open in IMG/M |
3300031782|Ga0318552_10453472 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 654 | Open in IMG/M |
3300031793|Ga0318548_10284554 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 812 | Open in IMG/M |
3300031819|Ga0318568_10099149 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1742 | Open in IMG/M |
3300031821|Ga0318567_10738635 | Not Available | 558 | Open in IMG/M |
3300031823|Ga0307478_10202950 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1596 | Open in IMG/M |
3300031845|Ga0318511_10591960 | Not Available | 517 | Open in IMG/M |
3300031859|Ga0318527_10195522 | Not Available | 855 | Open in IMG/M |
3300031879|Ga0306919_10633120 | Not Available | 825 | Open in IMG/M |
3300031890|Ga0306925_10495958 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1301 | Open in IMG/M |
3300031893|Ga0318536_10333744 | Not Available | 768 | Open in IMG/M |
3300031897|Ga0318520_10797353 | Not Available | 592 | Open in IMG/M |
3300031910|Ga0306923_12133140 | Not Available | 564 | Open in IMG/M |
3300031947|Ga0310909_11594919 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 518 | Open in IMG/M |
3300031954|Ga0306926_10007701 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 11710 | Open in IMG/M |
3300032008|Ga0318562_10068995 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1969 | Open in IMG/M |
3300032008|Ga0318562_10874794 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 513 | Open in IMG/M |
3300032009|Ga0318563_10260310 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 938 | Open in IMG/M |
3300032009|Ga0318563_10642259 | Not Available | 571 | Open in IMG/M |
3300032052|Ga0318506_10357273 | Not Available | 648 | Open in IMG/M |
3300032059|Ga0318533_11311813 | Not Available | 529 | Open in IMG/M |
3300032065|Ga0318513_10129134 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1197 | Open in IMG/M |
3300032066|Ga0318514_10258595 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 917 | Open in IMG/M |
3300032066|Ga0318514_10605699 | Not Available | 583 | Open in IMG/M |
3300032066|Ga0318514_10641428 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 565 | Open in IMG/M |
3300032068|Ga0318553_10228758 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 970 | Open in IMG/M |
3300032091|Ga0318577_10128236 | Not Available | 1200 | Open in IMG/M |
3300032091|Ga0318577_10363992 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 691 | Open in IMG/M |
3300032174|Ga0307470_10567417 | Not Available | 842 | Open in IMG/M |
3300032261|Ga0306920_100445278 | All Organisms → cellular organisms → Bacteria | 1925 | Open in IMG/M |
3300032770|Ga0335085_10271714 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 2025 | Open in IMG/M |
3300032770|Ga0335085_10406001 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1580 | Open in IMG/M |
3300032770|Ga0335085_11127472 | Not Available | 838 | Open in IMG/M |
3300032782|Ga0335082_10784855 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 814 | Open in IMG/M |
3300032782|Ga0335082_11105789 | Not Available | 659 | Open in IMG/M |
3300032828|Ga0335080_12419383 | Not Available | 500 | Open in IMG/M |
3300032955|Ga0335076_11705002 | Not Available | 519 | Open in IMG/M |
3300033134|Ga0335073_10006605 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 16300 | Open in IMG/M |
