NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F061125

Metagenome Family F061125

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F061125
Family Type Metagenome
Number of Sequences 132
Average Sequence Length 42 residues
Representative Sequence PAGSFIVIPAGVPHFVAAKGGTVIIQLNGNGKFQTDYVEK
Number of Associated Samples 110
Number of Associated Scaffolds 132

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.76 %
% of genes near scaffold ends (potentially truncated) 97.73 %
% of genes from short scaffolds (< 2000 bps) 94.70 %
Associated GOLD sequencing projects 103
AlphaFold2 3D model prediction Yes
3D model pTM-score0.27

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (92.424 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere
(6.818 % of family members)
Environment Ontology (ENVO) Unclassified
(48.485 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(70.455 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 0.00%    β-sheet: 0.00%    Coil/Unstructured: 100.00%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.27
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 132 Family Scaffolds
PF08840BAAT_C 3.03
PF07606DUF1569 3.03
PF13646HEAT_2 2.27
PF01915Glyco_hydro_3_C 1.52
PF00924MS_channel 1.52
PF01370Epimerase 1.52
PF03130HEAT_PBS 1.52
PF07589PEP-CTERM 1.52
PF00892EamA 1.52
PF05977MFS_3 1.52
PF12680SnoaL_2 1.52
PF01522Polysacc_deac_1 1.52
PF00501AMP-binding 1.52
PF00072Response_reg 1.52
PF02517Rce1-like 0.76
PF07676PD40 0.76
PF14534DUF4440 0.76
PF13649Methyltransf_25 0.76
PF08241Methyltransf_11 0.76
PF13531SBP_bac_11 0.76
PF04073tRNA_edit 0.76
PF16694Cytochrome_P460 0.76
PF00723Glyco_hydro_15 0.76
PF00326Peptidase_S9 0.76
PF04775Bile_Hydr_Trans 0.76
PF14081DUF4262 0.76
PF14905OMP_b-brl_3 0.76
PF00144Beta-lactamase 0.76
PF00211Guanylate_cyc 0.76
PF03544TonB_C 0.76
PF00011HSP20 0.76
PF03050DDE_Tnp_IS66 0.76
PF14066DUF4256 0.76
PF12695Abhydrolase_5 0.76
PF04392ABC_sub_bind 0.76
PF06210DUF1003 0.76

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 132 Family Scaffolds
COG0668Small-conductance mechanosensitive channelCell wall/membrane/envelope biogenesis [M] 1.52
COG0726Peptidoglycan/xylan/chitin deacetylase, PgdA/NodB/CDA1 familyCell wall/membrane/envelope biogenesis [M] 1.52
COG1472Periplasmic beta-glucosidase and related glycosidasesCarbohydrate transport and metabolism [G] 1.52
COG3264Small-conductance mechanosensitive channel MscKCell wall/membrane/envelope biogenesis [M] 1.52
COG2814Predicted arabinose efflux permease AraJ, MFS familyCarbohydrate transport and metabolism [G] 1.52
COG4449Predicted protease, Abi (CAAX) familyGeneral function prediction only [R] 0.76
COG0071Small heat shock protein IbpA, HSP20 familyPosttranslational modification, protein turnover, chaperones [O] 0.76
COG4420Uncharacterized membrane proteinFunction unknown [S] 0.76
COG3436TransposaseMobilome: prophages, transposons [X] 0.76
COG3387Glucoamylase (glucan-1,4-alpha-glucosidase), GH15 familyCarbohydrate transport and metabolism [G] 0.76
COG2984ABC-type uncharacterized transport system, periplasmic componentGeneral function prediction only [R] 0.76
COG2367Beta-lactamase class ADefense mechanisms [V] 0.76
COG2114Adenylate cyclase, class 3Signal transduction mechanisms [T] 0.76
COG1686D-alanyl-D-alanine carboxypeptidaseCell wall/membrane/envelope biogenesis [M] 0.76
COG1680CubicO group peptidase, beta-lactamase class C familyDefense mechanisms [V] 0.76
COG1266Membrane protease YdiL, CAAX protease familyPosttranslational modification, protein turnover, chaperones [O] 0.76
COG0810Periplasmic protein TonB, links inner and outer membranesCell wall/membrane/envelope biogenesis [M] 0.76


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms92.42 %
UnclassifiedrootN/A7.58 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2170459016|G1P06HT02F0RHBAll Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium595Open in IMG/M
3300000043|ARcpr5yngRDRAFT_c019000All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium580Open in IMG/M
