Basic Information | |
---|---|
Family ID | F061160 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 132 |
Average Sequence Length | 46 residues |
Representative Sequence | MAGVLDRIVAATRARVAEARRGADLRELERRAERHVPRGFRRA |
Number of Associated Samples | 119 |
Number of Associated Scaffolds | 132 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 30.30 % |
% of genes near scaffold ends (potentially truncated) | 100.00 % |
% of genes from short scaffolds (< 2000 bps) | 90.15 % |
Associated GOLD sequencing projects | 115 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.44 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (84.848 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (7.576 % of family members) |
Environment Ontology (ENVO) | Unclassified (18.182 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (45.455 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 43.66% β-sheet: 0.00% Coil/Unstructured: 56.34% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.44 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 132 Family Scaffolds |
---|---|---|
PF01979 | Amidohydro_1 | 12.88 |
PF01263 | Aldose_epim | 11.36 |
PF01522 | Polysacc_deac_1 | 6.82 |
PF02517 | Rce1-like | 6.82 |
PF02566 | OsmC | 2.27 |
PF13561 | adh_short_C2 | 1.52 |
PF01980 | TrmO | 1.52 |
PF13840 | ACT_7 | 1.52 |
PF12708 | Pectate_lyase_3 | 0.76 |
PF12850 | Metallophos_2 | 0.76 |
PF12704 | MacB_PCD | 0.76 |
PF02738 | MoCoBD_1 | 0.76 |
PF00834 | Ribul_P_3_epim | 0.76 |
PF10012 | DUF2255 | 0.76 |
PF13229 | Beta_helix | 0.76 |
PF10091 | Glycoamylase | 0.76 |
PF00144 | Beta-lactamase | 0.76 |
PF01288 | HPPK | 0.76 |
PF00005 | ABC_tran | 0.76 |
PF01156 | IU_nuc_hydro | 0.76 |
PF13847 | Methyltransf_31 | 0.76 |
PF13432 | TPR_16 | 0.76 |
PF00149 | Metallophos | 0.76 |
COG ID | Name | Functional Category | % Frequency in 132 Family Scaffolds |
---|---|---|---|
COG0676 | D-hexose-6-phosphate mutarotase | Carbohydrate transport and metabolism [G] | 11.36 |
COG2017 | Galactose mutarotase or related enzyme | Carbohydrate transport and metabolism [G] | 11.36 |
COG0726 | Peptidoglycan/xylan/chitin deacetylase, PgdA/NodB/CDA1 family | Cell wall/membrane/envelope biogenesis [M] | 6.82 |
COG1266 | Membrane protease YdiL, CAAX protease family | Posttranslational modification, protein turnover, chaperones [O] | 6.82 |
COG4449 | Predicted protease, Abi (CAAX) family | General function prediction only [R] | 6.82 |
COG1764 | Organic hydroperoxide reductase OsmC/OhrA | Defense mechanisms [V] | 2.27 |
COG1765 | Uncharacterized OsmC-related protein | General function prediction only [R] | 2.27 |
COG1720 | tRNA (Thr-GGU) A37 N6-methylase | Translation, ribosomal structure and biogenesis [J] | 1.52 |
COG0036 | Pentose-5-phosphate-3-epimerase | Carbohydrate transport and metabolism [G] | 0.76 |
COG0801 | 7,8-dihydro-6-hydroxymethylpterin pyrophosphokinase (folate biosynthesis) | Coenzyme transport and metabolism [H] | 0.76 |
COG1680 | CubicO group peptidase, beta-lactamase class C family | Defense mechanisms [V] | 0.76 |
COG1686 | D-alanyl-D-alanine carboxypeptidase | Cell wall/membrane/envelope biogenesis [M] | 0.76 |
COG1957 | Inosine-uridine nucleoside N-ribohydrolase | Nucleotide transport and metabolism [F] | 0.76 |
COG2367 | Beta-lactamase class A | Defense mechanisms [V] | 0.76 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 84.85 % |
Unclassified | root | N/A | 15.15 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300000567|JGI12270J11330_10059253 | All Organisms → cellular organisms → Bacteria | 1987 | Open in IMG/M |
3300001593|JGI12635J15846_10810992 | All Organisms → cellular organisms → Bacteria | 536 | Open in IMG/M |
3300002245|JGIcombinedJ26739_101088428 | All Organisms → cellular organisms → Bacteria | 686 | Open in IMG/M |
3300002911|JGI25390J43892_10111410 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium KBS 89 | 619 | Open in IMG/M |
3300005181|Ga0066678_10981715 | All Organisms → cellular organisms → Bacteria | 548 | Open in IMG/M |
3300005332|Ga0066388_100683013 | All Organisms → cellular organisms → Bacteria | 1636 | Open in IMG/M |
3300005332|Ga0066388_107843365 | All Organisms → cellular organisms → Bacteria | 534 | Open in IMG/M |
3300005347|Ga0070668_101632225 | Not Available | 591 | Open in IMG/M |
3300005435|Ga0070714_100860104 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 880 | Open in IMG/M |
3300005439|Ga0070711_100442347 | All Organisms → cellular organisms → Bacteria | 1063 | Open in IMG/M |
3300005445|Ga0070708_101658125 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 595 | Open in IMG/M |
3300005471|Ga0070698_100512923 | All Organisms → cellular organisms → Bacteria | 1137 | Open in IMG/M |
3300005529|Ga0070741_11684252 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 517 | Open in IMG/M |
3300005534|Ga0070735_10618756 | All Organisms → cellular organisms → Bacteria | 642 | Open in IMG/M |