3300033134|Ga0335073_10982493 | Not Available | 877 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 37.12% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 6.82% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 6.82% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 6.06% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 6.06% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 3.03% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.03% |
Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 2.27% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 2.27% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 2.27% |
Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 2.27% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 1.52% |
Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 1.52% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 1.52% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 1.52% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.52% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.52% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.52% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.52% |
Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 1.52% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.52% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.52% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 0.76% |
Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.76% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.76% |
Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 0.76% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.76% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere | 0.76% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.76% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
3300000550 | Amended soil microbial communities from Kansas Great Prairies, USA - BrdU amended with acetate total DNA F2.4 TB clc assemly | Environmental | Open in IMG/M |
3300003218 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM1 | Environmental | Open in IMG/M |
3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Environmental | Open in IMG/M |
3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Environmental | Open in IMG/M |
3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Host-Associated | Open in IMG/M |
3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Environmental | Open in IMG/M |
3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
3300006102 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013 | Environmental | Open in IMG/M |
3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
3300010341 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM2 | Environmental | Open in IMG/M |
3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
3300012487 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.4.old.130510 | Host-Associated | Open in IMG/M |
3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
3300012984 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MG | Environmental | Open in IMG/M |
3300012987 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MG | Environmental | Open in IMG/M |
3300015200 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S209-509C-1 (version 2) | Environmental | Open in IMG/M |
3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
3300017926 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_2 | Environmental | Open in IMG/M |
3300017937 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_4 | Environmental | Open in IMG/M |
3300017942 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_3 | Environmental | Open in IMG/M |
