| Basic Information | |
|---|---|
| Family ID | F061151 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 132 |
| Average Sequence Length | 41 residues |
| Representative Sequence | VRQVLGEEATPRTRLVELPGRGVTRVWECAGPPGAETLMLIHG |
| Number of Associated Samples | 122 |
| Number of Associated Scaffolds | 132 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 99.23 % |
| % of genes near scaffold ends (potentially truncated) | 98.48 % |
| % of genes from short scaffolds (< 2000 bps) | 91.67 % |
| Associated GOLD sequencing projects | 120 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.43 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (74.242 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (22.727 % of family members) |
| Environment Ontology (ENVO) | Unclassified (21.212 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (41.667 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 26.76% Coil/Unstructured: 73.24% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.43 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 132 Family Scaffolds |
|---|---|---|
| PF13847 | Methyltransf_31 | 15.15 |
| PF08240 | ADH_N | 5.30 |
| PF00196 | GerE | 3.79 |
| PF10009 | DUF2252 | 3.03 |
| PF01261 | AP_endonuc_2 | 1.52 |
| PF13185 | GAF_2 | 0.76 |
| PF02126 | PTE | 0.76 |
| PF02913 | FAD-oxidase_C | 0.76 |
| PF12697 | Abhydrolase_6 | 0.76 |
| PF06187 | DUF993 | 0.76 |
| PF00465 | Fe-ADH | 0.76 |
| PF13560 | HTH_31 | 0.76 |
| PF08448 | PAS_4 | 0.76 |
| PF01590 | GAF | 0.76 |
| PF03446 | NAD_binding_2 | 0.76 |
| PF02371 | Transposase_20 | 0.76 |
| PF02579 | Nitro_FeMo-Co | 0.76 |
| PF00501 | AMP-binding | 0.76 |
| PF00106 | adh_short | 0.76 |
| PF12847 | Methyltransf_18 | 0.76 |
| COG ID | Name | Functional Category | % Frequency in 132 Family Scaffolds |
|---|---|---|---|
| COG0277 | FAD/FMN-containing lactate dehydrogenase/glycolate oxidase | Energy production and conversion [C] | 0.76 |
| COG0337 | 3-dehydroquinate synthetase | Amino acid transport and metabolism [E] | 0.76 |
| COG0371 | Glycerol dehydrogenase or related enzyme, iron-containing ADH family | Energy production and conversion [C] | 0.76 |
| COG1454 | Alcohol dehydrogenase, class IV | Energy production and conversion [C] | 0.76 |
| COG1735 | Predicted metal-dependent hydrolase, phosphotriesterase family | General function prediction only [R] | 0.76 |
| COG1979 | Alcohol dehydrogenase YqhD, Fe-dependent ADH family | Energy production and conversion [C] | 0.76 |
| COG3547 | Transposase | Mobilome: prophages, transposons [X] | 0.76 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 74.24 % |
| Unclassified | root | N/A | 25.76 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2170459012|GOYVCMS01CXJSV | Not Available | 501 | Open in IMG/M |
| 2209111022|2221196248 | All Organisms → cellular organisms → Bacteria | 1277 | Open in IMG/M |
| 3300003368|JGI26340J50214_10008624 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 3274 | Open in IMG/M |
| 3300004092|Ga0062389_102772991 | Not Available | 654 | Open in IMG/M |
| 3300005339|Ga0070660_100993744 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 709 | Open in IMG/M |
| 3300005363|Ga0008090_15292001 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 720 | Open in IMG/M |
| 3300005367|Ga0070667_100079788 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2798 | Open in IMG/M |
| 3300005539|Ga0068853_100384797 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1311 | Open in IMG/M |
| 3300005546|Ga0070696_101316872 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 614 | Open in IMG/M |
| 3300005568|Ga0066703_10667979 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 600 | Open in IMG/M |
| 3300005591|Ga0070761_11055394 | Not Available | 517 | Open in IMG/M |
| 3300006059|Ga0075017_101687707 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 501 | Open in IMG/M |
| 3300006162|Ga0075030_100349880 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1179 | Open in IMG/M |
| 3300006174|Ga0075014_100454505 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 709 | Open in IMG/M |
| 3300006176|Ga0070765_101322295 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 680 | Open in IMG/M |
| 3300006579|Ga0074054_11668586 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 843 | Open in IMG/M |
| 3300007076|Ga0075435_100212789 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1640 | Open in IMG/M |
| 3300009012|Ga0066710_101047672 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1260 | Open in IMG/M |
| 3300009093|Ga0105240_11283420 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 773 | Open in IMG/M |
| 3300009137|Ga0066709_102971045 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 623 | Open in IMG/M |
| 3300009177|Ga0105248_11296602 | Not Available | 824 | Open in IMG/M |
| 3300009524|Ga0116225_1510757 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 534 | Open in IMG/M |
| 3300009553|Ga0105249_13246597 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 523 | Open in IMG/M |