3300005542|Ga0070732_10604883 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 666 | Open in IMG/M |
3300005561|Ga0066699_10932280 | All Organisms → cellular organisms → Bacteria | 604 | Open in IMG/M |
3300005564|Ga0070664_101945672 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 558 | Open in IMG/M |
3300005577|Ga0068857_100910495 | All Organisms → cellular organisms → Bacteria | 844 | Open in IMG/M |
3300005610|Ga0070763_10971732 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella → Granulicella tundricola | 508 | Open in IMG/M |
3300005764|Ga0066903_102155362 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1074 | Open in IMG/M |
3300005764|Ga0066903_109012242 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella → Granulicella tundricola | 505 | Open in IMG/M |
3300005889|Ga0075290_1007596 | All Organisms → cellular organisms → Bacteria | 1210 | Open in IMG/M |
3300006028|Ga0070717_10038048 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3909 | Open in IMG/M |
3300006052|Ga0075029_100062712 | All Organisms → cellular organisms → Bacteria | 2172 | Open in IMG/M |
3300006059|Ga0075017_100256821 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1279 | Open in IMG/M |
3300006102|Ga0075015_100708044 | All Organisms → cellular organisms → Bacteria | 598 | Open in IMG/M |
3300006102|Ga0075015_100862238 | All Organisms → cellular organisms → Bacteria | 547 | Open in IMG/M |
3300006162|Ga0075030_100548040 | All Organisms → cellular organisms → Bacteria | 919 | Open in IMG/M |
3300006162|Ga0075030_101063275 | All Organisms → cellular organisms → Bacteria | 637 | Open in IMG/M |
3300006174|Ga0075014_100136723 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1183 | Open in IMG/M |
3300006755|Ga0079222_12441441 | Not Available | 524 | Open in IMG/M |
3300006796|Ga0066665_10103903 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2089 | Open in IMG/M |
3300006804|Ga0079221_10836586 | All Organisms → cellular organisms → Bacteria | 665 | Open in IMG/M |
3300006871|Ga0075434_102233293 | All Organisms → cellular organisms → Bacteria | 551 | Open in IMG/M |
3300006954|Ga0079219_11292058 | All Organisms → cellular organisms → Bacteria | 641 | Open in IMG/M |
3300009029|Ga0066793_10450116 | All Organisms → cellular organisms → Bacteria | 738 | Open in IMG/M |
3300009545|Ga0105237_10929409 | All Organisms → cellular organisms → Bacteria | 877 | Open in IMG/M |
3300010048|Ga0126373_10258085 | All Organisms → cellular organisms → Bacteria | 1719 | Open in IMG/M |
3300010048|Ga0126373_11560693 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 725 | Open in IMG/M |
3300010326|Ga0134065_10005121 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3305 | Open in IMG/M |
3300010361|Ga0126378_10557909 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1260 | Open in IMG/M |
3300010366|Ga0126379_13816343 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 505 | Open in IMG/M |
3300010373|Ga0134128_12773414 | Not Available | 540 | Open in IMG/M |
3300010397|Ga0134124_10544951 | Not Available | 1128 | Open in IMG/M |
3300010398|Ga0126383_10090505 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 2702 | Open in IMG/M |
3300011271|Ga0137393_11731677 | All Organisms → cellular organisms → Bacteria | 514 | Open in IMG/M |
3300012189|Ga0137388_11169953 | Not Available | 706 | Open in IMG/M |
3300012210|Ga0137378_10055816 | All Organisms → cellular organisms → Bacteria | 3562 | Open in IMG/M |
3300012285|Ga0137370_10953017 | All Organisms → cellular organisms → Bacteria | 530 | Open in IMG/M |
3300012357|Ga0137384_11067173 | All Organisms → cellular organisms → Bacteria | 648 | Open in IMG/M |
3300012363|Ga0137390_11985939 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 508 | Open in IMG/M |
3300012957|Ga0164303_11255233 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 545 | Open in IMG/M |
3300012971|Ga0126369_13362079 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 524 | Open in IMG/M |
3300013105|Ga0157369_12448623 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 529 | Open in IMG/M |
3300014169|Ga0181531_10639732 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2 | 660 | Open in IMG/M |
3300014200|Ga0181526_10320315 | All Organisms → cellular organisms → Bacteria | 987 | Open in IMG/M |
3300014200|Ga0181526_10761497 | All Organisms → cellular organisms → Bacteria | 610 | Open in IMG/M |
3300014200|Ga0181526_10949936 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 540 | Open in IMG/M |
3300014501|Ga0182024_11645109 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 726 | Open in IMG/M |
3300015264|Ga0137403_11511696 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 522 | Open in IMG/M |
3300015374|Ga0132255_100821771 | All Organisms → cellular organisms → Bacteria | 1386 | Open in IMG/M |
3300017823|Ga0187818_10261872 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 757 | Open in IMG/M |