3300017959 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG | Environmental | Open in IMG/M |
3300017999 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP10_10_MG | Environmental | Open in IMG/M |
3300018025 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_100 | Environmental | Open in IMG/M |
3300018046 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_10 | Environmental | Open in IMG/M |
3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
3300021475 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O | Environmental | Open in IMG/M |
3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
3300024232 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK05 | Environmental | Open in IMG/M |
3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) | Environmental | Open in IMG/M |
3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300027698 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM2 (SPAdes) | Environmental | Open in IMG/M |
3300027703 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 81 (SPAdes) | Environmental | Open in IMG/M |
3300027905 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes) | Environmental | Open in IMG/M |
3300028146 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK23 | Environmental | Open in IMG/M |
3300030399 | II_Palsa_E2 coassembly | Environmental | Open in IMG/M |
3300030520 | III_Palsa_N2 coassembly | Environmental | Open in IMG/M |
3300031234 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2 | Environmental | Open in IMG/M |
3300031545 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26 | Environmental | Open in IMG/M |
3300031546 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23 | Environmental | Open in IMG/M |
3300031549 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f24 | Environmental | Open in IMG/M |
3300031572 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19 | Environmental | Open in IMG/M |
3300031680 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22 | Environmental | Open in IMG/M |
3300031681 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20 | Environmental | Open in IMG/M |
3300031723 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23 | Environmental | Open in IMG/M |
3300031724 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20 | Environmental | Open in IMG/M |
3300031747 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22 | Environmental | Open in IMG/M |
3300031763 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f29 | Environmental | Open in IMG/M |
3300031764 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f27 | Environmental | Open in IMG/M |
3300031765 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22 | Environmental | Open in IMG/M |
3300031782 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f20 | Environmental | Open in IMG/M |
3300031793 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f21 | Environmental | Open in IMG/M |
3300031819 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21 | Environmental | Open in IMG/M |
3300031821 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f20 | Environmental | Open in IMG/M |
3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
3300031845 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f18 | Environmental | Open in IMG/M |
3300031859 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f25 | Environmental | Open in IMG/M |
3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
3300031893 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f28 | Environmental | Open in IMG/M |