| 3300009698|Ga0116216_10285001 | Not Available | 1007 | Open in IMG/M |
| 3300009700|Ga0116217_10063634 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2615 | Open in IMG/M |
| 3300009839|Ga0116223_10628606 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Geodermatophilales → Geodermatophilaceae → unclassified Geodermatophilaceae → Geodermatophilaceae bacterium URHB0062 | 619 | Open in IMG/M |
| 3300010323|Ga0134086_10455256 | Not Available | 523 | Open in IMG/M |
| 3300010375|Ga0105239_11499246 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 779 | Open in IMG/M |
| 3300010376|Ga0126381_100209205 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Micromonospora → Micromonospora chokoriensis | 2614 | Open in IMG/M |
| 3300010379|Ga0136449_101312061 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1127 | Open in IMG/M |
| 3300010379|Ga0136449_103494885 | Not Available | 599 | Open in IMG/M |
| 3300010396|Ga0134126_12565052 | Not Available | 554 | Open in IMG/M |
| 3300012354|Ga0137366_11071854 | Not Available | 556 | Open in IMG/M |
| 3300012497|Ga0157319_1041528 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 540 | Open in IMG/M |
| 3300012582|Ga0137358_10892449 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 583 | Open in IMG/M |
| 3300012971|Ga0126369_11919427 | All Organisms → cellular organisms → Bacteria | 680 | Open in IMG/M |
| 3300012985|Ga0164308_10599488 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 937 | Open in IMG/M |
| 3300012989|Ga0164305_11148060 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 670 | Open in IMG/M |
| 3300013100|Ga0157373_10034533 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3632 | Open in IMG/M |
| 3300013297|Ga0157378_11143530 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 817 | Open in IMG/M |
| 3300015372|Ga0132256_101705101 | All Organisms → cellular organisms → Bacteria | 739 | Open in IMG/M |
| 3300015372|Ga0132256_102654966 | Not Available | 601 | Open in IMG/M |
| 3300015374|Ga0132255_102757749 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 751 | Open in IMG/M |
| 3300015374|Ga0132255_105176710 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 552 | Open in IMG/M |
| 3300016371|Ga0182034_11640546 | Not Available | 565 | Open in IMG/M |
| 3300016445|Ga0182038_11849746 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 545 | Open in IMG/M |
| 3300017926|Ga0187807_1067974 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1109 | Open in IMG/M |
| 3300017937|Ga0187809_10435368 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 505 | Open in IMG/M |
| 3300017946|Ga0187879_10440879 | Not Available | 722 | Open in IMG/M |
| 3300017946|Ga0187879_10762892 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 539 | Open in IMG/M |
| 3300017961|Ga0187778_10410103 | Not Available | 890 | Open in IMG/M |
| 3300017966|Ga0187776_10102586 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1707 | Open in IMG/M |
| 3300017972|Ga0187781_11274486 | Not Available | 542 | Open in IMG/M |
| 3300017974|Ga0187777_10758592 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales | 691 | Open in IMG/M |
| 3300018026|Ga0187857_10552743 | Not Available | 514 | Open in IMG/M |
| 3300018037|Ga0187883_10734231 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 516 | Open in IMG/M |
| 3300018038|Ga0187855_10285448 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Demequinaceae → Demequina → Demequina aestuarii | 966 | Open in IMG/M |
| 3300018058|Ga0187766_10062352 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 2209 | Open in IMG/M |
| 3300018058|Ga0187766_10658147 | All Organisms → cellular organisms → Bacteria | 720 | Open in IMG/M |
| 3300018060|Ga0187765_10187231 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1189 | Open in IMG/M |
| 3300019888|Ga0193751_1195702 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 682 | Open in IMG/M |
| 3300021170|Ga0210400_10333250 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1248 | Open in IMG/M |
| 3300021180|Ga0210396_11316179 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 601 | Open in IMG/M |
| 3300021181|Ga0210388_10361683 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1276 | Open in IMG/M |
| 3300021388|Ga0213875_10036866 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 2305 | Open in IMG/M |
| 3300021404|Ga0210389_10738428 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 770 | Open in IMG/M |
| 3300021404|Ga0210389_11457597 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 521 | Open in IMG/M |
| 3300021407|Ga0210383_10194895 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1731 | Open in IMG/M |
| 3300021560|Ga0126371_12594045 | Not Available | 614 | Open in IMG/M |
| 3300025527|Ga0208714_1026017 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1389 | Open in IMG/M |
| 3300025898|Ga0207692_10681147 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 666 | Open in IMG/M |