3300017937|Ga0187809_10129503 | All Organisms → cellular organisms → Bacteria | 862 | Open in IMG/M |
3300017937|Ga0187809_10287824 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 603 | Open in IMG/M |
3300017955|Ga0187817_10140354 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1534 | Open in IMG/M |
3300017973|Ga0187780_10366355 | All Organisms → cellular organisms → Bacteria | 1019 | Open in IMG/M |
3300017974|Ga0187777_11297390 | Not Available | 535 | Open in IMG/M |
3300018001|Ga0187815_10334233 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 643 | Open in IMG/M |
3300018035|Ga0187875_10348989 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 795 | Open in IMG/M |
3300018037|Ga0187883_10603450 | Not Available | 570 | Open in IMG/M |
3300018040|Ga0187862_10876976 | All Organisms → cellular organisms → Bacteria | 515 | Open in IMG/M |
3300018044|Ga0187890_10204272 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Paraburkholderia → Paraburkholderia rhynchosiae | 1119 | Open in IMG/M |
3300018044|Ga0187890_10259248 | All Organisms → cellular organisms → Bacteria | 978 | Open in IMG/M |
3300018047|Ga0187859_10857639 | Not Available | 523 | Open in IMG/M |
3300018057|Ga0187858_10457347 | All Organisms → cellular organisms → Bacteria | 786 | Open in IMG/M |
3300018062|Ga0187784_11404950 | All Organisms → cellular organisms → Bacteria | 553 | Open in IMG/M |
3300018085|Ga0187772_11495477 | All Organisms → cellular organisms → Bacteria | 502 | Open in IMG/M |
3300018090|Ga0187770_10703828 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 806 | Open in IMG/M |
3300020150|Ga0187768_1093632 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 683 | Open in IMG/M |
3300020581|Ga0210399_11327986 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 565 | Open in IMG/M |
3300020582|Ga0210395_10423739 | All Organisms → cellular organisms → Bacteria | 1001 | Open in IMG/M |
3300021171|Ga0210405_10242452 | Not Available | 1427 | Open in IMG/M |
3300021171|Ga0210405_10781029 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 733 | Open in IMG/M |
3300021171|Ga0210405_11252715 | All Organisms → cellular organisms → Bacteria | 547 | Open in IMG/M |
3300021178|Ga0210408_10579607 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2 | 889 | Open in IMG/M |
3300021180|Ga0210396_11033399 | Not Available | 695 | Open in IMG/M |
3300021402|Ga0210385_10328513 | All Organisms → cellular organisms → Bacteria | 1138 | Open in IMG/M |
3300021405|Ga0210387_11644648 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 545 | Open in IMG/M |
3300021420|Ga0210394_10981711 | Not Available | 732 | Open in IMG/M |
3300021560|Ga0126371_10813298 | All Organisms → cellular organisms → Bacteria | 1080 | Open in IMG/M |
3300022731|Ga0224563_1020803 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2 | 580 | Open in IMG/M |
3300025612|Ga0208691_1070384 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 790 | Open in IMG/M |
3300025898|Ga0207692_11039804 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 541 | Open in IMG/M |
3300025911|Ga0207654_10038799 | All Organisms → cellular organisms → Bacteria | 2675 | Open in IMG/M |
3300025917|Ga0207660_11153617 | Not Available | 631 | Open in IMG/M |
3300025928|Ga0207700_10132266 | All Organisms → cellular organisms → Bacteria | 2039 | Open in IMG/M |
3300025928|Ga0207700_10358415 | All Organisms → cellular organisms → Bacteria | 1271 | Open in IMG/M |
3300025929|Ga0207664_11625751 | All Organisms → cellular organisms → Bacteria | 568 | Open in IMG/M |
3300025949|Ga0207667_11473463 | Not Available | 652 | Open in IMG/M |
3300025949|Ga0207667_11938610 | Not Available | 550 | Open in IMG/M |
3300025972|Ga0207668_11943471 | Not Available | 530 | Open in IMG/M |
3300026003|Ga0208284_1006465 | All Organisms → cellular organisms → Bacteria | 909 | Open in IMG/M |
3300026116|Ga0207674_10221505 | All Organisms → cellular organisms → Bacteria | 1840 | Open in IMG/M |
3300026308|Ga0209265_1146825 | All Organisms → cellular organisms → Bacteria | 604 | Open in IMG/M |
3300026315|Ga0209686_1184953 | Not Available | 575 | Open in IMG/M |
3300026332|Ga0209803_1288259 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2 | 563 | Open in IMG/M |
3300026552|Ga0209577_10883962 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 501 | Open in IMG/M |
3300027297|Ga0208241_1010447 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 1299 | Open in IMG/M |
3300027568|Ga0208042_1094404 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 757 | Open in IMG/M |
3300027867|Ga0209167_10021375 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3080 | Open in IMG/M |
3300029951|Ga0311371_10320476 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2169 | Open in IMG/M |
3300030002|Ga0311350_10569256 | All Organisms → cellular organisms → Bacteria | 1018 | Open in IMG/M |