3300000364|INPhiseqgaiiFebDRAFT_104990681All Organisms → cellular organisms → Bacteria → Proteobacteria741Open in IMG/M
3300000559|F14TC_104979091All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales570Open in IMG/M
3300001989|JGI24739J22299_10266749All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae502Open in IMG/M
3300003994|Ga0055435_10221704All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium KBS 83550Open in IMG/M
3300004156|Ga0062589_100014172All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae3489Open in IMG/M
3300004281|Ga0066397_10160565All Organisms → cellular organisms → Bacteria520Open in IMG/M
3300004479|Ga0062595_100299107All Organisms → cellular organisms → Bacteria1083Open in IMG/M
3300005093|Ga0062594_102405112All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium576Open in IMG/M
3300005294|Ga0065705_10042269All Organisms → cellular organisms → Bacteria1498Open in IMG/M
3300005332|Ga0066388_104010063All Organisms → cellular organisms → Bacteria751Open in IMG/M
3300005332|Ga0066388_108771954All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium KBS 83502Open in IMG/M
3300005336|Ga0070680_100306830All Organisms → cellular organisms → Bacteria1346Open in IMG/M
3300005340|Ga0070689_102102270All Organisms → cellular organisms → Bacteria517Open in IMG/M
3300005364|Ga0070673_100339763All Organisms → cellular organisms → Bacteria1330Open in IMG/M
3300005364|Ga0070673_101907411All Organisms → cellular organisms → Bacteria563Open in IMG/M
3300005438|Ga0070701_10243469All Organisms → cellular organisms → Bacteria1083Open in IMG/M
3300005444|Ga0070694_101360497All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae598Open in IMG/M
3300005455|Ga0070663_100227217All Organisms → cellular organisms → Bacteria1468Open in IMG/M
3300005466|Ga0070685_10986646All Organisms → cellular organisms → Bacteria → Acidobacteria631Open in IMG/M
3300005518|Ga0070699_101418754All Organisms → cellular organisms → Bacteria637Open in IMG/M
3300005526|Ga0073909_10262069All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium772Open in IMG/M
3300005544|Ga0070686_100387491All Organisms → cellular organisms → Bacteria1059Open in IMG/M
3300005545|Ga0070695_100739902All Organisms → cellular organisms → Bacteria783Open in IMG/M
3300005548|Ga0070665_100533989All Organisms → cellular organisms → Bacteria → Acidobacteria1185Open in IMG/M
3300005575|Ga0066702_10330863All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium927Open in IMG/M
3300005578|Ga0068854_101644863All Organisms → cellular organisms → Bacteria586Open in IMG/M
3300005617|Ga0068859_101243839All Organisms → cellular organisms → Bacteria → Acidobacteria820Open in IMG/M
3300005617|Ga0068859_102057592All Organisms → cellular organisms → Bacteria630Open in IMG/M
3300005618|Ga0068864_101769394All Organisms → cellular organisms → Bacteria623Open in IMG/M
3300005618|Ga0068864_102226561All Organisms → cellular organisms → Bacteria554Open in IMG/M
3300005718|Ga0068866_10113430All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium KBS 831516Open in IMG/M
3300005764|Ga0066903_104100083All Organisms → cellular organisms → Bacteria780Open in IMG/M
3300005841|Ga0068863_101188883All Organisms → cellular organisms → Bacteria768Open in IMG/M
3300005842|Ga0068858_100416508All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1292Open in IMG/M
3300005844|Ga0068862_100748330All Organisms → cellular organisms → Bacteria951Open in IMG/M
3300006028|Ga0070717_10640631All Organisms → cellular organisms → Bacteria965Open in IMG/M
3300006175|Ga0070712_100740839All Organisms → cellular organisms → Bacteria840Open in IMG/M
3300006358|Ga0068871_102339027All Organisms → cellular organisms → Bacteria509Open in IMG/M
3300006844|Ga0075428_101301864Not Available764Open in IMG/M
3300006854|Ga0075425_100391610All Organisms → cellular organisms → Bacteria1601Open in IMG/M
3300006904|Ga0075424_101269782Not Available783Open in IMG/M
3300009012|Ga0066710_100661657All Organisms → cellular organisms → Bacteria1590Open in IMG/M