| 3300025905|Ga0207685_10681394 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 558 | Open in IMG/M |
| 3300025921|Ga0207652_11007100 | Not Available | 732 | Open in IMG/M |
| 3300025924|Ga0207694_11006543 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 705 | Open in IMG/M |
| 3300025929|Ga0207664_11406810 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 618 | Open in IMG/M |
| 3300025949|Ga0207667_12151841 | Not Available | 516 | Open in IMG/M |
| 3300026023|Ga0207677_10559258 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 998 | Open in IMG/M |
| 3300026374|Ga0257146_1078902 | Not Available | 537 | Open in IMG/M |
| 3300027590|Ga0209116_1017877 | All Organisms → cellular organisms → Bacteria | 1453 | Open in IMG/M |
| 3300027676|Ga0209333_1105424 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 767 | Open in IMG/M |
| 3300027825|Ga0209039_10022490 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 3179 | Open in IMG/M |
| 3300027879|Ga0209169_10268029 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 896 | Open in IMG/M |
| 3300027894|Ga0209068_10919750 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 518 | Open in IMG/M |
| 3300027911|Ga0209698_11045263 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 607 | Open in IMG/M |
| 3300028708|Ga0307295_10157911 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 632 | Open in IMG/M |
| 3300028801|Ga0302226_10161371 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 971 | Open in IMG/M |
| 3300028877|Ga0302235_10387194 | Not Available | 599 | Open in IMG/M |
| 3300029943|Ga0311340_10455885 | Not Available | 1156 | Open in IMG/M |
| 3300029997|Ga0302302_1348965 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 525 | Open in IMG/M |
| 3300030057|Ga0302176_10046326 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Frankiales | 1665 | Open in IMG/M |
| 3300030399|Ga0311353_10612436 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 950 | Open in IMG/M |
| 3300030509|Ga0302183_10256056 | Not Available | 679 | Open in IMG/M |
| 3300030617|Ga0311356_11538033 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 600 | Open in IMG/M |
| 3300030906|Ga0302314_11326700 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 663 | Open in IMG/M |
| 3300031236|Ga0302324_102088299 | Not Available | 707 | Open in IMG/M |
| 3300031549|Ga0318571_10412079 | Not Available | 529 | Open in IMG/M |
| 3300031681|Ga0318572_10926884 | Not Available | 517 | Open in IMG/M |
| 3300031716|Ga0310813_12312968 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 509 | Open in IMG/M |
| 3300031723|Ga0318493_10643699 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 592 | Open in IMG/M |
| 3300031724|Ga0318500_10586021 | All Organisms → cellular organisms → Bacteria | 564 | Open in IMG/M |
| 3300031747|Ga0318502_10637845 | Not Available | 642 | Open in IMG/M |
| 3300031748|Ga0318492_10114462 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1336 | Open in IMG/M |
| 3300031748|Ga0318492_10184765 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1062 | Open in IMG/M |
| 3300031751|Ga0318494_10464742 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 736 | Open in IMG/M |
| 3300031778|Ga0318498_10256704 | All Organisms → cellular organisms → Bacteria | 788 | Open in IMG/M |
| 3300031793|Ga0318548_10217168 | Not Available | 939 | Open in IMG/M |
| 3300031796|Ga0318576_10009864 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 3482 | Open in IMG/M |
| 3300031820|Ga0307473_10578290 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 772 | Open in IMG/M |
| 3300031832|Ga0318499_10235684 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium | 711 | Open in IMG/M |
| 3300031833|Ga0310917_10941156 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 581 | Open in IMG/M |
| 3300031845|Ga0318511_10084779 | All Organisms → cellular organisms → Bacteria | 1328 | Open in IMG/M |
| 3300031845|Ga0318511_10165664 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 971 | Open in IMG/M |
| 3300031859|Ga0318527_10179885 | All Organisms → cellular organisms → Bacteria | 892 | Open in IMG/M |
| 3300031860|Ga0318495_10484452 | All Organisms → cellular organisms → Bacteria | 540 | Open in IMG/M |
| 3300031890|Ga0306925_10427610 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1417 | Open in IMG/M |
| 3300031890|Ga0306925_11100734 | All Organisms → cellular organisms → Bacteria | 803 | Open in IMG/M |
| 3300031912|Ga0306921_12212177 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 579 | Open in IMG/M |
| 3300031938|Ga0308175_102009319 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 648 | Open in IMG/M |
| 3300031947|Ga0310909_11131374 | Not Available | 635 | Open in IMG/M |
| 3300031981|Ga0318531_10244430 | All Organisms → cellular organisms → Bacteria | 810 | Open in IMG/M |
| 3300032010|Ga0318569_10464003 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 591 | Open in IMG/M |
