| Basic Information | |
|---|---|
| Family ID | F061140 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 132 |
| Average Sequence Length | 49 residues |
| Representative Sequence | MHVNDVFDIIGGILTIALVAVFLTKPNTASDVNAAGGQFTGALKQAEAG |
| Number of Associated Samples | 101 |
| Number of Associated Scaffolds | 131 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 87.12 % |
| % of genes near scaffold ends (potentially truncated) | 12.88 % |
| % of genes from short scaffolds (< 2000 bps) | 59.09 % |
| Associated GOLD sequencing projects | 85 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.44 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (49.242 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere (15.152 % of family members) |
| Environment Ontology (ENVO) | Unclassified (23.485 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (41.667 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 54.55% β-sheet: 0.00% Coil/Unstructured: 45.45% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.44 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 131 Family Scaffolds |
|---|---|---|
| PF00041 | fn3 | 7.63 |
| PF01476 | LysM | 3.82 |
| PF11195 | DUF2829 | 2.29 |
| PF00534 | Glycos_transf_1 | 2.29 |
| PF00877 | NLPC_P60 | 2.29 |
| PF13481 | AAA_25 | 1.53 |
| PF01183 | Glyco_hydro_25 | 0.76 |
| PF13692 | Glyco_trans_1_4 | 0.76 |
| PF09458 | H_lectin | 0.76 |
| PF04191 | PEMT | 0.76 |
| PF03793 | PASTA | 0.76 |
| PF08774 | VRR_NUC | 0.76 |
| PF05345 | He_PIG | 0.76 |
| PF00589 | Phage_integrase | 0.76 |
| PF13495 | Phage_int_SAM_4 | 0.76 |
| COG ID | Name | Functional Category | % Frequency in 131 Family Scaffolds |
|---|---|---|---|
| COG0791 | Cell wall-associated hydrolase, NlpC_P60 family | Cell wall/membrane/envelope biogenesis [M] | 2.29 |
| COG3757 | Lyzozyme M1 (1,4-beta-N-acetylmuramidase), GH25 family | Cell wall/membrane/envelope biogenesis [M] | 0.76 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 54.55 % |
| Unclassified | root | N/A | 45.45 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000651|AP72_2010_repI_A10DRAFT_1005948 | All Organisms → Viruses → Predicted Viral | 1640 | Open in IMG/M |
| 3300000893|AP72_2010_repI_A001DRAFT_1069346 | Not Available | 555 | Open in IMG/M |
| 3300002910|JGI25615J43890_1001764 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 3007 | Open in IMG/M |
| 3300003322|rootL2_10349116 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 2038 | Open in IMG/M |
| 3300003323|rootH1_10094314 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 18123 | Open in IMG/M |
| 3300004457|Ga0066224_1148747 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 737 | Open in IMG/M |
| 3300005434|Ga0070709_10002441 | All Organisms → cellular organisms → Bacteria | 10068 | Open in IMG/M |
| 3300005434|Ga0070709_10050946 | Not Available | 2596 | Open in IMG/M |
| 3300005435|Ga0070714_100001053 | All Organisms → cellular organisms → Bacteria | 19689 | Open in IMG/M |
| 3300005435|Ga0070714_100001121 | All Organisms → cellular organisms → Bacteria | 19250 | Open in IMG/M |
| 3300005435|Ga0070714_100002557 | All Organisms → cellular organisms → Bacteria | 13397 | Open in IMG/M |
| 3300005435|Ga0070714_100021833 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 5241 | Open in IMG/M |
| 3300005435|Ga0070714_100404699 | Not Available | 1291 | Open in IMG/M |
| 3300005436|Ga0070713_100022511 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 4871 | Open in IMG/M |
| 3300005436|Ga0070713_100040884 | All Organisms → Viruses → Predicted Viral | 3773 | Open in IMG/M |
| 3300005436|Ga0070713_100105222 | Not Available | 2451 | Open in IMG/M |
| 3300005436|Ga0070713_100527538 | Not Available | 1116 | Open in IMG/M |
| 3300005436|Ga0070713_102038552 | Not Available | 556 | Open in IMG/M |
| 3300005437|Ga0070710_10061813 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 2134 | Open in IMG/M |
| 3300005444|Ga0070694_100339199 | Not Available | 1161 | Open in IMG/M |
| 3300005458|Ga0070681_10225175 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 1790 | Open in IMG/M |
| 3300005529|Ga0070741_10008095 | All Organisms → cellular organisms → Bacteria | 21299 | Open in IMG/M |
| 3300005529|Ga0070741_10014945 | All Organisms → cellular organisms → Bacteria | 13299 | Open in IMG/M |
| 3300005530|Ga0070679_100342386 | Not Available | 1443 | Open in IMG/M |
| 3300005534|Ga0070735_10112118 | All Organisms → Viruses → Predicted Viral | 1709 | Open in IMG/M |
| 3300005535|Ga0070684_100181230 | Not Available | 1915 | Open in IMG/M |
| 3300005537|Ga0070730_10287280 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 1079 | Open in IMG/M |