3300009094|Ga0111539_10729165All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium KBS 831154Open in IMG/M
3300009094|Ga0111539_12687405All Organisms → cellular organisms → Bacteria → Acidobacteria577Open in IMG/M
3300009098|Ga0105245_12191067Not Available606Open in IMG/M
3300009098|Ga0105245_12933831All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium529Open in IMG/M
3300009147|Ga0114129_10249193All Organisms → cellular organisms → Bacteria2385Open in IMG/M
3300009148|Ga0105243_10370492All Organisms → cellular organisms → Bacteria → Acidobacteria1321Open in IMG/M
3300009148|Ga0105243_10832782All Organisms → cellular organisms → Bacteria912Open in IMG/M
3300009156|Ga0111538_13958258All Organisms → cellular organisms → Bacteria → Acidobacteria512Open in IMG/M
3300009174|Ga0105241_10186643All Organisms → cellular organisms → Bacteria1724Open in IMG/M
3300009174|Ga0105241_12141590Not Available553Open in IMG/M
3300009174|Ga0105241_12589586All Organisms → cellular organisms → Bacteria509Open in IMG/M
3300009176|Ga0105242_10219363All Organisms → cellular organisms → Bacteria1699Open in IMG/M
3300009545|Ga0105237_10214220All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales1926Open in IMG/M
3300009551|Ga0105238_12559699All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium KBS 83546Open in IMG/M
3300009792|Ga0126374_10845007All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae704Open in IMG/M
3300010358|Ga0126370_10871316All Organisms → cellular organisms → Bacteria810Open in IMG/M
3300010360|Ga0126372_12367204All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae581Open in IMG/M
3300010366|Ga0126379_11873228Not Available703Open in IMG/M
3300010375|Ga0105239_10213458All Organisms → cellular organisms → Bacteria2163Open in IMG/M
3300010398|Ga0126383_11109055All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium881Open in IMG/M
3300010398|Ga0126383_12171665Not Available642Open in IMG/M
3300010399|Ga0134127_11725705All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium702Open in IMG/M
3300010403|Ga0134123_10228382All Organisms → cellular organisms → Bacteria1604Open in IMG/M
3300011119|Ga0105246_10131390All Organisms → cellular organisms → Bacteria → Acidobacteria1871Open in IMG/M
3300012198|Ga0137364_11144648All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium584Open in IMG/M
3300012199|Ga0137383_10018392All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia4814Open in IMG/M
3300012207|Ga0137381_11307819All Organisms → cellular organisms → Bacteria618Open in IMG/M
3300012355|Ga0137369_10769685All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae658Open in IMG/M
3300012511|Ga0157332_1042899Not Available623Open in IMG/M
3300012927|Ga0137416_10781254All Organisms → cellular organisms → Bacteria843Open in IMG/M
3300012927|Ga0137416_11856050All Organisms → cellular organisms → Bacteria551Open in IMG/M
3300012955|Ga0164298_10895296All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium645Open in IMG/M
3300012971|Ga0126369_11929297All Organisms → cellular organisms → Bacteria679Open in IMG/M
3300012971|Ga0126369_12035787All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae662Open in IMG/M
3300012986|Ga0164304_10313882All Organisms → cellular organisms → Bacteria1080Open in IMG/M
3300012987|Ga0164307_11024779All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium KBS 83673Open in IMG/M
3300013306|Ga0163162_10414832All Organisms → cellular organisms → Bacteria → Acidobacteria1479Open in IMG/M
3300013306|Ga0163162_10870318All Organisms → cellular organisms → Bacteria1015Open in IMG/M
3300013306|Ga0163162_11482369All Organisms → cellular organisms → Bacteria773Open in IMG/M
3300013308|Ga0157375_10640366All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1220Open in IMG/M
3300013308|Ga0157375_10788943All Organisms → cellular organisms → Bacteria1099Open in IMG/M
3300013308|Ga0157375_11050226All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes952Open in IMG/M
3300014497|Ga0182008_10689617All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium582Open in IMG/M