| 3300032039|Ga0318559_10218188 | Not Available | 879 | Open in IMG/M |
| 3300032043|Ga0318556_10621168 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 563 | Open in IMG/M |
| 3300032068|Ga0318553_10264540 | Not Available | 899 | Open in IMG/M |
| 3300032160|Ga0311301_12232554 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 626 | Open in IMG/M |
| 3300032160|Ga0311301_13032361 | Not Available | 504 | Open in IMG/M |
| 3300032783|Ga0335079_10579605 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium → Mycobacterium tuberculosis complex → Mycobacterium tuberculosis | 1186 | Open in IMG/M |
| 3300032892|Ga0335081_10421561 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1708 | Open in IMG/M |
| 3300032954|Ga0335083_10511367 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1004 | Open in IMG/M |
| 3300033807|Ga0314866_056193 | Not Available | 653 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 22.73% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 7.58% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 6.06% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 5.30% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 3.79% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 3.79% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.79% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 3.79% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 2.27% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 2.27% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 2.27% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 2.27% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.27% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 2.27% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 1.52% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 1.52% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.52% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 1.52% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.52% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.52% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.52% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 1.52% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.76% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.76% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.76% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grass Soil | 0.76% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 0.76% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 0.76% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 0.76% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.76% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.76% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.76% |
| Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 0.76% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.76% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.76% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.76% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.76% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere | 0.76% |
| Plant Roots | Host-Associated → Plants → Roots → Unclassified → Unclassified → Plant Roots | 0.76% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.76% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.76% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.76% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.76% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.76% |
| Tropical Rainforest Soil | Environmental → Terrestrial → Soil → Unclassified → Tropical Rainforest → Tropical Rainforest Soil | 0.76% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2170459012 | Grass soil microbial communities from Rothamsted Park, UK - July 2010 direct MP BIO1O1 lysis Rhizosphere grass | Environmental | Open in IMG/M |
| 2209111022 | Grass soil microbial communities from Rothamsted Park, UK - Chitin enrichment | Environmental | Open in IMG/M |
| 3300003368 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM2 | Environmental | Open in IMG/M |
| 3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005363 | Tropical rainforest soil microbial communities from the Amazon Forest, Brazil, analyzing deforestation - Metatranscriptome F II A100 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Host-Associated | Open in IMG/M |
| 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Environmental | Open in IMG/M |
| 3300005568 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 | Environmental | Open in IMG/M |
| 3300005591 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 | Environmental | Open in IMG/M |
| 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Host-Associated | Open in IMG/M |
| 3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
| 3300006162 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 | Environmental | Open in IMG/M |