| 3300005538|Ga0070731_10329884 | All Organisms → Viruses → Predicted Viral | 1013 | Open in IMG/M |
| 3300005545|Ga0070695_101493307 | Not Available | 562 | Open in IMG/M |
| 3300005563|Ga0068855_100007384 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 13306 | Open in IMG/M |
| 3300005569|Ga0066705_10020283 | Not Available | 3411 | Open in IMG/M |
| 3300005614|Ga0068856_100002300 | All Organisms → cellular organisms → Bacteria | 19701 | Open in IMG/M |
| 3300005614|Ga0068856_100557397 | Not Available | 1167 | Open in IMG/M |
| 3300005712|Ga0070764_10863130 | Not Available | 565 | Open in IMG/M |
| 3300006052|Ga0075029_100329172 | Not Available | 980 | Open in IMG/M |
| 3300006175|Ga0070712_100069109 | All Organisms → Viruses → Predicted Viral | 2519 | Open in IMG/M |
| 3300006175|Ga0070712_101009314 | Not Available | 720 | Open in IMG/M |
| 3300009012|Ga0066710_100403913 | Not Available | 2037 | Open in IMG/M |
| 3300009137|Ga0066709_100093946 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 3643 | Open in IMG/M |
| 3300009525|Ga0116220_10021582 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 2601 | Open in IMG/M |
| 3300009698|Ga0116216_10362965 | Not Available | 880 | Open in IMG/M |
| 3300009808|Ga0105071_1017268 | Not Available | 1006 | Open in IMG/M |
| 3300010048|Ga0126373_10774666 | Not Available | 1020 | Open in IMG/M |
| 3300010048|Ga0126373_11369237 | Not Available | 773 | Open in IMG/M |
| 3300010048|Ga0126373_12207452 | Not Available | 612 | Open in IMG/M |
| 3300010373|Ga0134128_10094628 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 3398 | Open in IMG/M |
| 3300010379|Ga0136449_103592515 | Not Available | 588 | Open in IMG/M |
| 3300010869|Ga0126359_1047267 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Rugosimonospora → Rugosimonospora africana | 3363 | Open in IMG/M |
| 3300011070|Ga0138567_1061302 | Not Available | 565 | Open in IMG/M |
| 3300011332|Ga0126317_10284536 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 3797 | Open in IMG/M |
| 3300012206|Ga0137380_10003171 | All Organisms → cellular organisms → Bacteria | 14268 | Open in IMG/M |
| 3300012209|Ga0137379_10002303 | All Organisms → cellular organisms → Bacteria | 17714 | Open in IMG/M |
| 3300012353|Ga0137367_11161310 | Not Available | 518 | Open in IMG/M |
| 3300013296|Ga0157374_10158478 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 2204 | Open in IMG/M |
| 3300017959|Ga0187779_10035713 | All Organisms → Viruses → Predicted Viral | 2872 | Open in IMG/M |
| 3300017961|Ga0187778_10864907 | Not Available | 620 | Open in IMG/M |
| 3300017973|Ga0187780_10913983 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 637 | Open in IMG/M |
| 3300017973|Ga0187780_11221589 | Not Available | 551 | Open in IMG/M |
| 3300017975|Ga0187782_11278008 | Not Available | 575 | Open in IMG/M |
| 3300018001|Ga0187815_10027446 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 2419 | Open in IMG/M |
| 3300020069|Ga0197907_10689188 | Not Available | 580 | Open in IMG/M |
| 3300020080|Ga0206350_10558937 | Not Available | 922 | Open in IMG/M |
| 3300020081|Ga0206354_10128145 | Not Available | 538 | Open in IMG/M |
| 3300021178|Ga0210408_10509408 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 956 | Open in IMG/M |
| 3300021404|Ga0210389_10049851 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 3211 | Open in IMG/M |
| 3300021406|Ga0210386_10025339 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 4642 | Open in IMG/M |
| 3300021475|Ga0210392_10229138 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 1308 | Open in IMG/M |
| 3300021560|Ga0126371_10171437 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 2247 | Open in IMG/M |
| 3300022525|Ga0242656_1042627 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 765 | Open in IMG/M |
| 3300022530|Ga0242658_1024885 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 1113 | Open in IMG/M |
| 3300022718|Ga0242675_1022633 | Not Available | 897 | Open in IMG/M |
| 3300024232|Ga0247664_1115975 | Not Available | 623 | Open in IMG/M |
| 3300025898|Ga0207692_10210112 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 1149 | Open in IMG/M |
| 3300025906|Ga0207699_10001357 | All Organisms → cellular organisms → Bacteria | 11640 | Open in IMG/M |
| 3300025910|Ga0207684_10002416 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 18842 | Open in IMG/M |
| 3300025915|Ga0207693_10306811 | Not Available | 1243 | Open in IMG/M |
| 3300025928|Ga0207700_10001568 | All Organisms → cellular organisms → Bacteria | 12968 | Open in IMG/M |
| 3300025928|Ga0207700_10018239 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 4711 | Open in IMG/M |
| 3300025928|Ga0207700_10229806 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 1576 | Open in IMG/M |