3300014745|Ga0157377_10897950All Organisms → cellular organisms → Bacteria662Open in IMG/M
3300014968|Ga0157379_10510687All Organisms → cellular organisms → Bacteria1115Open in IMG/M
3300014969|Ga0157376_11083840All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium826Open in IMG/M
3300015372|Ga0132256_100878328All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis1013Open in IMG/M
3300015372|Ga0132256_102294173All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_2_20CM_56_17643Open in IMG/M
3300015374|Ga0132255_101149359All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium KBS 831168Open in IMG/M
3300015374|Ga0132255_105345799All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium543Open in IMG/M
3300016357|Ga0182032_10073741All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium KBS 832317Open in IMG/M
3300017792|Ga0163161_11610994All Organisms → cellular organisms → Bacteria573Open in IMG/M
3300023263|Ga0247800_1081616Not Available633Open in IMG/M
3300025912|Ga0207707_10583842All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium KBS 83947Open in IMG/M
3300025914|Ga0207671_10217042All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales1498Open in IMG/M
3300025916|Ga0207663_10597938All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae866Open in IMG/M
3300025917|Ga0207660_11742849All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium KBS 83500Open in IMG/M
3300025920|Ga0207649_11691088All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium KBS 83501Open in IMG/M
3300025923|Ga0207681_10347947All Organisms → cellular organisms → Bacteria1186Open in IMG/M
3300025923|Ga0207681_10679135All Organisms → cellular organisms → Bacteria855Open in IMG/M
3300025924|Ga0207694_11549897All Organisms → cellular organisms → Bacteria559Open in IMG/M
3300025924|Ga0207694_11658411All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium KBS 83538Open in IMG/M
3300025926|Ga0207659_10249113All Organisms → cellular organisms → Bacteria1441Open in IMG/M
3300025927|Ga0207687_10262273All Organisms → cellular organisms → Bacteria1378Open in IMG/M
3300025927|Ga0207687_11768269All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium529Open in IMG/M
3300025930|Ga0207701_10178371All Organisms → cellular organisms → Bacteria → Acidobacteria1875Open in IMG/M
3300025931|Ga0207644_11763976All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae518Open in IMG/M
3300025932|Ga0207690_11585851All Organisms → cellular organisms → Bacteria → Acidobacteria547Open in IMG/M
3300025935|Ga0207709_10300927All Organisms → cellular organisms → Bacteria1192Open in IMG/M
3300025939|Ga0207665_10266612All Organisms → cellular organisms → Bacteria1270Open in IMG/M
3300025939|Ga0207665_10651850All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_2_20CM_56_17825Open in IMG/M
3300025945|Ga0207679_11571231All Organisms → cellular organisms → Bacteria → Acidobacteria603Open in IMG/M
3300025949|Ga0207667_11223046All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_2_20CM_56_17730Open in IMG/M
3300025960|Ga0207651_10853727All Organisms → cellular organisms → Bacteria809Open in IMG/M
3300026023|Ga0207677_10172957All Organisms → cellular organisms → Bacteria1691Open in IMG/M
3300026089|Ga0207648_11480526Not Available638Open in IMG/M
3300026548|Ga0209161_10385004All Organisms → cellular organisms → Bacteria618Open in IMG/M
3300027765|Ga0209073_10454123All Organisms → cellular organisms → Bacteria534Open in IMG/M
3300028379|Ga0268266_10451317All Organisms → cellular organisms → Bacteria → Acidobacteria1222Open in IMG/M
3300030496|Ga0268240_10191893All Organisms → cellular organisms → Bacteria519Open in IMG/M
3300031744|Ga0306918_10984679All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae655Open in IMG/M
3300031854|Ga0310904_10793774All Organisms → cellular organisms → Bacteria662Open in IMG/M
3300031908|Ga0310900_10905420All Organisms → cellular organisms → Bacteria → Acidobacteria720Open in IMG/M
3300032003|Ga0310897_10106104All Organisms → cellular organisms → Bacteria → Acidobacteria1124Open in IMG/M