| 3300006174 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014 | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006579 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLAB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009524 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_c_BC metaG | Environmental | Open in IMG/M |
| 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
| 3300009698 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG | Environmental | Open in IMG/M |
| 3300009700 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG | Environmental | Open in IMG/M |
| 3300009839 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG | Environmental | Open in IMG/M |
| 3300010323 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300012354 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012497 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 | Host-Associated | Open in IMG/M |
| 3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012985 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MG | Environmental | Open in IMG/M |
| 3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
| 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Host-Associated | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300017926 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_2 | Environmental | Open in IMG/M |
| 3300017937 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_4 | Environmental | Open in IMG/M |
| 3300017946 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_10 | Environmental | Open in IMG/M |
| 3300017961 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MG | Environmental | Open in IMG/M |
| 3300017966 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MG | Environmental | Open in IMG/M |
| 3300017972 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017974 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MG | Environmental | Open in IMG/M |
| 3300018026 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_100 | Environmental | Open in IMG/M |
| 3300018037 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_10 | Environmental | Open in IMG/M |
| 3300018038 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_10 | Environmental | Open in IMG/M |
| 3300018058 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MG | Environmental | Open in IMG/M |
| 3300018060 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MG | Environmental | Open in IMG/M |
| 3300019888 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1c2 | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
| 3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
| 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Host-Associated | Open in IMG/M |
| 3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
| 3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300025527 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 415-1 shallow-072012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026374 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - CO-08-A | Environmental | Open in IMG/M |
| 3300027590 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027676 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_O3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027825 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027879 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 (SPAdes) | Environmental | Open in IMG/M |
| 3300027894 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300027911 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300028708 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_152 | Environmental | Open in IMG/M |
| 3300028801 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E3_3 | Environmental | Open in IMG/M |
| 3300028877 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N3_3 | Environmental | Open in IMG/M |
| 3300029943 | I_Palsa_N3 coassembly | Environmental | Open in IMG/M |
| 3300029997 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E1_3 | Environmental | Open in IMG/M |
| 3300030057 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E1_1 | Environmental | Open in IMG/M |
| 3300030399 | II_Palsa_E2 coassembly | Environmental | Open in IMG/M |
| 3300030509 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_N3_2 | Environmental | Open in IMG/M |
| 3300030617 | II_Palsa_N2 coassembly | Environmental | Open in IMG/M |
| 3300030906 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N2_3 | Environmental | Open in IMG/M |
| 3300031236 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1 | Environmental | Open in IMG/M |
| 3300031469 | Fir Spring Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031549 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f24 | Environmental | Open in IMG/M |
| 3300031681 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20 | Environmental | Open in IMG/M |
| 3300031716 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3 | Environmental | Open in IMG/M |
| 3300031723 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23 | Environmental | Open in IMG/M |