3300030606|Ga0299906_11116770 | Not Available | 571 | Open in IMG/M |
3300030659|Ga0316363_10028903 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2863 | Open in IMG/M |
3300030879|Ga0265765_1050268 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2 | 571 | Open in IMG/M |
3300031090|Ga0265760_10017606 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2052 | Open in IMG/M |
3300031128|Ga0170823_10184155 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2 | 537 | Open in IMG/M |
3300031234|Ga0302325_11874280 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 747 | Open in IMG/M |
3300031344|Ga0265316_10335016 | All Organisms → cellular organisms → Bacteria | 1097 | Open in IMG/M |
3300031446|Ga0170820_11150771 | All Organisms → cellular organisms → Bacteria | 819 | Open in IMG/M |
3300031708|Ga0310686_107355709 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 536 | Open in IMG/M |
3300031718|Ga0307474_10530470 | Not Available | 925 | Open in IMG/M |
3300031719|Ga0306917_10382234 | All Organisms → cellular organisms → Bacteria | 1098 | Open in IMG/M |
3300031823|Ga0307478_11511184 | All Organisms → cellular organisms → Bacteria | 556 | Open in IMG/M |
3300032173|Ga0315268_11699513 | All Organisms → cellular organisms → Bacteria | 644 | Open in IMG/M |
3300032722|Ga0316231_1262913 | Not Available | 701 | Open in IMG/M |
3300032805|Ga0335078_12159167 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 589 | Open in IMG/M |
3300032829|Ga0335070_11037445 | All Organisms → cellular organisms → Bacteria | 756 | Open in IMG/M |
3300032892|Ga0335081_11399398 | All Organisms → cellular organisms → Bacteria | 782 | Open in IMG/M |
3300032893|Ga0335069_10407315 | All Organisms → cellular organisms → Bacteria | 1594 | Open in IMG/M |
3300033134|Ga0335073_10508973 | Not Available | 1372 | Open in IMG/M |
3300033888|Ga0334792_011064 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 3561 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 7.58% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 5.30% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 5.30% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 5.30% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 5.30% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 5.30% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 4.55% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 4.55% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 4.55% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 3.79% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 3.79% |
Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 3.03% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 3.03% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 3.03% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 3.03% |
Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 2.27% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 2.27% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 2.27% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.52% |
Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.52% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.52% |
Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 1.52% |
Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 1.52% |
Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 1.52% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.52% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.52% |
Freshwater | Environmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater | 0.76% |
Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 0.76% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 0.76% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.76% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.76% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.76% |
Prmafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil | 0.76% |
Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 0.76% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.76% |
Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 0.76% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.76% |
Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 0.76% |
Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 0.76% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.76% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.76% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.76% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.76% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.76% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300000567 | Peat soil microbial communities from Weissenstadt, Germany - SII-2010 | Environmental | Open in IMG/M |
3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
3300002911 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cm | Environmental | Open in IMG/M |