3300032008|Ga0318562_10624342All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae622Open in IMG/M
3300032180|Ga0307471_103329103All Organisms → cellular organisms → Bacteria569Open in IMG/M
3300033289|Ga0310914_10126703All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae2229Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere6.82%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere6.82%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere6.82%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil6.06%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere6.06%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere5.30%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere5.30%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil4.55%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere3.79%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil3.03%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil3.03%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere3.03%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere3.03%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil2.27%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil2.27%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil2.27%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere2.27%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere2.27%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere2.27%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere2.27%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere2.27%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil1.52%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil1.52%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil1.52%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere1.52%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere1.52%
Natural And Restored WetlandsEnvironmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands0.76%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.76%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil0.76%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere0.76%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.76%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil0.76%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil0.76%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere0.76%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil0.76%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil0.76%
Miscanthus RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere0.76%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere0.76%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.76%
Switchgrass, Maize And Mischanthus LitterEngineered → Solid Waste → Grass → Composting → Unclassified → Switchgrass, Maize And Mischanthus Litter0.76%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2170459016Litter degradation ZMR2EngineeredOpen in IMG/M
3300000043Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphereHost-AssociatedOpen in IMG/M
3300000364Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300000559Amended soil microbial communities from Kansas Great Prairies, USA - control no BrdU total DNA F1.4 TC clc assemlyEnvironmentalOpen in IMG/M
3300001989Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5Host-AssociatedOpen in IMG/M
3300003994Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqA_D2EnvironmentalOpen in IMG/M
3300004156Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1EnvironmentalOpen in IMG/M
3300004281Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 30 MoBioEnvironmentalOpen in IMG/M
3300004479Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAsEnvironmentalOpen in IMG/M
3300005093Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All BlocksEnvironmentalOpen in IMG/M
3300005294Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk SoilEnvironmentalOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005336Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaGEnvironmentalOpen in IMG/M