| 3300025928|Ga0207700_11110892 | Not Available | 707 | Open in IMG/M |
| 3300025929|Ga0207664_10016945 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 5329 | Open in IMG/M |
| 3300025929|Ga0207664_10089188 | Not Available | 2525 | Open in IMG/M |
| 3300025949|Ga0207667_10003580 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 19198 | Open in IMG/M |
| 3300026078|Ga0207702_10002009 | All Organisms → cellular organisms → Bacteria | 19718 | Open in IMG/M |
| 3300026078|Ga0207702_10006415 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 10148 | Open in IMG/M |
| 3300026304|Ga0209240_1000939 | All Organisms → cellular organisms → Bacteria | 11774 | Open in IMG/M |
| 3300026475|Ga0257147_1005548 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 1557 | Open in IMG/M |
| 3300026514|Ga0257168_1000013 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 8420 | Open in IMG/M |
| 3300026530|Ga0209807_1029338 | All Organisms → cellular organisms → Bacteria | 2649 | Open in IMG/M |
| 3300026557|Ga0179587_10490740 | Not Available | 805 | Open in IMG/M |
| 3300027273|Ga0209886_1021891 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 957 | Open in IMG/M |
| 3300027273|Ga0209886_1086733 | Not Available | 505 | Open in IMG/M |
| 3300027496|Ga0208987_1028933 | Not Available | 969 | Open in IMG/M |
| 3300027496|Ga0208987_1108268 | Not Available | 507 | Open in IMG/M |
| 3300027528|Ga0208985_1001239 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 4169 | Open in IMG/M |
| 3300027590|Ga0209116_1021430 | Not Available | 1338 | Open in IMG/M |
| 3300027857|Ga0209166_10721422 | Not Available | 501 | Open in IMG/M |
| 3300027869|Ga0209579_10325857 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 829 | Open in IMG/M |
| 3300027895|Ga0209624_10617554 | Not Available | 718 | Open in IMG/M |
| 3300028552|Ga0302149_1166978 | Not Available | 574 | Open in IMG/M |
| 3300028881|Ga0307277_10577135 | Not Available | 505 | Open in IMG/M |
| 3300030007|Ga0311338_11407433 | Not Available | 648 | Open in IMG/M |
| 3300030056|Ga0302181_10307022 | Not Available | 703 | Open in IMG/M |
| 3300030494|Ga0310037_10312558 | Not Available | 667 | Open in IMG/M |
| 3300030743|Ga0265461_14013906 | Not Available | 501 | Open in IMG/M |
| 3300030937|Ga0138302_1718501 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 1039 | Open in IMG/M |
| 3300031022|Ga0138301_1213483 | Not Available | 639 | Open in IMG/M |
| 3300031231|Ga0170824_107365461 | Not Available | 761 | Open in IMG/M |
| 3300031234|Ga0302325_11228768 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 994 | Open in IMG/M |
| 3300031234|Ga0302325_11228768 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 994 | Open in IMG/M |
| 3300031236|Ga0302324_103173699 | Not Available | 542 | Open in IMG/M |
| 3300031446|Ga0170820_11222109 | Not Available | 601 | Open in IMG/M |
| 3300031474|Ga0170818_112976359 | Not Available | 540 | Open in IMG/M |
| 3300031670|Ga0307374_10548507 | Not Available | 604 | Open in IMG/M |
| 3300031708|Ga0310686_111644815 | Not Available | 737 | Open in IMG/M |
| 3300031708|Ga0310686_119083747 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 732 | Open in IMG/M |
| 3300031718|Ga0307474_10188782 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 1566 | Open in IMG/M |
| 3300032160|Ga0311301_10266143 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 2800 | Open in IMG/M |
| 3300032783|Ga0335079_10231558 | Not Available | 2039 | Open in IMG/M |
| 3300032805|Ga0335078_10027073 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 8504 | Open in IMG/M |
| 3300032893|Ga0335069_10036863 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Rugosimonospora → Rugosimonospora africana | 6564 | Open in IMG/M |
| 3300032893|Ga0335069_10114830 | All Organisms → Viruses → Predicted Viral | 3382 | Open in IMG/M |
| 3300032893|Ga0335069_10300582 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 1910 | Open in IMG/M |
| 3300032895|Ga0335074_10288002 | Not Available | 1890 | Open in IMG/M |
| 3300032895|Ga0335074_11035794 | Not Available | 718 | Open in IMG/M |
| 3300032896|Ga0335075_10025039 | All Organisms → cellular organisms → Bacteria | 8712 | Open in IMG/M |
| 3300032896|Ga0335075_10185116 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 2522 | Open in IMG/M |
| 3300032896|Ga0335075_10318984 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 1720 | Open in IMG/M |
| 3300032896|Ga0335075_10899889 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 811 | Open in IMG/M |
| 3300032898|Ga0335072_10764962 | Not Available | 931 | Open in IMG/M |
| 3300032898|Ga0335072_11506983 | Not Available | 574 | Open in IMG/M |