3300031897 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16 | Environmental | Open in IMG/M |
3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
3300032008 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f18 | Environmental | Open in IMG/M |
3300032009 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f19 | Environmental | Open in IMG/M |
3300032052 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f19 | Environmental | Open in IMG/M |
3300032059 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27 | Environmental | Open in IMG/M |
3300032065 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f20 | Environmental | Open in IMG/M |
3300032066 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f18 | Environmental | Open in IMG/M |
3300032068 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f21 | Environmental | Open in IMG/M |
3300032091 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f25 | Environmental | Open in IMG/M |
3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
3300032782 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1 | Environmental | Open in IMG/M |
3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
3300032955 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5 | Environmental | Open in IMG/M |
3300033134 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
INPhiseqgaiiFebDRAFT_1006382733 | 3300000364 | Soil | MTSEVADTPRPGQPAAASELAWHTLGTDQVLRSEGVDGQRGL |
F24TB_110305371 | 3300000550 | Soil | MTSGVTDTPRSGEPSGAGELAWHTLGADQVLHSEGMDGKRGLSAA |
JGI26339J46600_101538051 | 3300003218 | Bog Forest Soil | MTSGVTDTPRSGRPPGSGGLAWHTLSTDQVLESEGVDGQRGLTSAE |
Ga0062389_1005741102 | 3300004092 | Bog Forest Soil | MTSEVTDTATPAGPPAAGEPAWHTLGADQVLHSEGVDGQR |
Ga0070683_1001662221 | 3300005329 | Corn Rhizosphere | MTSEVADTPRPGQPAAASELAWHTLGTDQVLRSEGVDGQRGLSSAEAA |
Ga0070691_107172531 | 3300005341 | Corn, Switchgrass And Miscanthus Rhizosphere | MASGATDTPRPGRPPPPDELAWHTLGTGQVLRSEGTDGRRGLSSAEAAAR |
Ga0070675_1007164183 | 3300005354 | Miscanthus Rhizosphere | MTSEVADTSRPGQPAAASELAWHTLGTDQVLRSEGVDGQRGLSSAEAA |
Ga0070714_1007085134 | 3300005435 | Agricultural Soil | MTSEVADTPRPGQPAAAGELAWHTLGADQVLRSEGVDGQRGLSSA |
Ga0070707_1001323014 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | MRETSGATATPGSGRPPATGEIAWHTLGADQVLHSEGVDGQRGLSSAEAAVRA |
Ga0070704_1003477733 | 3300005549 | Corn, Switchgrass And Miscanthus Rhizosphere | MTSEVADTPRPGQPAAASELAWHTLGTDQVLRSEGVDGQRGLSSAEAAT |
Ga0070762_104530451 | 3300005602 | Soil | MTSGVTDTPRSGGPPADGEPAWHTLGADQVLHSEGVDGQRGLSSAEA |
Ga0075029_1009083051 | 3300006052 | Watersheds | MTSEVTDTPRSGRPPAAGGIAWHTLSADQVLQSQRVDG |
Ga0075029_1010400951 | 3300006052 | Watersheds | MTSGVTDTPGSGRLPAAGELAWHTLGADQVLHSEG |
Ga0075015_1007115121 | 3300006102 | Watersheds | MTSGVTDTPAPGRPPADGGLAWHTLGADQVLHSEGVDGQ |
Ga0070716_1013163681 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | MTSGVADTPRSGRPPAAGELAWHTLGADQVLRSEGVDGQRGLSSAEAA |
Ga0070712_1009446621 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | MTSEAAAAPRPGQSSAASELAWHTLGADQVLRSERADGQRGLSSAEAAAR |
Ga0066665_101623921 | 3300006796 | Soil | MTSGVTDTPGSERPSAVGELAWHTFGADQVLHSEGVDEQRGLSSAEA |
Ga0075425_1021344722 | 3300006854 | Populus Rhizosphere | MTSGVADTPRSGQPPAAGELAWHTLSADQVLHSEGVDEQRGLSSAEAA |
Ga0075436_1001305554 | 3300006914 | Populus Rhizosphere | MTSGTTGTPGSGGPPADDRLAWHTLGTDQVLHSEGVDGQ |
Ga0126382_110334891 | 3300010047 | Tropical Forest Soil | MPPGVTDTPRSERPFAAGEVAWHTLSADQALRTEGVDAQRGLSSAEAA |