3300005340Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaGEnvironmentalOpen in IMG/M
3300005364Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaGHost-AssociatedOpen in IMG/M
3300005438Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaGEnvironmentalOpen in IMG/M
3300005444Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaGEnvironmentalOpen in IMG/M
3300005455Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaGHost-AssociatedOpen in IMG/M
3300005466Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaGEnvironmentalOpen in IMG/M
3300005518Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaGEnvironmentalOpen in IMG/M
3300005526Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1EnvironmentalOpen in IMG/M
3300005543Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaGHost-AssociatedOpen in IMG/M
3300005544Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaGEnvironmentalOpen in IMG/M
3300005545Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaGEnvironmentalOpen in IMG/M
3300005548Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaGHost-AssociatedOpen in IMG/M
3300005575Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151EnvironmentalOpen in IMG/M
3300005578Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2Host-AssociatedOpen in IMG/M
3300005617Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2Host-AssociatedOpen in IMG/M
3300005618Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2Host-AssociatedOpen in IMG/M
3300005718Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2Host-AssociatedOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300005841Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2Host-AssociatedOpen in IMG/M
3300005842Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2Host-AssociatedOpen in IMG/M
3300005844Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2Host-AssociatedOpen in IMG/M
3300006028Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaGEnvironmentalOpen in IMG/M
3300006175Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaGEnvironmentalOpen in IMG/M
3300006358Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2Host-AssociatedOpen in IMG/M
3300006844Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2Host-AssociatedOpen in IMG/M
3300006854Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4Host-AssociatedOpen in IMG/M
3300006904Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3Host-AssociatedOpen in IMG/M
3300009012Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159EnvironmentalOpen in IMG/M
3300009094Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009098Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaGHost-AssociatedOpen in IMG/M
3300009147Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2)Host-AssociatedOpen in IMG/M
3300009148Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaGHost-AssociatedOpen in IMG/M
3300009156Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009174Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaGHost-AssociatedOpen in IMG/M
3300009176Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaGHost-AssociatedOpen in IMG/M
3300009545Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaGHost-AssociatedOpen in IMG/M
3300009551Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaGHost-AssociatedOpen in IMG/M
3300009792Tropical forest soil microbial communities from Panama - MetaG Plot_12EnvironmentalOpen in IMG/M
3300010358Tropical forest soil microbial communities from Panama - MetaG Plot_3EnvironmentalOpen in IMG/M
3300010360Tropical forest soil microbial communities from Panama - MetaG Plot_6EnvironmentalOpen in IMG/M
3300010366Tropical forest soil microbial communities from Panama - MetaG Plot_24EnvironmentalOpen in IMG/M
3300010375Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaGHost-AssociatedOpen in IMG/M
3300010398Tropical forest soil microbial communities from Panama - MetaG Plot_35EnvironmentalOpen in IMG/M
3300010399Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3EnvironmentalOpen in IMG/M