| 3300033412|Ga0310810_10054591 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 4859 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 15.15% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 9.85% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 9.85% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 5.30% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 5.30% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 4.55% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 4.55% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 3.79% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 3.79% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 3.79% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 3.79% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.03% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 3.03% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 3.03% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 3.03% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 2.27% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 2.27% |
| Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 2.27% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 1.52% |
| Sugarcane Root And Bulk Soil | Host-Associated → Plants → Rhizome → Unclassified → Unclassified → Sugarcane Root And Bulk Soil | 1.52% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.76% |
| Soil | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil | 0.76% |
| Marine | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine | 0.76% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.76% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.76% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.76% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 0.76% |
| Soil | Environmental → Terrestrial → Soil → Clay → Unclassified → Soil | 0.76% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 0.76% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.76% |
| Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 0.76% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000651 | Forest soil microbial communities from Amazon forest - Pasture72 2010 replicate I A10 | Environmental | Open in IMG/M |
| 3300000893 | Forest soil microbial communities from Amazon forest - Pasture72 2010 replicate I A001 | Environmental | Open in IMG/M |
| 3300002910 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_80cm | Environmental | Open in IMG/M |
| 3300003322 | Sugarcane root Sample L2 | Host-Associated | Open in IMG/M |
| 3300003323 | Sugarcane root Sample H1 | Host-Associated | Open in IMG/M |
| 3300004457 | Marine viral communities from Newfoundland, Canada MC-1 | Environmental | Open in IMG/M |
| 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
| 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
| 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
| 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Environmental | Open in IMG/M |
| 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Environmental | Open in IMG/M |
| 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Environmental | Open in IMG/M |
| 3300005529 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1 | Environmental | Open in IMG/M |
| 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Environmental | Open in IMG/M |
| 3300005534 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 | Environmental | Open in IMG/M |
| 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Environmental | Open in IMG/M |
| 3300005537 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 | Environmental | Open in IMG/M |
| 3300005538 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 | Environmental | Open in IMG/M |
| 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Environmental | Open in IMG/M |
| 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Host-Associated | Open in IMG/M |
| 3300005569 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 | Environmental | Open in IMG/M |
| 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Host-Associated | Open in IMG/M |
| 3300005712 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 | Environmental | Open in IMG/M |
| 3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009525 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_7_NC metaG | Environmental | Open in IMG/M |
| 3300009698 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG | Environmental | Open in IMG/M |