Ga0126373_106475103 | 3300010048 | Tropical Forest Soil | MTSGLADTPRSGAPPAAGEHAWHTLGADKVLRSEGVDGQQGLSSAEAA |
Ga0074045_100779441 | 3300010341 | Bog Forest Soil | MTSEATDIPRSGRPPAADGVAWHTLGTDQVLHSEGVDGQ |
Ga0126370_125515722 | 3300010358 | Tropical Forest Soil | MTSGLADTPRPGRPAVAGEPAWHTLGADQVLHSEGVDGQ |
Ga0134128_107387603 | 3300010373 | Terrestrial Soil | MTSEVADTPRPGQPAAASELAWHTLGTDQVLRSEGVDGQRGLSS |
Ga0126381_1001862781 | 3300010376 | Tropical Forest Soil | MMASGVTDTPRSVQPPAGVAWHTLGADQALHSEGVDEQRG |
Ga0136449_1034597011 | 3300010379 | Peatlands Soil | MTSGVTDTPTSGRPPAAGELAWHTLGADQVLQSEGVDG |
Ga0134126_109272342 | 3300010396 | Terrestrial Soil | MTSEAAAAPRPGQSPAASELAWHTLGADQVLRSEGADGQRGLSSA |
Ga0134126_123415762 | 3300010396 | Terrestrial Soil | MTSGVTDTTRSGGPPADGERAWHTLGADQVLHSEGVDGQRGLSSAE |
Ga0126383_130563842 | 3300010398 | Tropical Forest Soil | MTSGVTDTPRSGQPPAEVAWHTLDADQVLHSEGVDRQRGLSSAEVAA |
Ga0137399_102630041 | 3300012203 | Vadose Zone Soil | MTSGATGTPGSGGPPADGGPAWHTLGVDQVLHSEGVDGQRGLSSAE |
Ga0157321_10261691 | 3300012487 | Arabidopsis Rhizosphere | MTSEVADTPRPGQPAASELAWHTLGADQVLHSEGVDGQRGLSSAEA |
Ga0164303_100228041 | 3300012957 | Soil | MTSEVADTSRPGQPAAASELAWHTLGTDQVLRSEGV |
Ga0126369_124259022 | 3300012971 | Tropical Forest Soil | MTSGLADTPRPGRPPVAGEPAWHTLGADQVLHSEGVDGQRGLSSAEAA |
Ga0164309_110229292 | 3300012984 | Soil | MISEVTDTPRPGQPPAASELAWHTLDADQVLRSEGVDEQRGLS |
Ga0164307_101607601 | 3300012987 | Soil | MTSEVADTPRPGQPAAAGELAWHTLGADQVLRSEGVDGQR |
Ga0173480_110065102 | 3300015200 | Soil | MTSEVADTPRPGQPTAASELAWHTLGADQVLHSEGVDGQRGLSSAEAAA |
Ga0182036_105348982 | 3300016270 | Soil | MTSGVADTPRPDRPPPAGELAWHTLSADQVLHSEGVDAQRGLSSAEAA |
Ga0182032_113302552 | 3300016357 | Soil | MTSGVTDTPRSGRPPAAGELAWHTLSADQVLRSEGVDAQRGLSSAE |
Ga0182040_113272311 | 3300016387 | Soil | MTSGVTDTPTSGRPPAAGGELAWHTLSADQVLHSEGVDAQRGLSS |
Ga0182039_104451501 | 3300016422 | Soil | MTSGVTDTPRPDRPPPAGELAWHTLSADQVLHSEGVDAQRGLSSAEAAA |
Ga0187807_12788791 | 3300017926 | Freshwater Sediment | MEHHMTSGVTDTPTSGRPPADGELAWHTLGADQVL |
Ga0187809_101878311 | 3300017937 | Freshwater Sediment | MTTGVTGTPRSGGPPADDELAWHTLGADQVLRSEG |
Ga0187808_103807101 | 3300017942 | Freshwater Sediment | MTSGVTGTPRSGRPPADGELAWHTLGADQVLHSEGVDGQRGLSSAEAAAR |
Ga0187808_105404471 | 3300017942 | Freshwater Sediment | MTSGVTETPGPGRPPADGELTWHTLGADQVVQSEGVDGQRGL |
Ga0187779_109541661 | 3300017959 | Tropical Peatland | MTSGVTDTPTSGRPQAAGERAWHTLGTDQVLHLEGVDGQRGLSSAEAA |
Ga0187767_102287071 | 3300017999 | Tropical Peatland | MTSGVTDTPRSGGPPADGELPWHTLGVDQVLQSEGVDGQRGLSS |
Ga0187885_103906133 | 3300018025 | Peatland | MTSGVTDTPRSGGLPVDGELAWHTLGADQVLHSEGVDGQRGLS |
Ga0187851_102261274 | 3300018046 | Peatland | MTSGVTDTPASGGPPAVGELAWHTLGADQVLRSEGVDGQ |
Ga0206356_106894113 | 3300020070 | Corn, Switchgrass And Miscanthus Rhizosphere | MTSEVADTSRPGQPAAASELAWHTLGTDQVLRSEGVDGQRGLSSAEAAA |
Ga0206353_106898222 | 3300020082 | Corn, Switchgrass And Miscanthus Rhizosphere | MTSEVADTPRPGQPAAASELAWHTLGTDQVLRSEGVDGQRGLSSAEA |
Ga0210384_103292382 | 3300021432 | Soil | MTSGVTDTPRSGGPPADGERAWHTLGADQVLHSEGV |
Ga0210390_110907651 | 3300021474 | Soil | MTSGVTDTPRSGGPPAVGELAWHTLGADQVLHSERVDGQRG |
Ga0210392_111544811 | 3300021475 | Soil | MTSEVADTPRPGQPAAAGELAWHTLGADQVLRSEGVDGQRGLS |
Ga0210402_108016531 | 3300021478 | Soil | MTSGVIGTPRSGGPPADGELAWHTLGADQVLHSEGVDG |
Ga0210410_108060761 | 3300021479 | Soil | MTSGVTDTPRSGGPPADGERAWHTLGADQVLHSEGVDGQRGLSSAEASAR |
Ga0126371_117748782 | 3300021560 | Tropical Forest Soil | MTSGVADTPKSGQQPAHGEPAWQTLSADQVLHYEGVDEQHGLSSAEAAA |