3300010403Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3EnvironmentalOpen in IMG/M
3300011119Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaGHost-AssociatedOpen in IMG/M
3300012198Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012199Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaGEnvironmentalOpen in IMG/M
3300012207Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaGEnvironmentalOpen in IMG/M
3300012355Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaGEnvironmentalOpen in IMG/M
3300012511Unplanted soil (control) microbial communities from North Carolina - M.Soil.8.old.080610_10EnvironmentalOpen in IMG/M
3300012927Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012955Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MGEnvironmentalOpen in IMG/M
3300012971Tropical forest soil microbial communities from Panama - MetaG Plot_1EnvironmentalOpen in IMG/M
3300012986Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MGEnvironmentalOpen in IMG/M
3300012987Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MGEnvironmentalOpen in IMG/M
3300013306Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaGHost-AssociatedOpen in IMG/M
3300013308Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaGHost-AssociatedOpen in IMG/M
3300014497Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaGHost-AssociatedOpen in IMG/M
3300014745Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaGHost-AssociatedOpen in IMG/M
3300014968Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaGHost-AssociatedOpen in IMG/M
3300014969Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaGHost-AssociatedOpen in IMG/M
3300015372Soil combined assemblyHost-AssociatedOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300016357Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000EnvironmentalOpen in IMG/M
3300017792Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaGHost-AssociatedOpen in IMG/M
3300023263Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S092-311B-6EnvironmentalOpen in IMG/M
3300025912Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025914Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025916Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025917Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025920Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025923Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025924Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025926Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025927Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025930Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes)EnvironmentalOpen in IMG/M
3300025931Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025932Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025935Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025939Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025945Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025949Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025960Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026023Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026089Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026548Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 (SPAdes)EnvironmentalOpen in IMG/M
3300027765Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 (SPAdes)EnvironmentalOpen in IMG/M
3300028379Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300030496Bulk soil microbial communities from Mexico - Penjamo (Pe) metaG (v2)EnvironmentalOpen in IMG/M
3300031744Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2)EnvironmentalOpen in IMG/M
3300031854Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D1EnvironmentalOpen in IMG/M
3300031908Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D1EnvironmentalOpen in IMG/M
3300032003Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D1EnvironmentalOpen in IMG/M
3300032008Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f18EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300033289Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