| 3300031724 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20 | Environmental | Open in IMG/M |
| 3300031747 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22 | Environmental | Open in IMG/M |
| 3300031748 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f22 | Environmental | Open in IMG/M |
| 3300031751 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24 | Environmental | Open in IMG/M |
| 3300031778 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f24 | Environmental | Open in IMG/M |
| 3300031793 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f21 | Environmental | Open in IMG/M |
| 3300031796 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f24 | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300031832 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f25 | Environmental | Open in IMG/M |
| 3300031833 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178 | Environmental | Open in IMG/M |
| 3300031845 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f18 | Environmental | Open in IMG/M |
| 3300031859 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f25 | Environmental | Open in IMG/M |
| 3300031860 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f25 | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031938 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1 | Environmental | Open in IMG/M |
| 3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
| 3300031981 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f25 | Environmental | Open in IMG/M |
| 3300032010 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f22 | Environmental | Open in IMG/M |
| 3300032039 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f21 | Environmental | Open in IMG/M |
| 3300032043 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f24 | Environmental | Open in IMG/M |
| 3300032068 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f21 | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
| 3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
| 3300032954 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2 | Environmental | Open in IMG/M |
| 3300033807 | Tropical peat soil microbial communities from peatlands in Loreto, Peru - MAQ_100_10 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| N56_09200800 | 2170459012 | Grass Soil | VVRRVLGEAAAPLTRLVELPGRGATRVWECPGPRRAETLM |
| 2222018003 | 2209111022 | Grass Soil | VRQVSGKAATPRTRLVELPGRGVTRVWECAGPQGAETL |
| JGI26340J50214_100086244 | 3300003368 | Bog Forest Soil | VLGEATAPLTRLVELPGRGVTRVWECAGPPGAETLMLIHGVTFTAE |
| Ga0062389_1027729913 | 3300004092 | Bog Forest Soil | VRRVSQETAMPVTRLIELPGRGVTRVWECAGPPGAETLILIHGVTV |
| Ga0070660_1009937442 | 3300005339 | Corn Rhizosphere | VVRRVAGEAAAPLSRLVELPGRGVMRVWECPGPRRAETLMLIHGVAVTA |
| Ga0008090_152920011 | 3300005363 | Tropical Rainforest Soil | VVRRVLGEAKTPLTRLVDLPGRGATRVWECSGPRRAETLMLIH |
| Ga0070667_1000797884 | 3300005367 | Switchgrass Rhizosphere | VRQVAGMVATAGTRLVELPGRGVTRVWECPGPRGAETLMLI |
| Ga0068853_1003847971 | 3300005539 | Corn Rhizosphere | MVATAGTRLVELPGRGVTRVWECPGPRGAETLMLIHGVTFTA |
| Ga0070696_1013168722 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | VVRRVAGEAAAPLSRLVELPGRGVMRVWECPGPRRAETLMLIHGVAVT |
| Ga0066703_106679792 | 3300005568 | Soil | VVRRVLGEAETPLTRLVELPGRGATRVWECPGPRRAETL |
| Ga0070761_110553942 | 3300005591 | Soil | VRQVLEEATAPLSRLVVLPGRGVMRVWECAGPPGAD |
| Ga0068864_1024909491 | 3300005618 | Switchgrass Rhizosphere | VVIRELPGEAEPPAPRTRLTALPGRGVTRIWECAG |
| Ga0075017_1016877071 | 3300006059 | Watersheds | MVQQVLEEAAAPLTRLAELPGRGVTRVWECAGPRGAETLMLIHGLAFTA |
| Ga0075030_1003498801 | 3300006162 | Watersheds | VLGEASLRQVLGEAEAPVTRLVELPGRGVTRVWEC |
| Ga0075014_1004545051 | 3300006174 | Watersheds | VLGEASLRQVLGEAEAPATRLVELPGRGVTRVWECAGPPGAE |
| Ga0070765_1013222951 | 3300006176 | Soil | VRQLAQEAVPAKTRLIALPGRGVTRVWECAGPPDAPV |
| Ga0074054_116685862 | 3300006579 | Soil | VRQVPGMAETAGTRLVELPGRGVTRVWECPGPRGA |
| Ga0075435_1002127893 | 3300007076 | Populus Rhizosphere | VVRRVAGEAAPPSRLVELPGRGATRVWECPGPRRAETLMLIHGVAVTA |
| Ga0066710_1010476722 | 3300009012 | Grasslands Soil | VRHVSGKAATPRTRLVELPGRGVTRVWECTGPRGAETLMLIHGVTF |
| Ga0105240_112834202 | 3300009093 | Corn Rhizosphere | MAATAGTRLVELPGRGVTRVWECPGPRGAETLMLIHGVTFTA |
| Ga0066709_1029710451 | 3300009137 | Grasslands Soil | MRRVLGEAATPLTRLVELPGRGATRVWECPGPRRAE |
| Ga0105248_112966023 | 3300009177 | Switchgrass Rhizosphere | VRQVPGEAVAPVTRLAVLPGRGATRVWECAGPRGAETLVLIH |
| Ga0116225_15107571 | 3300009524 | Peatlands Soil | VRQVLGEATAPLTRLVELPGRGATRVWECAGPPGA |
| Ga0105249_132465972 | 3300009553 | Switchgrass Rhizosphere | MAATAGTRLVELPGRGVTRVWECPGPRGAETLMLI |
| Ga0116216_102850012 | 3300009698 | Peatlands Soil | VRQVLAEEATPRTRLVELPGRGATRMWECAGPPGA |
| Ga0116217_100636343 | 3300009700 | Peatlands Soil | VRQVLAEEATPRTRLVELPGRGATRMWECAGPPGAETLMLIHGV |
| Ga0116223_106286061 | 3300009839 | Peatlands Soil | VVRQVPGEAAAPVTRLAELPGRGVTRVWECVGPPGAETLMLIHGVACT |