Ga0126371_131448432 | 3300021560 | Tropical Forest Soil | MTSGVADTPKSGQAPAAAELAWHTLSADQVLHSEGVDEQHGL |
Ga0247664_10459603 | 3300024232 | Soil | MTSEVADTPRPGQPAAASELAWHTLGADQVLHSEGVDGQRGLSSAEAA |
Ga0207692_111888951 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | MTSAVTGTPGSGRPQAAGELAWHTLGVDQVLHSEGVDERRGLSSAEAA |
Ga0207647_107601812 | 3300025904 | Corn Rhizosphere | MTSEVADTPRPGQPAAASELAWHTLGTDQVLRSEGVDGQRGLSSA |
Ga0207693_107550502 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | MTSEAAAAPRPGQSSAASELAWHTLGADQVLRSERADGQRGLSSAEAAARAQ |
Ga0207663_100821883 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | MTSEVTDTPRPGQPPAASELAWHTLDADQVLRSEGVDE |
Ga0207660_109703402 | 3300025917 | Corn Rhizosphere | MTSGVADIPRSGGPPAAGELAWHTLGADQVLHSEGVDGQRGLSAAEAAA |
Ga0207664_106248383 | 3300025929 | Agricultural Soil | MTSEVADTPRPGQPAAAGELAWHTLGADQVLRSEGVDGQRGLSS |
Ga0207702_110304141 | 3300026078 | Corn Rhizosphere | MTSGVADTPRPGRAPAAGELAWHTLGAEQVLRSEGVDRQHGLSSAE |
Ga0207675_1013987962 | 3300026118 | Switchgrass Rhizosphere | MTSGVADIPRSGGPPAAGELAWHTLGADQVLHSEGVDGHRGLSAAEAAA |
Ga0209446_10691101 | 3300027698 | Bog Forest Soil | MTPGVTHTPRPGRPPAAGGLAWHTLGADQVLYSEGV |
Ga0207862_11635722 | 3300027703 | Tropical Forest Soil | MSSEVTDTPRPGRPPTVAEPVWHTLSSDQVLRSEGVDGQRGLSSAEVA |
Ga0207862_11962762 | 3300027703 | Tropical Forest Soil | MTSGVTDTPRSGGPPAAGELALHTLGADQVLHSEGVDGQRGLSSAE |
Ga0209415_106851241 | 3300027905 | Peatlands Soil | MTTGVTGTPRSGGPPADDELAWHTLGADQVLRSEGADGQSGLSSA |
Ga0247682_10408131 | 3300028146 | Soil | MTSEVADTPRPGQPAAASELAWHTLGADQVLHSEGV |
Ga0311353_107929092 | 3300030399 | Palsa | MTSGVMDTPASGRPPAAGELAWHTLGADQVLHSERV |
Ga0311372_117918741 | 3300030520 | Palsa | MTSGVTDTPRSGGLPVDGELAWHTLGADQVLHSEGVDG |
Ga0302325_128605501 | 3300031234 | Palsa | MTSGVTDTPRSGRPPAAGQLAWHTLGADQVLRSEGVDGQRGLSSAEAAA |
Ga0318541_106033232 | 3300031545 | Soil | MTSGVTGAPRSGSPPAAGELGWHTLDAGEVLRSEGVD |
Ga0318538_104565652 | 3300031546 | Soil | MPPGVMDTPRSGQPSAEAGLAWHTLGADQVLHSEGVDG |
Ga0318571_104469531 | 3300031549 | Soil | MTSGVTGTPRSGSPPAAGELAWHTLDAGEVLRSEGVDGQRGLS |
Ga0318515_103661961 | 3300031572 | Soil | MTSGVTDTPRSGGPPAGGELAWHTLGADQVLQSEGVDGQRGLSSAEAALPI |
Ga0318515_103941541 | 3300031572 | Soil | MTSGVTDTPTSGRPPAAGELAWHTLSADQVLRSEGVDAQQGLSSAE |
Ga0318574_101081893 | 3300031680 | Soil | MTSEVAQTPRSGPPPAPGNLAWHTLGADQVLRTEGVDRQHGLS |
Ga0318572_101405613 | 3300031681 | Soil | MTSGVTDTPTSGRPPAAGELAWHTLSADQVLRSEGVD |
Ga0318572_109396642 | 3300031681 | Soil | MTSEVTDTPRSGPSPAQAAWHTLGADQVLQSEGVDRQ |
Ga0318493_102162931 | 3300031723 | Soil | MTSGVTDTPRPDRPPPAGELAWHTLSADQVLHSEGADAQRGLSSAEAA |
Ga0318493_104501112 | 3300031723 | Soil | MTSGVADTPKSGQAPAAAELAWHTLSADQVLHSEGVE |
Ga0318500_104317852 | 3300031724 | Soil | MTSEVTDTPRSGPSPAQAAWHTLGADQVLQSEGVDRQRGLSSAEAAAPS |
Ga0318502_103066471 | 3300031747 | Soil | MTSGVTDTPRSGGPPAAGELAWHTLGADQVLHSEGVDGQRGLS |
Ga0318502_103645512 | 3300031747 | Soil | MTSGVTDTPRPDRPPPAGELAWHTLSADQVLHSEGVDAQRGLRSA |
Ga0318502_110344991 | 3300031747 | Soil | MTSGVADTPKSGQAPVAAELAWHTLGADQVLHSEGVDEQRG |
Ga0318537_103017471 | 3300031763 | Soil | MTSGVADTPKSGQAPAAGELAWHTLSADQVLHSEGVDEQHGLSSAEA |
Ga0318535_101196063 | 3300031764 | Soil | MTSGVTDTPTSGRPSAAGELAWHTLSADQVLRSEGVDAQHGLSSA |
Ga0318535_105436232 | 3300031764 | Soil | MTSGVTDTPTSGRPPAAGELAWHTLSADQVLRSEGVDAQHGLSSAE |
Ga0318554_102955471 | 3300031765 | Soil | MTSGVTDTPRPDRPPPAGELAWHTLSADQVLHSEGVDAQRGLS |