3300005181 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 | Environmental | Open in IMG/M |
3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Host-Associated | Open in IMG/M |
3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
3300005529 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1 | Environmental | Open in IMG/M |
3300005534 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 | Environmental | Open in IMG/M |
3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
3300005561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 | Environmental | Open in IMG/M |
3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Host-Associated | Open in IMG/M |
3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Host-Associated | Open in IMG/M |
3300005610 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 | Environmental | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300005889 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_80N_201 | Environmental | Open in IMG/M |
3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
3300006102 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013 | Environmental | Open in IMG/M |
3300006162 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 | Environmental | Open in IMG/M |
3300006174 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014 | Environmental | Open in IMG/M |
3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
3300009029 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 1 DNA2013-189 | Environmental | Open in IMG/M |
3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
3300010326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Host-Associated | Open in IMG/M |
3300014169 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_10_metaG | Environmental | Open in IMG/M |
3300014200 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_30_metaG | Environmental | Open in IMG/M |
3300014501 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
3300017823 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_3 | Environmental | Open in IMG/M |
3300017937 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_4 | Environmental | Open in IMG/M |
3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
3300017973 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MG | Environmental | Open in IMG/M |
3300017974 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MG | Environmental | Open in IMG/M |
3300018001 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_5 | Environmental | Open in IMG/M |
3300018035 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_10 | Environmental | Open in IMG/M |
3300018037 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_10 | Environmental | Open in IMG/M |
3300018040 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_150 | Environmental | Open in IMG/M |
3300018044 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_21_10 | Environmental | Open in IMG/M |
3300018047 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_10 | Environmental | Open in IMG/M |
3300018057 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_150 | Environmental | Open in IMG/M |
3300018062 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
3300018090 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
3300020150 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP10_20_MG | Environmental | Open in IMG/M |
3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
3300021402 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O | Environmental | Open in IMG/M |
3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
3300022731 | Soil microbial communities from Bohemian Forest, Czech Republic ? CSU4 | Environmental | Open in IMG/M |
3300025612 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_10 (SPAdes) | Environmental | Open in IMG/M |
3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) | Environmental | Open in IMG/M |
3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026003 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_80N_201 (SPAdes) | Environmental | Open in IMG/M |
3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026308 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103 (SPAdes) | Environmental | Open in IMG/M |
3300026315 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 (SPAdes) | Environmental | Open in IMG/M |
3300026332 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 (SPAdes) | Environmental | Open in IMG/M |
3300026552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes) | Environmental | Open in IMG/M |
3300027297 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF047 (SPAdes) | Environmental | Open in IMG/M |
3300027568 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_7_NC metaG (SPAdes) | Environmental | Open in IMG/M |
3300027867 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300029951 | III_Palsa_N1 coassembly | Environmental | Open in IMG/M |