| Ga0134086_104552561 | 3300010323 | Grasslands Soil | MRRVLGEAATPLTRLVELPGRGATRVWECPGPRRAETLMLIH |
| Ga0105239_114992461 | 3300010375 | Corn Rhizosphere | MVATAGTRLVELPGRGVTRVWECPGPHGAETLMLIHGVTFTA |
| Ga0126381_1002092054 | 3300010376 | Tropical Forest Soil | VVRRVLGQAARPLTRVAELPGRGTTRVWECAGPRGAETLVLIHGVAV |
| Ga0136449_1013120611 | 3300010379 | Peatlands Soil | VRQVFEETAAPLSRLVVLPGRGVTRVWECAGPPGADTLVLIHGVAATAE |
| Ga0136449_1034948851 | 3300010379 | Peatlands Soil | MLGEAAIPLTRLVELPGRGTTRVWECAGPPGAGTLV |
| Ga0134126_125650521 | 3300010396 | Terrestrial Soil | VRQVPGKAGTSRTRLVELPSRGVTRVWECTGPRGAPTLMLIHGVTFT |
| Ga0137366_110718541 | 3300012354 | Vadose Zone Soil | VVRRVLGEAATPLTRLVELPGRGATRVWECPGPRRAETLM |
| Ga0157319_10415281 | 3300012497 | Arabidopsis Rhizosphere | VRQVAGIVATAGTRLVELPDRGVTRVWECPGPRGAETLM |
| Ga0137358_108924491 | 3300012582 | Vadose Zone Soil | VRQVPGKAGTSRTRLVELPGRGVTRVWECTGPRGAPTLMLIH |
| Ga0126369_119194271 | 3300012971 | Tropical Forest Soil | VVRRVLGEAATPLTRLVELPGRGATRVWECPGPRRAETLMLIHGVAVTAE |
| Ga0164308_105994881 | 3300012985 | Soil | MVATAGTRLVELPGRGVTRVWECPGPRGAETLMLIHGVTF |
| Ga0164305_111480602 | 3300012989 | Soil | VRQVPGKAGTSRTRLVELPGRGVTRVWECTGPRGAPTLMLI |
| Ga0157373_100345331 | 3300013100 | Corn Rhizosphere | VRQVAGMVATAGTRLVELPGRGVTRIWECPGPRGA |
| Ga0157378_111435302 | 3300013297 | Miscanthus Rhizosphere | VRQVAGMVATAGTRPVELPGRGVTRVWECPGPRGA |
| Ga0132256_1017051011 | 3300015372 | Arabidopsis Rhizosphere | VVRRVAGEAAPPSRLVELPGRGATRVWECPGPRRAETL |
| Ga0132256_1026549661 | 3300015372 | Arabidopsis Rhizosphere | VRQVLGQEAAPRTGLVELPGRGVTRVWECAGPPGAGTLML |
| Ga0132255_1027577492 | 3300015374 | Arabidopsis Rhizosphere | MVATAGTRLVELPDRGVTRVWECPGPRGAETLMLIHGVTFT |
| Ga0132255_1051767101 | 3300015374 | Arabidopsis Rhizosphere | VRQVAGMAATASTRLVELPGRGVTRVWECPGPRGAETL |
| Ga0182034_116405461 | 3300016371 | Soil | VRQATAKAATPRTRLVELPGRGVTRVWECTGPRGAETLMLIHGVTFTAEL |
| Ga0182038_118497461 | 3300016445 | Soil | MRQASRDAATPVTRLVELPGRGVARVWECAGPCGAETLMLI |
| Ga0187807_10679741 | 3300017926 | Freshwater Sediment | VRQVLGDTAALTRLVELPGRGVTRVWECAGPPGAEPL |
| Ga0187809_104353681 | 3300017937 | Freshwater Sediment | VLQLPQEAAAPQTRLVELPGRGVTRVWECAGPPGTP |
| Ga0187879_104408792 | 3300017946 | Peatland | MFVVREAAVPRTRVVELPGRGMTRVWECAGPPGAETLMLIHGVA |
| Ga0187879_107628921 | 3300017946 | Peatland | VRQVLGEEATPRTRLVELPGRGVTRVWECAGPPGAETLMLIHG |
| Ga0187778_104101032 | 3300017961 | Tropical Peatland | VVQQVLEDAVAPVTRMVELPGRGVTRVWECAGPHGAEHGRER |
| Ga0187776_101025863 | 3300017966 | Tropical Peatland | VRRVLGEAAAPLTRLVELPGRGATRVWECPGPRRAETLILI |
| Ga0187781_112744862 | 3300017972 | Tropical Peatland | VQQLPGEQTAPFTRLVEVPGRGVTRVWECAGPPGA |
| Ga0187777_107585921 | 3300017974 | Tropical Peatland | VRQVHEDAVAPVTRLVELPGRGVTRVRECAGPPGAGTLMLIHGVA |
| Ga0187857_105527431 | 3300018026 | Peatland | MFVVREATVPRTRVVELPGRGMTRVWECAGPRGAETV |
| Ga0187883_107342312 | 3300018037 | Peatland | VRQVLGEEATPRTRLVELPGRGVTRVWECAGPPGAETLM |
| Ga0187855_102854481 | 3300018038 | Peatland | VQRVPGECAFPVTRLVDLPGRGTTRVWECAGPRGAETLMLIH |
| Ga0187766_100623523 | 3300018058 | Tropical Peatland | VRQALRETTIPSARLVELPGRGVTRVWEGAGPPGAQ |
| Ga0187766_106581471 | 3300018058 | Tropical Peatland | VVRRVLGAAATPLTRLVELPGRGATRVWECPGPRRAETLMLIHG |
| Ga0187765_101872311 | 3300018060 | Tropical Peatland | VRQLLGEAANPHTRLVELPGRGVTRVWEYAGPRDAETLMLIHGVTFTAELN |
| Ga0193751_11957021 | 3300019888 | Soil | VRQVPGAPATPRTRLAELPGRGVTRVWECTGPPGAETLMLIHGVTFTA |
| Ga0210400_103332503 | 3300021170 | Soil | VRQVLGEAAAPATRLIELPGRGVTRVWECAGPPGAESLM |
| Ga0210396_113161792 | 3300021180 | Soil | VLQLPQEAPAPQTRLVELPGRGVTRIWECAGPPDAPTLMLIH |
| Ga0210388_103616831 | 3300021181 | Soil | VRQVLGEAAAPLTRLAELPGRGVTRIWECAGPPGAQTLMLIHGVTFTAEL |
| Ga0213875_100368663 | 3300021388 | Plant Roots | VVVRQLPGELPAPRTRLVELPGRGITRVWECSGPPAAPVLMLIHG |
| Ga0210389_107384282 | 3300021404 | Soil | VRQVLGKAAAPRTRLVELPGRGVTRVWECTGPRGAPTLMLI |
| Ga0210389_114575971 | 3300021404 | Soil | MPFTRLVELPGRGTTRVWECAGPGGAETLMLIHGV |
| Ga0210383_101948953 | 3300021407 | Soil | VRQVLGEATAPLTRLAELPGRGVTRIWECAGPPGAQTLMLIHGVTFT |
| Ga0126371_125940451 | 3300021560 | Tropical Forest Soil | MRRVLGEAETPLTRLVELPGRGVTRVWECPGPRRAETLMLIHGVAV |
| Ga0208714_10260173 | 3300025527 | Arctic Peat Soil | VRQVLGEAAAPLTRLVELPGRGVTRVWECAGPPGAET |
| Ga0207692_106811472 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | VRQVAGMVATAGTRLVELPGRGVTRVWECPGPRGAETLMLIHG |
| Ga0207685_106813941 | 3300025905 | Corn, Switchgrass And Miscanthus Rhizosphere | VRQTPGKASTPRTRLVELPGRGVTRVWECAGPPGAGTLVLIH |
| Ga0207652_110071001 | 3300025921 | Corn Rhizosphere | VRQVPVEAVAPVTRLAVLPGRGATRVWECAGPRGAETLMLIHGVSFTAEL |
| Ga0207694_110065432 | 3300025924 | Corn Rhizosphere | VRQVAGMVATAGTRLVELPGRGVTRVWECPGPRGAETLMLIHGVTFTA |
| Ga0207664_114068101 | 3300025929 | Agricultural Soil | VRQVLGKAAAPRTRLVELPGRGVTRVWECTGPRGAPTLMLIHG |
| Ga0207667_121518411 | 3300025949 | Corn Rhizosphere | VRQVPGKAATPRTRLVELPGRGVTRVWECTGPCGAPTLML |