Ga0318554_103821442 | 3300031765 | Soil | MTSGVADTPKSGQAPAAAELAWHTLSADQVLHSEGVDEQRGLSSAEAAA |
Ga0318554_105695482 | 3300031765 | Soil | MTSGVTGTPRSGSPPAAGELAWHTLDAGEVLRSEGVDGQRGLSSAE |
Ga0318552_104534722 | 3300031782 | Soil | MTSGVTGAPRSGSPPAAGELGWHTLDAGEVLRSEG |
Ga0318548_102845542 | 3300031793 | Soil | MTSGVTDTPTSGRPPAAGELAWHTLSADQVLRSEGVDAQHGLSSAEA |
Ga0318568_100991493 | 3300031819 | Soil | MTSGVTDTPRPDRPPPAGELAWHTLSADQVLHSEGVDAQRGLSSAEAAALR |
Ga0318567_107386352 | 3300031821 | Soil | MTSGVADTPRSGRPPAAGELAWHTLGADQVLRSEGVDGQSGLSSAEAAVPI |
Ga0307478_102029501 | 3300031823 | Hardwood Forest Soil | VTSGVTVKPGSGGPPADGGLAWHTLGADQVLHSEGVDAQRGLSSAEA |
Ga0318511_105919601 | 3300031845 | Soil | MTSGVTDTPRSGGPPATGQPAWHTLGTDQVLHSEGVDGQHGLSSAEAA |
Ga0318527_101955221 | 3300031859 | Soil | MTSGVTGTPGSGRPPADGELAWHTLGADQVLRSEGVDGRR |
Ga0306919_106331202 | 3300031879 | Soil | MTSGVADTPKSGQAPAAGGLAWHTLGADQVLHSEGVDGQRGLS |
Ga0306925_104959581 | 3300031890 | Soil | MTSGVTDTPRSGRPPAAGELAWHTLSADQVLHSEGVDAQRGLSSAETAAR |
Ga0318536_103337441 | 3300031893 | Soil | MTSGVADTPKSGQAPAAGELAWHTLSADQVLHSEGVDEQHGL |
Ga0318520_107973532 | 3300031897 | Soil | MTSGVTDTPRSGGPSAAGELAWHTLGADQVLQTEGVD |
Ga0306923_121331401 | 3300031910 | Soil | MTSGVTDTPTSGPPSAPGQTAWHTLSADQVLHSEEVDAQR |
Ga0310909_115949191 | 3300031947 | Soil | MTSGVTDTPRSGRPPAAGELAWHTLSADQVLHSEGVDAQRGLSS |
Ga0306926_1000770112 | 3300031954 | Soil | MTSGVTDTPRPDRPPPAGELAWHTLSADQVLHSEGADAQRGLSSAE |
Ga0318562_100689953 | 3300032008 | Soil | MTSGVTDTPRPDRPPPAGELAWHTLSADQVLHSEGVDAQRGLSAARAAPR |
Ga0318562_108747941 | 3300032008 | Soil | MTSGVTGAPRSGSPPAAGELGWHTLDAGEVLRSEGVDG |
Ga0318563_102603101 | 3300032009 | Soil | MTSEVAQTPRSGPPPAPGNLAWHTLGADQVLRTEGVDGQ |
Ga0318563_106422591 | 3300032009 | Soil | MTSGVADTPRSGQPPAAGELAWHTLSADQVLHSEGVDEQHGL |
Ga0318506_103572731 | 3300032052 | Soil | MTSGVTDTPRSGKLPTAGELAWHTLSADRVLHSERANC |
Ga0318533_113118132 | 3300032059 | Soil | MTSGVADTPKSGQAPAAGGLAWHTLGADQVLHSEG |
Ga0318513_101291343 | 3300032065 | Soil | MTSEVAQTPRSGPPPAPGNLAWHTLGADQVLRTEG |
Ga0318514_102585952 | 3300032066 | Soil | MTSEVEQTPRSGPPPAPGDLAWHTLGVDQVLRTEGVDGQRGLSSA |
Ga0318514_106056992 | 3300032066 | Soil | MTSGVADTPKSGQAPAAAELAWHTLSADQVLHSEGVEE |
Ga0318514_106414281 | 3300032066 | Soil | MTSGVTGTPRSGSPPAAGKLAWHTLDAGEVLRSEGVD |
Ga0318553_102287581 | 3300032068 | Soil | MTSGVTDTPTSGRPPAAGELAWHTLSADQVLRSEGVDAQHGLSS |
Ga0318577_101282361 | 3300032091 | Soil | MTSGVTDTPRPDRPPPAGELAWHTLSADQVLHSEGADAQRGLSSAEAAA |
Ga0318577_103639922 | 3300032091 | Soil | MTSGVTDTPRSGRPPAAGELAWHTLSADQVLRSEGVDAQRGLSSAEAA |
Ga0307470_105674172 | 3300032174 | Hardwood Forest Soil | MTSGATGTPGSGGPPADGGPAWHTLGADQVLHSDGVDGQRGLSSAEAAA |
Ga0306920_1004452781 | 3300032261 | Soil | MTSGVTDTPRSGGPSAAGELAWHTLGADQVLQTEGV |
Ga0335085_102717141 | 3300032770 | Soil | MTTGTTDTSRPGRPPTAGELAWHTLSADQVLHSEGVDEQRGLSSA |
Ga0335085_104060011 | 3300032770 | Soil | MTSEVTDTPSPGPPPAAAGLAWHTLSADQVLRSEGVDAQRGLST |
Ga0335085_111274721 | 3300032770 | Soil | MTSEVTDTPRPERPSAAAEPAWHTLSGDQVLHSEGVDGQR |
Ga0335082_107848551 | 3300032782 | Soil | MTSEVTDTPRPERPPAAAEPAWHTLSGDQVLHSEG |
Ga0335082_111057892 | 3300032782 | Soil | MTSGVAGPPISGGTPAVSELAWHTLGADQVLRSQGVDG |
Ga0335080_124193832 | 3300032828 | Soil | MTSGVAGPPISGGPPAVSELAWHTLGADQVLRSQGV |
Ga0335076_117050021 | 3300032955 | Soil | MTSGVADTPKSGQPPAAGEHAWHTLGADQVLHSEGVDGQRGLSSAEAAAR |
Ga0335073_1000660518 | 3300033134 | Soil | MTSGVSDTPRSGQPAADGAPAWHTLGADQVLRSEGVDGQRGLSSA |
Ga0335073_109824932 | 3300033134 | Soil | MTSGVAETPKSGQPPAAAELAWHTLGADQVLHSEGVDEQ |
⦗Top⦘ |