3300030002 | II_Fen_N1 coassembly | Environmental | Open in IMG/M |
3300030606 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT145D125 | Environmental | Open in IMG/M |
3300030659 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG (v2) | Environmental | Open in IMG/M |
3300030879 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031128 | Oak Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031234 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2 | Environmental | Open in IMG/M |
3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Host-Associated | Open in IMG/M |
3300031446 | Fir Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
3300032173 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C1_top | Environmental | Open in IMG/M |
3300032722 | Freshwater microbial communities from Trout Bog Lake, Wisconsin, USA - TBH18027 | Environmental | Open in IMG/M |
3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
3300032829 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3 | Environmental | Open in IMG/M |
3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
3300032893 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1 | Environmental | Open in IMG/M |
3300033134 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2 | Environmental | Open in IMG/M |
3300033888 | Peat soil microbial communities from Stordalen Mire, Sweden - 713 P-3-X1 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
JGI12270J11330_100592533 | 3300000567 | Peatlands Soil | MPAFLEQIVAAARRRVAEAKRRADRGELDRQAERHVPRGFRRV |
JGI12635J15846_108109922 | 3300001593 | Forest Soil | MAAILERIIAATRARVEEARRVADLRELERRAERHVPRGFRR |
JGIcombinedJ26739_1010884282 | 3300002245 | Forest Soil | MAAILERIIAATRARVMKSRRHADLRELERRAERHVPRGF |
JGI25390J43892_101114101 | 3300002911 | Grasslands Soil | MPSSLDQIVAATRRRIAQCRARADFRLLERQAQNHAPRGFRQILEE |
Ga0066678_109817152 | 3300005181 | Soil | MPTSLDHIVAATRRRLAETRLAADLRELERRAAEHVPRGFRRALEEKSRESV |
Ga0066388_1006830131 | 3300005332 | Tropical Forest Soil | MAAILERIVAATRARVAQSRAVADFSQMERRAESHVPRGFQAALAAKSREGIAVIAE |
Ga0066388_1078433652 | 3300005332 | Tropical Forest Soil | MASKLEEIIAAARVRVAESKSAADLRDLELRAAAHQPRGFRDRL |
Ga0070668_1016322252 | 3300005347 | Switchgrass Rhizosphere | MPARLDQIVAATRRRVADAKRSSDLRQLEREAEQHVPRGFR |
Ga0070714_1008601042 | 3300005435 | Agricultural Soil | MAAFLDEIVAATRRRVARTKSAADLRALEKQAERHVPRGFRRALAARSQDGIA |
Ga0070711_1004423471 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | MAASLDQIVATTRRRVADTKRSADLRQLEQRAEQHVPRGFRRALAAKSRTGPA |
Ga0070708_1016581251 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MAASLDQIVAATRRRVADGKSSTDLRQLEREAGQHVPRGFRRALASQTGPAIIAE |
Ga0070698_1005129233 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | MAAILERIIAATRARVTGARRGADLRELERRAELHVPRGFRRAL |
Ga0070741_116842521 | 3300005529 | Surface Soil | MAAVLDRIVAATRARVERSKQTADFRALERQAEGHSPRGFRRSLQVRSRDGIAVI |
Ga0070735_106187561 | 3300005534 | Surface Soil | MAASLDQIVAATRRRVAEAKRSADLPRLERTAEQHVPRGFRRALATESQRGPAVI |
Ga0070732_106048832 | 3300005542 | Surface Soil | MPASLDEIVAATRRRVAEIKPATDLRQLERQAGNHVPRGFRRSLE |
Ga0066699_109322801 | 3300005561 | Soil | MPTSLDQIVAATRRRLAEIRPTADLRELERRAAEHVPRGFRRALEE |
Ga0070664_1019456722 | 3300005564 | Corn Rhizosphere | MAAFLDEIVAATRRRVARSKSAADLRALERQAATHVPRGFRRAL |
Ga0068857_1009104951 | 3300005577 | Corn Rhizosphere | MAASLDQIVAATRRRVADGKSSTDLRQLERAAGQHVPRGFRRALASQTGPA |
Ga0070763_109717321 | 3300005610 | Soil | MAAVLDRIVAATRARVETSRRGADLRALERRAEQHVPRG |
Ga0066903_1021553622 | 3300005764 | Tropical Forest Soil | MAAVLDKIVAASRARVAESKRTADLRDLQERAAKHIPRGFR |
Ga0066903_1090122421 | 3300005764 | Tropical Forest Soil | MAAVLDKIVAATRVRVAESKRTADLRALQERAARHIPRGFRRA |
Ga0075290_10075961 | 3300005889 | Rice Paddy Soil | MAAFLDEIVAATRRRLAHNKNAADLRALEREAARHVPRGFRRALAA |
Ga0070717_100380481 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MAAFLDEIVTATRRRVARSKSAADLRALERQAATHVPRGFRRALAA |
Ga0075029_1000627123 | 3300006052 | Watersheds | MAAVLDRIVAATRAQVAESRRTADLRELERLAEQHVPRGFRKTL |
Ga0075017_1002568211 | 3300006059 | Watersheds | MAAVLDRIVAATRVRVAESTRTADLRELERAAEAHVPRGFRRALE |
Ga0075015_1007080442 | 3300006102 | Watersheds | MAGVLDRIVAATRARVAEARRGADLRELERRAERHVPRGFRRA |
Ga0075015_1008622382 | 3300006102 | Watersheds | MVATLDQIVAATRGRVADAKRSADLRQMERRAEEHAPRGFRRALAAKNQTGIAV |
Ga0075030_1005480401 | 3300006162 | Watersheds | MPAVLDKILAATRARVADARRGVDLRELERRAEEHVPRGFRRALIAKAR |
Ga0075030_1010632751 | 3300006162 | Watersheds | MSAVLDRILAGTRARVAEAKRGADLLELERRAEKHVPRGF |
Ga0075014_1001367232 | 3300006174 | Watersheds | MAAVLDRIVAATRAQVAESRRTADLRELERLAEQHVPRG |
Ga0079222_124414411 | 3300006755 | Agricultural Soil | MAASLDQIVAATRRRVADGKSSTDLRQLERAAGQHVPRGFRR |
Ga0066665_101039036 | 3300006796 | Soil | MPAFLDEIVARTRVRVAAAKPAADLHELERRAARH |
Ga0079221_108365862 | 3300006804 | Agricultural Soil | MVASLDQIVAATRRRVADAKRSADLRQLERQAQEHSPRGFR |