| 3300009808 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N2_40_50 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300010869 | Boreal forest soil eukaryotic communities from Alaska, USA - W4-4 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300011070 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 52 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011332 | Soil microbial communities from California, USA to study soil gas exchange rates - SR-CA-SC2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012353 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
| 3300017959 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG | Environmental | Open in IMG/M |
| 3300017961 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MG | Environmental | Open in IMG/M |
| 3300017973 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MG | Environmental | Open in IMG/M |
| 3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018001 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_5 | Environmental | Open in IMG/M |
| 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
| 3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
| 3300021475 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300022525 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-4-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022530 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-30-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022718 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300024232 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK05 | Environmental | Open in IMG/M |
| 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_80cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026475 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - CO-12-A | Environmental | Open in IMG/M |
| 3300026514 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DL-13-B | Environmental | Open in IMG/M |
| 3300026530 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 (SPAdes) | Environmental | Open in IMG/M |
| 3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300027273 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N2_40_50 (SPAdes) | Environmental | Open in IMG/M |
| 3300027496 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027528 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA Ref_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027590 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027857 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027869 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027895 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028552 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N1_1 | Environmental | Open in IMG/M |
| 3300028881 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_116 | Environmental | Open in IMG/M |
| 3300030007 | I_Palsa_E1 coassembly | Environmental | Open in IMG/M |
| 3300030056 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_3 | Environmental | Open in IMG/M |
| 3300030494 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG (v2) | Environmental | Open in IMG/M |
| 3300030743 | Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada VCO Co-assembly | Environmental | Open in IMG/M |
| 3300030937 | Forest soil microbial communities from Spain - ITS-tags Site 9-Mixed-thinned forest site A4_MS_spring Metatranscriptome (Eukaryote Community Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300031022 | Forest soil microbial communities from Spain - ITS-tags Site 9-Mixed-thinned forest site A3_MS_spring Metatranscriptome (Eukaryote Community Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031234 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2 | Environmental | Open in IMG/M |
| 3300031236 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1 | Environmental | Open in IMG/M |
| 3300031446 | Fir Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031474 | Fir Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031670 | Soil microbial communities from Risofladan, Vaasa, Finland - OX-3 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
| 3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
| 3300032893 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1 | Environmental | Open in IMG/M |
| 3300032895 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.3 | Environmental | Open in IMG/M |
| 3300032896 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.4 | Environmental | Open in IMG/M |
| 3300032898 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.1 | Environmental | Open in IMG/M |
| 3300033412 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NC | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| AP72_2010_repI_A10DRAFT_10059482 | 3300000651 | Forest Soil | MHVNTIMDIFGGVLTIALVATILTKPNTAADVNAAGNQFTGALKQAEAG* |
| AP72_2010_repI_A001DRAFT_10693464 | 3300000893 | Forest Soil | MHVNTIMDIFGGVLTIALVATILTKPNTAADVNAAGNQFTGALKQ |