| Ga0207677_105592581 | 3300026023 | Miscanthus Rhizosphere | MVATAGTRLVELPGRGVTRVWECPGPHGAETLMLIHG |
| Ga0257146_10789021 | 3300026374 | Soil | VVRRVAGEAATPLTRLVELPGRGATRVWECPGPRR |
| Ga0209116_10178771 | 3300027590 | Forest Soil | VRQVLQQAAAAQTRLVELPGRGVTRVWELTGPPGAETLM |
| Ga0209333_11054242 | 3300027676 | Forest Soil | VRRVSEETANPVVTRLIELPGRGVTRVWECAGPPGAETLILIHGVAIT |
| Ga0209039_100224904 | 3300027825 | Bog Forest Soil | VLGEATAPLTRLVELPGRGVTRVWECAGPPGAETL |
| Ga0209169_102680291 | 3300027879 | Soil | VRQVLEEATAPLSRLVVLPGRGAMRVWECAGPPGADTLVLIHG |
| Ga0209068_109197501 | 3300027894 | Watersheds | VMHLPQEAATPQTRLVKLPGRGVTRVWECAGPPGAPTLMLIHG |
| Ga0209698_110452632 | 3300027911 | Watersheds | VLGEASLRQVLGEAEAPVTRLVELPGRGVTRVWECA |
| Ga0307295_101579111 | 3300028708 | Soil | VRQVPGEAATSRTRLVELPGRGVTRVWECPGPRGAETLMLIHGV |
| Ga0302226_101613711 | 3300028801 | Palsa | VRSEPDESETPVTRLVELPGRGTTRVWECAGPRDAETLVLI |
| Ga0302235_103871943 | 3300028877 | Palsa | VRPVPLDSATPVTRLVHLPGRGTTRVWECAGPPGAETLVLIH |
| Ga0311340_104558851 | 3300029943 | Palsa | LRVVPGESAAPVTRLVNLPGRGTTRVWECAGPRDAGTLVLIHGVT |
| Ga0302302_13489651 | 3300029997 | Palsa | LRAVPGESAAPVTRLVNLPGRGTTRVWECAGPRDAGTLVLIHGV |
| Ga0302176_100463261 | 3300030057 | Palsa | VRQVLGEEVTPRTRLVELPGRGVTRVWECAGPPGAETL |
| Ga0311353_106124361 | 3300030399 | Palsa | VRQVLQQAAAAQTRLVELPGRGVTRVWELTGPPGAETLMLIHGVTFT |
| Ga0302183_102560561 | 3300030509 | Palsa | VLQVLGEEATPLTRLVELPGRGVTRVWECAGPPGAETLMLIH |
| Ga0311356_115380331 | 3300030617 | Palsa | VWAVPGESATPVSWLVDLPGRGTTRVWECAGPRGAETLVL |
| Ga0302314_113267002 | 3300030906 | Palsa | VRQVLQQAAAAQTRLVELPGRGVTRVWELTGPPGAETLMLIHGVMFT |
| Ga0302324_1020882991 | 3300031236 | Palsa | MLTEAAVPLTRLVELPGRGTTRVWECPGPRGAETVVL |
| Ga0170819_148217611 | 3300031469 | Forest Soil | VVVRDLPGEPQAPRTRLMELPGRGATRIWECAGPP |
| Ga0318571_104120791 | 3300031549 | Soil | VRQATAKAATPRTRLVELPGRGVTRVWECTGPRGAETLMLIH |
| Ga0318572_109268842 | 3300031681 | Soil | VRQVPREAATPVTRLVELPGRGTTRVWECAGPRGAETLM |
| Ga0310813_123129681 | 3300031716 | Soil | VRQVPGKAATPRTSLVELPGRGVTRVWECPGPRGAETLMLIHGVTF |
| Ga0318493_106436992 | 3300031723 | Soil | VRQVPEQVATPLTRLAELPGRGVTRMWECGGPPGAETLIMIHGVTFT |
| Ga0318500_105860211 | 3300031724 | Soil | VLQLPQEAAVPETRLVELPGRGVTRVWECAGPPAAPTVM |
| Ga0318502_106378451 | 3300031747 | Soil | MRQAPRETATPLTRLVELPGRGVTPVWECAGPRDAQTLM |
| Ga0318492_101144623 | 3300031748 | Soil | VLQLPPETAAPRTRLVELPGRGVTRVWECAGPPGAPA |
| Ga0318492_101847652 | 3300031748 | Soil | MRQASRDAATPVTRLVELPGRGVARVWECAGPCGAETLMLIHGVT |
| Ga0318494_104647421 | 3300031751 | Soil | VRQVPGKAATPHTRLVELPGRGVTRVWECAGPPAAETLMLIHGVT |
| Ga0318498_102567041 | 3300031778 | Soil | VVRRVIGETAEGPSARLVELPGRGATRVWECAGPRGA |
| Ga0318548_102171681 | 3300031793 | Soil | VLQLPQEAAVPETRLVELPGRGVTRVWECAGPPAAP |
| Ga0318576_100098644 | 3300031796 | Soil | VLQLPPETAAPRTRLVELPGRGVTRVWECAGPPGAPALM |
| Ga0307473_105782901 | 3300031820 | Hardwood Forest Soil | VRQVAGMVATAGTRLVELPGRGVTRVWECPGPRGAETLMLIHGVTF |
| Ga0318499_102356842 | 3300031832 | Soil | VLQLPQEAAVPETRLVELPGRGVTRVWECAGPPAAPTVMLIH |
| Ga0310917_109411561 | 3300031833 | Soil | MRQASRDAATPVTRLVELPGRGVARVWECAGPCGAETLMLIHGVTVTAE |
| Ga0318511_100847791 | 3300031845 | Soil | VLQLPQEAAVPETRLVELPGRGVTRVWECAGPPAAPTLMLIH |
| Ga0318511_101656641 | 3300031845 | Soil | VRQVPGKAATPLTRLVELPGRGVTRVWECAGPRDAETLMLIHGVT |
| Ga0318527_101798852 | 3300031859 | Soil | VRQVPREAATPVTRLVDLPGRGVTRVWECPGPRGAETLMLIH |
| Ga0318495_104844522 | 3300031860 | Soil | VVRRVIGETAEGPSARLVELPGRGATRVWECAGPRGAGTLVL |
| Ga0306925_104276103 | 3300031890 | Soil | VRQVPGKAATPHTRLVELPGRGVTQVWECAGPPAAETLMLIHGVT |
| Ga0306925_111007342 | 3300031890 | Soil | VVRRVIGETAEGPSARLVELPGRGATRVWECAGPRGAGTLV |
| Ga0306921_122121772 | 3300031912 | Soil | VRQVPEQVATPLTRLTELPGRGVTRMWECGGPPGAQTL |
| Ga0308175_1020093191 | 3300031938 | Soil | VRQVPGDAATSRTRLVELPGRGVTRVWECPGPRGAETLMLIHGVTFTAE |
| Ga0310909_111313741 | 3300031947 | Soil | MRQAPRETATPLTRLVELPGRGVTPVWECAGPRDAQTLMLIHGLAATA |
| Ga0318531_102444302 | 3300031981 | Soil | VVRRVLGETAEAPSARLVELPGRGATRVWECAGPRGAG |
| Ga0318569_104640032 | 3300032010 | Soil | VRQVPEQVATPLTRLAELPGRGVTRMWECGGPPGAET |
| Ga0318559_102181881 | 3300032039 | Soil | MRQAPRETATPLTRLVELPGRGVTPVWECAGPRDAQTLMLIHGLA |
| Ga0318556_106211682 | 3300032043 | Soil | VRQVPEQVATPLTRLAELPGRGVTRMWECGGPPGAE |
| Ga0318553_102645401 | 3300032068 | Soil | MRQAPRETATPLTRLVELPGRGVTPVWECAGPRDAQTLMLIHG |
| Ga0311301_122325541 | 3300032160 | Peatlands Soil | VLQLPQEAATPQTRLVELPGRGVTRVWECAGPPGAPTLM |
| Ga0311301_130323612 | 3300032160 | Peatlands Soil | VLGEAMLGEATAPLTRLVELPGRGVTRVWECAGPPGAQTLVLIHGVAF |
| Ga0335079_105796051 | 3300032783 | Soil | VVRRVLGEAVTPLTRLVELPGRGATRVWECPGPRRADTLMLI |
| Ga0335081_104215612 | 3300032892 | Soil | VRQVLTEAAAPVTRLVTLPGRGVTRVWECAGPPGAPALMLI |
| Ga0335083_105113671 | 3300032954 | Soil | VRQVPEPVATPLTRLAELPGRGVTRMWECGGPPGAQTLILIHGVTFTAEL |
| Ga0314866_056193_1_138 | 3300033807 | Peatland | MLQLVKEPAGPLTRLAELPGRGTMRVWDCAGPPGAETLILIHGVAC |
| ⦗Top⦘ |