Ga0075434_1022332932 | 3300006871 | Populus Rhizosphere | MLARLEQVIAATRRRVADAKRSADLRELERQAQDHVPRGFRRAL |
Ga0079219_112920582 | 3300006954 | Agricultural Soil | MASKLDQIIAATRVRVAETKQRVALSELERDAEKHVPRGFRRA |
Ga0066793_104501161 | 3300009029 | Prmafrost Soil | MAAILERIVAATRVRVAETKRGADSRELERRAESHVPRGFRRALQARSRE |
Ga0105237_109294091 | 3300009545 | Corn Rhizosphere | MAVFLDEIVAATRRRVARSKSAADLRGLERQAEKHVPRGFRRALATRSRDGI |
Ga0126373_102580852 | 3300010048 | Tropical Forest Soil | MAAVLDTIIAATRVRVAESKRIANLRELERRAEQHVPRGFRR |
Ga0126373_115606932 | 3300010048 | Tropical Forest Soil | MVAVLDQIVTATRARVVVSRRAADLHGLERQAERHVPRGFRAALE |
Ga0134065_100051215 | 3300010326 | Grasslands Soil | MPAGLYQIVAATRRRLAETRPTADSRELERRAAEHVPRGFRRVLEEKSRDSVH |
Ga0126378_105579091 | 3300010361 | Tropical Forest Soil | MAAVLDRIVAATRVRVAEAKRGADLRQLARRAEQHVPR |
Ga0126379_138163431 | 3300010366 | Tropical Forest Soil | MNAVLDQIVAATRARVAESRRSADLGRLERQAERHVPRGFRT |
Ga0134128_127734142 | 3300010373 | Terrestrial Soil | MVTGLDQIIAATRRRVAAARASADLRELEQRAQEHAPRGFRRA |
Ga0134124_105449512 | 3300010397 | Terrestrial Soil | MGTRLDQIVAATRLRVANARRSADLRGLELAAEQHIPRGFRRALANKSKTGPA |
Ga0126383_100905053 | 3300010398 | Tropical Forest Soil | MPVGLDQIVAATRRRVAAARQSADLRQLERLAARHVPRGFRAR |
Ga0137393_117316772 | 3300011271 | Vadose Zone Soil | MAAILERIVAATRARVADAKRGADLPELERRAERHVP |
Ga0137388_111699531 | 3300012189 | Vadose Zone Soil | MAASLDQIVAATHRRVADAKRSADLRQLEQRTEQHVPRGFRQALST |
Ga0137378_100558161 | 3300012210 | Vadose Zone Soil | MPAILDRIVAATRARVAEAKRAANLRELERRAGLHVPRGF |
Ga0137370_109530171 | 3300012285 | Vadose Zone Soil | MAAFLDEIVAATRRRVACNKNAADLRSLERQAARHVPRGFRRAL |
Ga0137384_110671731 | 3300012357 | Vadose Zone Soil | MAAIIERIVAATRARVAEARRGADLRELERRAELH |
Ga0137390_119859391 | 3300012363 | Vadose Zone Soil | MAASLDQIVAATRRRVADAKRSVDLRQLEQRTEQYVPRGFRQA |
Ga0164303_112552332 | 3300012957 | Soil | MAAFLDEIVASTRRRIARSKSAADLRALEKQAETHALRGF |
Ga0126369_133620791 | 3300012971 | Tropical Forest Soil | MTAFLDKIVAATRRRVSEAKGSVDTGELERRAEEHVPRGFRRALEN |
Ga0157369_124486231 | 3300013105 | Corn Rhizosphere | MAVFLDEIVAATRRRVARSKSAADLRGLERQAEKHVPRG |
Ga0181531_106397323 | 3300014169 | Bog | MPASLDQIVAATRRRIAEMKPAANLRLLERQAGNHVPRGFRRGLESKSQNG |
Ga0181526_103203152 | 3300014200 | Bog | MAAILERIVAATRARVAESRRGANLPALEQAAERHVLRGFRRVLAA |
Ga0181526_107614971 | 3300014200 | Bog | MAAMLERIIAATRARVAETRGGADLRELERRAEQH |
Ga0181526_109499361 | 3300014200 | Bog | MAAILDRIVAATRARVAEARRSANLRDLEQRAERHVPRGFRRALSAKGENGSVA |
Ga0182024_116451091 | 3300014501 | Permafrost | MAAILERIVAATRALVAGAKRGADLRELELRAEMHGPRGFRRALELKSRE |
Ga0137403_115116962 | 3300015264 | Vadose Zone Soil | MAGVLDRIVAATRVRVAKAKRDADLRALERRAERHAPRGFRRA |
Ga0132255_1008217711 | 3300015374 | Arabidopsis Rhizosphere | MAAVLDRIVAATRARVAESRRMADLRELERLAERHVPRGFRDALQNPHF |
Ga0187818_102618721 | 3300017823 | Freshwater Sediment | MAAMLDRIVAATRARVAEAKRGADLRALERRAGQHAPRGFR |
Ga0187809_101295031 | 3300017937 | Freshwater Sediment | MATVLDRIVAATRARVAESKRVADLRALERQAEKHVPRGFRRALAA |
Ga0187809_102878242 | 3300017937 | Freshwater Sediment | MGTVLDRIVAATRARVAEAKRGADLRALEQRAERHAPRGFRRA |
Ga0187817_101403541 | 3300017955 | Freshwater Sediment | MFQFDMPASLDEIVAATRRRVAEIKPTADLRQLDRQAGNHVPRGFRRGLESSSASGVAVI |
Ga0187780_103663551 | 3300017973 | Tropical Peatland | MAAVLDRIVAATRARVAESKRGVDLRELERRAEQHVPRGFRKALAAKSRDGI |
Ga0187777_112973901 | 3300017974 | Tropical Peatland | MTASLDHIIAATRRRVADAKRTADVRDLERKAQDNKPRGFRRHLEKARAAGI |
Ga0187815_103342332 | 3300018001 | Freshwater Sediment | MPASLDEIVAATRRRVAESKPVVDLRQVERQAGNHVPRGFRHSLESGS |
Ga0187875_103489891 | 3300018035 | Peatland | MAVILERIVAAARMRLAETRRGADLRELERRAERHVPRGFRRVL |
Ga0187883_106034501 | 3300018037 | Peatland | MAAILERIAAATRARVAESMRGANLPALEQAAERHVLRGFRRVL |
Ga0187862_108769762 | 3300018040 | Peatland | MAAILERIVAATRARVVECRRGADWRELERRAERHVPRGFR |
Ga0187890_102042721 | 3300018044 | Peatland | MPASLDEIVAATRRRVAETKPAADLRKLERQADNHIPR |
Ga0187890_102592482 | 3300018044 | Peatland | MAAILERIVAATRARVVECRRGADWRELERRAERHVPRGFRRALEVKSREGVAVI |
Ga0187859_108576391 | 3300018047 | Peatland | MAAILERIAAATRARVAESMRGANLPALEQAAERHVPRGFRRVL |
Ga0187858_104573472 | 3300018057 | Peatland | MAAILERIVAAARARVSETRRKADLRELERLAESHVPRGFRRALELKSREGVAV |
Ga0187784_114049501 | 3300018062 | Tropical Peatland | MSAFLDRMIAATGARVTETKRGADLHELERRAEEHTPRGFRRALAEKGRTGIA |
Ga0187772_114954771 | 3300018085 | Tropical Peatland | MAAFLERIVSATRARVAEAKRRADIRELERMAEQHTLRRFRRALAEKSRRGIAVI |
Ga0187770_107038282 | 3300018090 | Tropical Peatland | MPANLDQIVAATHRRVADTKRSVSILELERRAREHIPRGFRESLKLKSR |
Ga0187768_10936321 | 3300020150 | Tropical Peatland | MPAGLDQIVAATRRKVAQARCATDLRELERQAEQHVPRGFRRALESRNG |
Ga0210399_113279862 | 3300020581 | Soil | MAAVLDRIVAATRARVAESMRTADLRELERRADQHVPRGFRNALAARGRDGI |
Ga0210395_104237393 | 3300020582 | Soil | MPALLDQIVAATRARVSRTKRDADLRDLERRAEQHAPRGFRHAL |
Ga0210405_102424521 | 3300021171 | Soil | MVASLDQIVAATRRRVAEAKRSADLPALKRQAEKHLPRGFRRALATQ |