| JGI25615J43890_10017642 | 3300002910 | Grasslands Soil | MHVNDIFDIFGALLVIALVAVILTKKNTARDVSAAGHTFTGALAQAQKG* |
| rootL2_103491161 | 3300003322 | Sugarcane Root And Bulk Soil | MKVNDFFDVLGGILTIALVATILSKPNTARDIQAAGAAFTGAIREAQS* |
| rootH1_1009431422 | 3300003323 | Sugarcane Root And Bulk Soil | MKVNDFFDVLGGILTIALVATILSKPNTANDIKAAGAAFTGAIREAQS* |
| Ga0066224_11487471 | 3300004457 | Marine | MNVNDIWDIFGGILVLALVATILTKPNTASDVNAAGNAFTGAIKAS |
| Ga0070709_100024413 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | VEVNDFFDIVGGLLTIALVAVILTKPNTAADINAAGSQFTAALREAQSG* |
| Ga0070709_100509463 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | MHIDDIFDIFGGLLTIALVAVFLTKPNTAADINAAGSQFTGALKQAQAGQ* |
| Ga0070714_10000105318 | 3300005435 | Agricultural Soil | MEVNDFFDIVGGLLTIALVAVVLTKPNTAADINAAGNQFTSALREAQSG* |
| Ga0070714_1000011218 | 3300005435 | Agricultural Soil | MDVHDFWSVIGGILTIALVATILTKPNTAADLNAAGSAFNGALHAAEAGS* |
| Ga0070714_10000255723 | 3300005435 | Agricultural Soil | MDVHDIWSVIGGILTIALVATILTKPNTAQDISAAGSSFTGALRAAEAGSG* |
| Ga0070714_1000218338 | 3300005435 | Agricultural Soil | MSVQNFFDIIGGLLTLALVAVILTKPNTASDINAAGNQFTGALKVAQAG* |
| Ga0070714_1004046992 | 3300005435 | Agricultural Soil | MSVQNFFDIIGALLTIALVAVILTKPNTASDINAAGGQFSGALKVAEAG* |
| Ga0070713_1000225116 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | MEVNDFFDIVGGILTIALVATILTKPNTASDINAAGNQFSAALREAQSG* |
| Ga0070713_1000408847 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | VNVNDIWDIFGGILILALVATILTKPNTAKDVQAAGSAFSGAIKTAEAG* |
| Ga0070713_1001052221 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | IFDIFGGLLTIALVAVFLTKPNTAADINAAGSQFTGALKQAQAGQ* |
| Ga0070713_1005275382 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | VQNFFDIIGALLTIALVAVILTKPNTASDINAAGGQFSGALKVAEAG* |
| Ga0070713_1020385523 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | MHIDDIFDIFGGLLTIALVAVFLTKPNTAADINAAGSQFTGA |
| Ga0070710_100618132 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | MNVNDIWDIFGGILLLALVATILTKPNTAKDVQAAGSAFSGSIRAAEAG* |
| Ga0070694_1003391992 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | MKVNDFFDVLGGILTIALVATILTKPNTARDIKAAGDAFTGAIREAQS* |
| Ga0070681_102251754 | 3300005458 | Corn Rhizosphere | MQVNDIFDIVGGLLTIALVAVILTKPNTAADINAAGSQFTGALRQAQAG* |
| Ga0070741_1000809521 | 3300005529 | Surface Soil | MQVNDFFDIFGGLLTLALVATILTKPNTAADVNAVGSQFTGALRQAEAG* |
| Ga0070741_1001494524 | 3300005529 | Surface Soil | MHVNDWFDIIGGLLTIALVATILTKPNTKGDIQAAGSAFTGALKQAEAG* |
| Ga0070679_1003423861 | 3300005530 | Corn Rhizosphere | NDIFDIVGGLLTIALVAVILTKPNTAADINAAGSQFTGALRQAQAG* |
| Ga0070735_101121181 | 3300005534 | Surface Soil | AARSEADPVKVEDVFDIIGGLLTIALVAVFLTKPNTASDVNAVGNQFSGALKTAEAG* |
| Ga0070684_1001812304 | 3300005535 | Corn Rhizosphere | MKVNDLFDIFGGLLALALVAVFLTKQNTAKDVNAVGNQFTGALKQAEAG* |
| Ga0070730_102872801 | 3300005537 | Surface Soil | MNVNDFWDIIGGILVLALVATVLTKPNTAGDINAAGGQFTGALKA |
| Ga0070731_103298842 | 3300005538 | Surface Soil | MQVNDIFDIFGGLLIIALAAVFFTKPNTAQDVNAVGNQFTGALKQAEAG* |
| Ga0070695_1014933072 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | TPMKVNDFFDVLGGILTIALVATILSKPNTANDIKAAGAAFTGAIREAQS* |
| Ga0068855_1000073844 | 3300005563 | Corn Rhizosphere | MKVNDFFDVLGGILTIALVATILSKPNTANDIKAAGAAFTGAIKEAQS* |
| Ga0066705_100202833 | 3300005569 | Soil | VQVNDFFDIVGGLLTIALVATILTKPNTASDINAAGNQFTSALKAAQSG* |
| Ga0068856_10000230023 | 3300005614 | Corn Rhizosphere | MKVNTIFDIFGAMFTLALVAVFFTKPNTAADVNAVGNQFTGALRVAEAG* |
| Ga0068856_1005573974 | 3300005614 | Corn Rhizosphere | VHPNDVFDIIGGLLTIALVAVFLTKPNTAKDVNAVGTQFTGALKQAQAG* |
| Ga0070764_108631303 | 3300005712 | Soil | MHVGDVFDIFGGLLTLAIIATILTKSNTASDINAAGTTFGGAIKDAEAG* |
| Ga0075029_1003291722 | 3300006052 | Watersheds | MNVNDIWDIFGGILVLALVATILTKQNTASDVNAAGSAFTGAIKQAQAG* |
| Ga0070712_1000691096 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | VKVEDVFDIIGGLLTIALVAVFLSKPNTASDVNAVGNQFSGALKQAEAG* |
| Ga0070712_1010093144 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | MHVNDFFDIIGGLLTLALVAVFFTKPNTASDVNAVGNQFTGALKAAEAG* |
| Ga0066710_1004039133 | 3300009012 | Grasslands Soil | MQVNDVFDIIGGLLTIALVATILTKPNTASDINAAGSNFTAALKQAQAG |
| Ga0066709_1000939464 | 3300009137 | Grasslands Soil | MQVNDVFDIIGGLLTIALVATILTKPNTASDINAAGSNFTAALKQAQAG* |
| Ga0116220_100215823 | 3300009525 | Peatlands Soil | MHVNDVFDIIGGILTIALVAVFLTKPNTASDVNAAGGQFTGALKQAEAG* |
| Ga0116216_103629652 | 3300009698 | Peatlands Soil | MHLNDWLDIFGGLLTIALVAVFLTKANTASDVNAVGNQFSGALKQAEAG* |
| Ga0105071_10172683 | 3300009808 | Groundwater Sand | VKVNDFFDVLGGILTIALVATILTKPNTARDIKAAGDAFTGAIREAQS* |
| Ga0126373_107746662 | 3300010048 | Tropical Forest Soil | MNVNDIFDIFGGILVLALVATILTKPNTAADVNAVGNAFSGSIKTAEAG* |
| Ga0126373_113692372 | 3300010048 | Tropical Forest Soil | MQVNDFWDLFGGILTIALVAVVLTKQNTSADVGAAGNAFTGALKQAEAG* |
| Ga0126373_122074522 | 3300010048 | Tropical Forest Soil | MHASDIFDIIAGLLTLALVAVFLTKQNTAKDVNAVGNQFTGALKAAEAG* |
| Ga0134128_100946283 | 3300010373 | Terrestrial Soil | MRVNDIFDIFGGILVLALVATILTKQNTASDVNAAGNQFTGAIKAAEAG* |
| Ga0136449_1035925153 | 3300010379 | Peatlands Soil | MNVNDFWDIVGGILVLALIATVLTKPNTAGDINAAGGQFTGALKAAEAG* |
| Ga0126359_10472675 | 3300010869 | Boreal Forest Soil | MHVNDVFDIFGGLLVIALAAVFLTKPNTAADVNAVGNQFTGALKQAEAG* |
| Ga0138567_10613024 | 3300011070 | Peatlands Soil | MHVNDVFDIIGAILTIALVAVFLTKPNTASDVNAAGGQFTGALKQAEA |
| Ga0126317_102845366 | 3300011332 | Soil | MKVSDFFDVIGGILTIALVATILNKSNTAPDLKAAGTAFTGALHEAKA* |
| Ga0137380_1000317124 | 3300012206 | Vadose Zone Soil | MHVNDVFDIFGGLLTVAVIAVVLTKSNTAKDIQAAGGTFTAALKQAEAG* |
| Ga0137379_1000230322 | 3300012209 | Vadose Zone Soil | MHVNDIFDIFGGLLTVAIVAVVLTKSNTAKDVQAAGGTFTAALKQAEAG* |
| Ga0137367_111613102 | 3300012353 | Vadose Zone Soil | MKVNNIFDIFGGLLTLALVATILTKQNTAKDVQAAGAAFTGALKQAEAG* |
| Ga0157374_101584786 | 3300013296 | Miscanthus Rhizosphere | MHVNDFFDIIGGLFTIALVAVILTKANTAADINAAGGQFTSALKQAQAG* |
| Ga0187779_100357137 | 3300017959 | Tropical Peatland | MHVNDIMDIFGGLLTIALVAVILTKKNTASDVHAAGSAFTGALKQAEAG |
| Ga0187778_108649072 | 3300017961 | Tropical Peatland | VNVNDIWDIFGGILVLALVATILTKPNTASDVNAAGNAFSGSIKAAEAG |
| Ga0187780_109139831 | 3300017973 | Tropical Peatland | VNVNDIWDIFGGILVLALVATILTKPNTASDVNAAGNAFSGSIKADEAG |
| Ga0187780_112215891 | 3300017973 | Tropical Peatland | REPMHVNDIMDIFGGLLTIALVAVILTKKNTASDVHAAGSAFTGALKQAEAG |
| Ga0187782_112780083 | 3300017975 | Tropical Peatland | VNVNDIWDIFGGILVLALVAVILTKPNTASDLQAGGNAFSGAIKTAEAG |
| Ga0187815_100274464 | 3300018001 | Freshwater Sediment | VNVNDFFDIIGGILLLALVAVFLTKPNTASDVNAVGNQFTGALKQAEAG |
| Ga0197907_106891882 | 3300020069 | Corn, Switchgrass And Miscanthus Rhizosphere | MKVNDFFDVLGGILTIALVATILSKPNTANDIKAAGAAFTGAIREAQS |
| Ga0206350_105589373 | 3300020080 | Corn, Switchgrass And Miscanthus Rhizosphere | MKVHDVLDIFGGLLTLALVAVFLTKPNTASDVNAVGNQFTGALKQAEAG |
| Ga0206354_101281454 | 3300020081 | Corn, Switchgrass And Miscanthus Rhizosphere | MKVNDFFDVLGGILTIALVATILSKPNTANDIKAAGAAFTGAIKEA |
| Ga0210408_105094082 | 3300021178 | Soil | MNVNDIWDIFGGILVLALVATILTKPNTAKDVQAAGSAFSGAIKQAQAG |
| Ga0210389_100498515 | 3300021404 | Soil | MRVSDIWDIFGGILVLALVATILTKNNTASDVNAAGTQFTGALKAAEAG |
| Ga0210386_100253394 | 3300021406 | Soil | MNVNDIWDIFGGILVLALVAVILTKQNTASDVNAAGSAFSGAIKAADAG |
| Ga0210392_102291384 | 3300021475 | Soil | MHANTIMDIFGGILTIALVAVILTKPNTASDITAAGSQFTGALKQAQAGQ |
| Ga0126371_101714373 | 3300021560 | Tropical Forest Soil | MNVNDIFDIFGGILVLALVATILTKPNTAADVNAVGNAFSGSIKTAEAG |
| Ga0242656_10426271 | 3300022525 | Soil | MQVNDFFDIIAGLLTIALAAVFLTKPNTANDINAAGNAFTGALRQAQAG |
| Ga0242658_10248854 | 3300022530 | Soil | VRVNDIFDIFGGLLTLAVIAVILTKPNTASDIQAGGNAFSGALK |
| Ga0242675_10226333 | 3300022718 | Soil | MGVHDWLDIFGGILTLALVAVFLTKANTATDVNAVGGQFTGAIKQAEAG |
| Ga0247664_11159754 | 3300024232 | Soil | MQVNDIFDIIGGLLTIALVATILTKPNTAADINAAGTQFTSALRQAQAG |
| Ga0207692_102101124 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | MDVHDFWSVIGGILTIALVATILTKPNTAADLNAAGSAFNGALHAAEAGS |
| Ga0207699_100013574 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | MHIDDIFDIFGGLLTIALVAVFLTKPNTAADINAAGSQFTGALKQAQAGQ |
| Ga0207684_1000241611 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MKVNDFFDVLGGILTIALVATILTKPNTARDIKAAGDAFTGAIREAQS |
| Ga0207693_103068114 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | VKVEDVFDIIGGLLTIALVAVFLSKPNTASDVNAVGNQFSGALKQAEAG |
| Ga0207700_1000156822 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | MDVHDIWSVIGGILTIALVATILTKPNTAQDISAAGSSFTGALRAAEAGSG |
| Ga0207700_100182393 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | MEVNDFFDIVGGILTIALVATILTKPNTASDINAAGNQFSAALREAQSG |
| Ga0207700_102298061 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | VNVNDIWDIFGGILILALVATILTKPNTAKDVQAAGSAFSGAIKTAEAG |
| Ga0207700_111108922 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | VQNFFDIIGALLTIALVAVILTKPNTASDINAAGGQFSGALKVAEAG |
| Ga0207664_100169458 | 3300025929 | Agricultural Soil | MSVQNFFDIIGGLLTLALVAVILTKPNTASDINAAGNQFTGALKVAQAG |
| Ga0207664_100891883 | 3300025929 | Agricultural Soil | MSVQNFFDIIGALLTIALVAVILTKPNTASDINAAGGQFSGALKVAEAG |
| Ga0207667_1000358026 | 3300025949 | Corn Rhizosphere | MKVNDFFDVLGGILTIALVATILSKPNTANDIKAAGAAFTGAIKEAQS |
| Ga0207702_1000200923 | 3300026078 | Corn Rhizosphere | MKVNTIFDIFGAMFTLALVAVFFTKPNTAADVNAVGNQFTGALRVAEAG |
| Ga0207702_100064159 | 3300026078 | Corn Rhizosphere | MKVNDLFDIFGGLLALALVAVFLTKQNTAKDVNAVGNQFTGALKQAEAG |