Ga0210405_107810292 | 3300021171 | Soil | MAAVLDRIVAATRARVAESRRAADLRELERRAERHVPRGFRKALDSKGPTA |
Ga0210405_112527152 | 3300021171 | Soil | MAAILERIVAATRARVAESRRGADWRGLEQAAERHVPRGF |
Ga0210408_105796073 | 3300021178 | Soil | MPASLSEIVAATRRRVAKTKLTADLRQLDRQAGSHVPRGFRQGLESANQV |
Ga0210396_110333991 | 3300021180 | Soil | MVASLDQIVAATRRRVAEAKRSADLPALKRQAEKHLPRGFRRAL |
Ga0210385_103285131 | 3300021402 | Soil | MAAVLDRIIAATRTRVAESKRAADLRQVEQRAEAHVPRGFRQVLAAKSRDGVAVI |
Ga0210387_116446481 | 3300021405 | Soil | MAAILERIVAATRALVAGAKRAADLRELELRAEMHVPRGFRRALELKS |
Ga0210394_109817112 | 3300021420 | Soil | MPATLDQIVSATRLRVADARRSADLRQLEKLAQDHVPRGFRRALANGEQAG |
Ga0126371_108132982 | 3300021560 | Tropical Forest Soil | MAAILDRIVAATRARVAESRRGADLRELERRADSHVPRGFRRSLENPHPSR |
Ga0224563_10208031 | 3300022731 | Soil | MPASLDQMVAATRRRIAETKPAADLRPLERQAGNHVPRGFRRGLE |
Ga0208691_10703841 | 3300025612 | Peatland | MAVILERIVAAARMRVAEARRGADLHELERRAERHVPRGFRRTLASKCREGVAVI |
Ga0207692_110398042 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | MAAFLDEIVAATRRRVARAKTGADLRELERRAAGHVP |
Ga0207654_100387991 | 3300025911 | Corn Rhizosphere | MGTRLDQIVAATRLRVANARRSADLRGLELAAEQHIPRGFRRALADK |
Ga0207660_111536172 | 3300025917 | Corn Rhizosphere | MAASLDQIVAATRRRVADGKSSTDLRQLERAAGQHVPRGFR |
Ga0207700_101322661 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | MAAFLDQIVTATRRRVAEAKRGADLRELERRAEQHAPRGFRRALAAKSDAAVIT |
Ga0207700_103584152 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | MAAFLDEIVAATRRRVSEATGSVDVSELERRAEEHVPRGFRRALAAK |
Ga0207664_116257511 | 3300025929 | Agricultural Soil | MAAFLDEIVAATRRRVARSKSAADLRALEKQAERHVPRGFRRAL |
Ga0207667_114734631 | 3300025949 | Corn Rhizosphere | MAASLDQIVAATRRRVADGKSSTDLRQLERAAGQHVLRGFRRALASQTGLAIIAELKK |
Ga0207667_119386101 | 3300025949 | Corn Rhizosphere | MAAFLDEIVAAARRRVARNKNAADLRALERQAARHVPRGLRRALASRGQDGIAI |
Ga0207668_119434712 | 3300025972 | Switchgrass Rhizosphere | MPARLDQIVAATRRRVADAKRSSDLRQLEREAEQHVPRGFRRALASQTGPA |
Ga0208284_10064651 | 3300026003 | Rice Paddy Soil | MAAFLDEIVAATRRRLAHNKNAADLRALEREAARHVPRGFRRALAARG |
Ga0207674_102215051 | 3300026116 | Corn Rhizosphere | MAASLDQIVAATRRRVADGKSSTDLRQLERAAGQHVPRGFRRALASQTGPAIIA |
Ga0209265_11468252 | 3300026308 | Soil | MAAFLDEIVAATRRRVAGSKSAADLRALERQAATHVPRGF |
Ga0209686_11849531 | 3300026315 | Soil | MPSSLDQIVAATRRRIAQCRARADFRLLERQAQNHAPRGFRQILAEGSR |
Ga0209803_12882591 | 3300026332 | Soil | MVASLDHIVAATRRRIAKSKRSADLAGLERQAQKHTPR |
Ga0209577_108839622 | 3300026552 | Soil | MGANLNQIIAATRRRVAEARGSADLRALERQAGEHVPRGFRRQLAQRA |
Ga0208241_10104471 | 3300027297 | Forest Soil | MPASLDQIVAEARRRVADTKSVADLHQLDGQAEKHVPRGFRRALESASHDGV |
Ga0208042_10944042 | 3300027568 | Peatlands Soil | MTAVLDRIVAATRARVAEARRAADLRALERQAEQHVPRGFR |
Ga0209167_100213751 | 3300027867 | Surface Soil | MAAVLDRIVAATRAKVEECRRGADLRTLEKRAESHVPRGFRQALQSKSAGGVAVIA |
Ga0311371_103204763 | 3300029951 | Palsa | MAGVLERIVAATRRRVSEARRGADLRELERRAERHVP |
Ga0311350_105692562 | 3300030002 | Fen | MAAVLDRILAATRARVAKARHGADLRELERQAELHVPRGFRRALAA |
Ga0299906_111167701 | 3300030606 | Soil | MPATLDEIVAATRRRVSEARKSVAASALERAGESHYPR |
Ga0316363_100289033 | 3300030659 | Peatlands Soil | MPAFLEQIVAAARRRVAEAKRRADRGELDRQAERHVPRGFRR |
Ga0265765_10502681 | 3300030879 | Soil | MPASLDQMVAATRRRIAETKPAADLRPLERQAGNHVPRGFRRGLESKSQNGIAVIA |
Ga0265760_100176063 | 3300031090 | Soil | MAAILERIVAATRARVAEGRRGADLRELERRAEGHVP |
Ga0170823_101841551 | 3300031128 | Forest Soil | MPAKLDQIVAATRRRLAEIKPAADLRQLDRQAGKHVPRGFRRGLES |
Ga0302325_118742801 | 3300031234 | Palsa | MLAMPASLDQIVSAARRRVAETKRRGGLGELERQAQA |
Ga0265316_103350162 | 3300031344 | Rhizosphere | MATVLDKIVAATWARVADAKRGADLREMEQRAESHVPRGFRRALAGQGREG |
Ga0170820_111507712 | 3300031446 | Forest Soil | MAAVLDKIIAATRARVAEAKRSSDLRELEQRAESHEPRGFRRA |
Ga0310686_1073557092 | 3300031708 | Soil | MAAILERIVAATRVRVAEAKRGADLRELERRAEGHVPRGFRRALAAKSKDG |
Ga0307474_105304702 | 3300031718 | Hardwood Forest Soil | MAVPYNLGTAMPASLDQIVAATRRRVAETRRSADSRALERQAEKHVPRGFR |
Ga0306917_103822341 | 3300031719 | Soil | MAAILDRIVAATRARVAESKRGADARELERRAESHVPRGFRAALAAKGGDGIAVIAE |
Ga0307478_115111842 | 3300031823 | Hardwood Forest Soil | MTAVLDRIIAATRARVAESRSTADLPSLELRAESHVPR |
Ga0315268_116995132 | 3300032173 | Sediment | MPTTLDEILAATRARVAAAKRPADLRALERQAAEHT |
Ga0316231_12629131 | 3300032722 | Freshwater | MAVNLDQIVAATRRRVALRCSAADLPALERQALAHRPRGFRRALAT |
Ga0335078_121591672 | 3300032805 | Soil | MVAVLDRIVAATRTRVAEAKRRGDFREMERRAERHVPRGFR |
Ga0335070_110374452 | 3300032829 | Soil | MAAVLDRIVAATRARVAESSRVADVRELERRAEQHVPRGFRDALQN |
Ga0335081_113993982 | 3300032892 | Soil | MAAILEQIVAATRVRVAESRSTADVRELERRAESHVPRGFRAALADRGRD |
Ga0335069_104073151 | 3300032893 | Soil | MPAVLDQIVAAARARVAVSKRSADLRELERRAQSHVPRGFRRALAS |
Ga0335073_105089732 | 3300033134 | Soil | MAAVLDKIIAATRARVAQSRRSANCVDLGRAAERHSPRGFRRALESK |
Ga0334792_011064_3399_3560 | 3300033888 | Soil | MAAILERIIAATQRRVGEVKRQADYRELERKAELHVPRGFRRALQSKSREGVAI |
⦗Top⦘ |