| Ga0209240_100093912 | 3300026304 | Grasslands Soil | MHVNDIFDIFGALLVIALVAVILTKKNTARDVSAAGHTFTGALAQAQKG |
| Ga0257147_10055484 | 3300026475 | Soil | VEVNDFFDIIGGLLTLALVATILTKPNTASDINAAGNQFTSALKQAEAG |
| Ga0257168_100001316 | 3300026514 | Soil | VQVNDFFDIIGGLLTIALVAVILTKPNTASDLNAAGGAFTGALKQAQAG |
| Ga0209807_10293383 | 3300026530 | Soil | VQVNDFFDIVGGLLTIALVATILTKPNTASDINAAGNQFTSALKAAQSG |
| Ga0179587_104907404 | 3300026557 | Vadose Zone Soil | MNVHDIWSVIGGILTIALVATILTKGNTASDLNAAGTAFTGALRTAEAGTG |
| Ga0209886_10218914 | 3300027273 | Groundwater Sand | VKVNDFFDVLGGILTIALVATILTKPNTARDIKAAGDAFTGAIREAQS |
| Ga0209886_10867331 | 3300027273 | Groundwater Sand | VKVNDFFDVLGGILTIALVATILTKPNTARDIKAAGDAFTGAI |
| Ga0208987_10289333 | 3300027496 | Forest Soil | MDVKSFWDIVGGILTIALVATILTKPNTAQDLTAAGTTFTSALSAAEAG |
| Ga0208987_11082682 | 3300027496 | Forest Soil | VQVNDFFDIIGGLLTLALVATFLTKPNTANDVNAAGNAFTGALKQAEAG |
| Ga0208985_10012393 | 3300027528 | Forest Soil | MNVSDGWDIFGGLLVLALVATVLTKPNTAGDINAAGGQFTGALKAAEAG |
| Ga0209116_10214302 | 3300027590 | Forest Soil | MHVNDAFDIVGGILTIALVAVFFTKANTATDVNAVGQQFTSALSTAEAG |
| Ga0209166_107214223 | 3300027857 | Surface Soil | MNVNDFWDIIGGILVLALVATVLTKPNTAGDINAAGGQFTGALKAAEAG |
| Ga0209579_103258574 | 3300027869 | Surface Soil | MQVNDIFDIFGGLLIIALAAVFFTKPNTAQDVNAVGNQFTGALKQAEAG |
| Ga0209624_106175542 | 3300027895 | Forest Soil | VHVNDFFDIVGGLLTIALVAVILTKANTSSDVSAAGTTFTQALAQAEKG |
| Ga0302149_11669782 | 3300028552 | Bog | MHVNDFFDIIGGILTITLVAVFLTKPNTAADVNAAGNQFTGALKQAEAG |
| Ga0307277_105771352 | 3300028881 | Soil | MKVNDVFDIIGGLLTIALVAVFLTKPNTASDINAVGTQFTGALKQAQAGQ |
| Ga0311338_114074331 | 3300030007 | Palsa | MKVNDVFDIFGGLLTVAIVAVILTKANTATDVTAAGATFT |
| Ga0302181_103070222 | 3300030056 | Palsa | MKVNDVFDIFGGLLTVAIVAVILTKANTATDVTAAGATFTSALTAAEAG |
| Ga0310037_103125583 | 3300030494 | Peatlands Soil | MHLNDWLDIFGGLLTIALVAVFLTKANTASDVNAVGNQFSGALKQAEAG |
| Ga0265461_140139062 | 3300030743 | Soil | MRVSTVLDIFGGILTIALVAVFLTKPNTASDVNAVGGQFTGALKQAEAG |
| Ga0138302_17185014 | 3300030937 | Soil | MHVNDIFDIFGGLLTVALIAVILTKPNTANDVQAGGTAFSGALKQAEAG |
| Ga0138301_12134833 | 3300031022 | Soil | VHVNDVFDIFGGLLTLALVATVLTKANTASDVNAAGTTFTSALKQAEAG |
| Ga0170824_1073654612 | 3300031231 | Forest Soil | MHVNDFFDIIGGLLTLALVAVFFTKPNTASDVNAVGNQFTGALKAAEAG |
| Ga0302325_112287682 | 3300031234 | Palsa | MKVNDIWDIFGGLLTLALVATILTKSNTASDLNAAGNQFTGALKQAEAG |
| Ga0302325_112287683 | 3300031234 | Palsa | VHVNDIFDVIGGILAIALAAVILTKNGTAGDINAAGGAFTGALKTAEAG |
| Ga0302324_1031736991 | 3300031236 | Palsa | MHVNDIFDIFGGLLLIALAAVFLTKPNTASDVNAVGGQFTGALKQAEAG |
| Ga0170820_112221092 | 3300031446 | Forest Soil | MHVNDFFDIIGGLLTIALVAVFFTKPNTARDVNAVGNQFTGALKAAEAG |
| Ga0170818_1129763592 | 3300031474 | Forest Soil | MHVNDFFDIIGGLLTLALVAVFFTKPNTARDVNAVGNQFTGALKAAEAG |
| Ga0307374_105485073 | 3300031670 | Soil | MADVKVNDFFDIFAAILTIALVAVVLTKKNTATDLQAGGSAFNGAIKQAEAG |
| Ga0310686_1116448152 | 3300031708 | Soil | FWDIIGGILVLALVATVLTKPNTAGDINAAGGQFTGALKAAEAG |
| Ga0310686_1190837474 | 3300031708 | Soil | VNVNDFWDIIGGILVLALVATVLTKPNTAGDINAAGGQFTGALKAAEAG |
| Ga0307474_101887825 | 3300031718 | Hardwood Forest Soil | MNVNDIWDIFGGLLVLAVIATILTKQNTASDVNAAGNAFSGAIKASEAG |
| Ga0311301_102661433 | 3300032160 | Peatlands Soil | MHVNDVFDIIGGILTIALVAVFLTKPNTASDVNAAGGQFTGALKQAEAG |
| Ga0335079_102315584 | 3300032783 | Soil | MHVYDVFDIFAGILTIALIAVILSKPNTASDIHATGSAFTSALKQAEAG |
| Ga0335078_1002707314 | 3300032805 | Soil | VNVNDIWDVLGGILVLALVATILTKPNTAKDINAAGGAFTGAIKQSEAG |
| Ga0335069_1003686311 | 3300032893 | Soil | MHPNDVFDIIGGLLTIALVAVFLTKPNTAADVNAVGNQFTGALKQAQAG |
| Ga0335069_101148306 | 3300032893 | Soil | VKVEDVFDIIGGLLTIALVAVFLTKPNTASDVNAVGNQFSGALKQAEAG |
| Ga0335069_103005824 | 3300032893 | Soil | VNVNDIWDIFGGILVLALVATILTKPNTAKDVQAAGSAFSGAIKQAQAG |
| Ga0335074_102880023 | 3300032895 | Soil | MHVNDIFDIFGGLLFIALVAVILTKKNTATDVGAAGSAFTGSLKQAEAG |
| Ga0335074_110357943 | 3300032895 | Soil | MHINDFLDIFGALLVIALVAVFLTKPNTASDVNAVGNQFTGALKQAEAG |
| Ga0335075_100250399 | 3300032896 | Soil | MHFSDIIDIIGGILTIALVAVFLTKPNTASDVNAVGNQFTGALKTAEAG |
| Ga0335075_101851166 | 3300032896 | Soil | MHVNDVLDIFGGLLTIALVAVFLTKPNTSSDVNAVGNQFTGALKQAEAG |
| Ga0335075_103189843 | 3300032896 | Soil | MHVNDVFDIFGGILVLALIATILTKPNTSSDINAAGTQFTGALKTAEAG |
| Ga0335075_108998894 | 3300032896 | Soil | MHVTDWLDIFGGLLTIALVAVFFTKANTASDVNAVGNQFTGALKQAEAG |
| Ga0335072_107649623 | 3300032898 | Soil | MQVNDVFDIIGGLLTIGLVATILAKPNTASDINAAGGQFTGALKQAEAG |
| Ga0335072_115069832 | 3300032898 | Soil | MHAGDIIDILALILTIALAATFLTKPNTASDVNAVGNQFTGAIKQAEAG |
| Ga0310810_100545914 | 3300033412 | Soil | MKVNTFFDVFGGLLTIALVAVILTKPNTKSVIQASGSAFTGALKQAEAG |
| ⦗Top⦘ |