2ZMR_037891902170459016Switchgrass, Maize And Mischanthus LitterGSFILIPAGAPHFVATRESPAVLQLSGTGKFHTDYVEK
ARcpr5yngRDRAFT_01900013300000043Arabidopsis RhizospherePAGSFIVIPAGVPHFVAAKGGTVIIQLNGNGKFQTDYVEK*
INPhiseqgaiiFebDRAFT_10499068113300000364SoilRRYPRGSFIVIPAGVPHFVAAENGPVVVQVSGTGRFHTDYLEK*
F14TC_10497909123300000559SoilVIPAGVPHFAASKEGGVIVQLNGAGSFATEYLENE
JGI24739J22299_1026674913300001989Corn RhizosphereSTNLKGYPAGSFIVIPAGLPHFVATKESIAVVQLNGSGKFRTDYVEK*
Ga0055435_1022170413300003994Natural And Restored WetlandsPAGSFIVIPARVPHFVAARESGVIVQLCGTAKFSTDYLEK*
Ga0062589_10001417253300004156SoilYPAHSFIVIPAGLPHFVATKEGAVVIQLSGVRKFETSYVEK*
Ga0066397_1016056523300004281Tropical Forest SoilYPAGSFIVIPAGVPHFVAAKDGNVIVQLYGNGKFHTDPVEK*
Ga0062595_10029910713300004479SoilTRFDAAKLRGYPRGSFIVIPAGVPHFVAAEKGAVVVQVSGAGKFQTAYVEK*
Ga0062594_10240511213300005093SoilGYGPGSFVIIPAGLPHFVAAKDGSVIVQVNGTGKFATDFLEK*
Ga0065705_1004226913300005294Switchgrass RhizosphereQGYPAGSFIVIPAGTPHFVATNNGVVVVQLTGTEKFRTDYLEK*
Ga0066388_10401006313300005332Tropical Forest SoilYTPGSFIVIPAGVPHFVATKESTVVVQLSGNGKFQTDYLEK*
Ga0066388_10877195413300005332Tropical Forest SoilAYPAGSFILIPAGVPHFVGAIEGDVIIQLSGNGKFQTDYIEK*
Ga0070680_10030683013300005336Corn RhizosphereKLRAYPAGSFIVIPAGVPHFLATKAGPVIVQASGQGIFRTKYVEE*
Ga0070689_10210227013300005340Switchgrass RhizosphereYPAGSFIVIPAGVPHFVATRESSVIVQLNGNGKFRTDYVEE*
Ga0070673_10033976313300005364Switchgrass RhizosphereAGSFIVIPAGVPHFVATRESSVIVQLNGNGKFRTDYVEE*
Ga0070673_10190741113300005364Switchgrass RhizosphereEGEKFDIAKLKGYPAGSFIVIPSGVPHFVTAKDGSVVVQVSGIGKFNTDYLEK*
Ga0070701_1024346913300005438Corn, Switchgrass And Miscanthus RhizosphereDSTKLKGYPAGTFIVIPAGVPHFVAAKDGAVIIQLEGNGKFQTDYVEQ*
Ga0070694_10136049723300005444Corn, Switchgrass And Miscanthus RhizosphereNLKGYPAGSFIVIPAGLPHFVATKESIAVVQLNGSGKFRTDYVEK*
Ga0070663_10022721743300005455Corn RhizosphereAHSFIVIPAGLPHFVATKEGAVVIQLSGVRKFETSYVEK*
Ga0070685_1098664623300005466Switchgrass RhizosphereGYAAGSFIVIPAGTPHFVAAESGAVVVQVSGTGTFQTEYVEK*
Ga0070699_10141875423300005518Corn, Switchgrass And Miscanthus RhizosphereLKGYPAGSFIVIPAGVPHFVAAKDGAVIVQVSGKGKFGTDYLEK*
Ga0073909_1026206923300005526Surface SoilNLKAYPAGSFIDIPAGVPHFVAAKEGIVIVQLNGNGKFQTDSVEK*
Ga0070672_10014365033300005543Miscanthus RhizosphereGSFIVIPADVPHFLATKEGPVIVQPSGRGIFRTSPLEK*
Ga0070686_10038749113300005544Switchgrass RhizosphereYPAGSFIVIPADVPHFLATKEGPVIVQPSGRGIFRTNPLEK*
Ga0070695_10073990223300005545Corn, Switchgrass And Miscanthus RhizosphereAKLKGYPAGSFIVIPAGTPHFVATKDSGVVVQLSGTVKFRTDYVER*
Ga0070665_10053398923300005548Switchgrass RhizosphereYAAGSFIVIPAGTPHFVAAESGAVVVQVSGTGTFQTEYVEK*
Ga0066702_1033086313300005575SoilYPAGSFIVIPAGVPHFVAARDGAVIVQISGSGKVGADYLEK*
Ga0068854_10164486323300005578Corn RhizosphereAGSFILIPAGLPHFVAAKHSPVVIQLSGNGKFGTDYLEK*
Ga0068859_10124383913300005617Switchgrass RhizosphereGSFIVIPAGTPHFVAAESGAVVVQVSGTGTFQTEYVEK*
Ga0068859_10205759223300005617Switchgrass RhizosphereFIVIPAGVPHFVAAPEGEVIVQISGDGPFRTEFVE*
Ga0068864_10176939413300005618Switchgrass RhizosphereIVIPAGVPHFLAAMDGAVIVQVSGTGRFATDYLEK*
Ga0068864_10222656113300005618Switchgrass RhizosphereYPAGSFILIPAGLPHFVAAKHSPVVIQLSGNGKFGTDYLEK*
Ga0068866_1011343023300005718Miscanthus RhizosphereYPAGSFIVIPAGLPHFVATKESIAVVQLNGSGKFRTDYVEK*
Ga0066903_10410008323300005764Tropical Forest SoilAGSFIVIPAGVPHFLAAKDGAVMVQLSGTGKFGTDYLEK*
Ga0068863_10118888323300005841Switchgrass RhizospherePYPAGSFIVIPARVPHFVAAPEGEVIVQISGDGPFRTEILEK*
Ga0068858_10041650823300005842Switchgrass RhizosphereLFIVIPAGLPHFVAAKDDSVIVQVSGTGKFTTDFLEK*
Ga0068862_10074833013300005844Switchgrass RhizosphereFIVIPAGVPHFVAAPEGVVIVQISGDGPFRTDFLEK*
Ga0070717_1064063113300006028Corn, Switchgrass And Miscanthus RhizosphereKFNPTNLKRYPAGSFIVIPAGVPHFVATRESSVIVQLNGNGKFRTDYVEE*
Ga0070712_10074083923300006175Corn, Switchgrass And Miscanthus RhizosphereKLKGYPAGSFIVIPAGTPHFVATKDSGVVVQLSGTVKFRTDYVER*
Ga0068871_10233902713300006358Miscanthus RhizosphereKAYPAGSFILIPAGLPHFVAAKDSPVVIQLSGNGKFGTDYLEK*
Ga0075428_10130186413300006844Populus RhizosphereHIPSDVAHFLATKEGPVIVQVSGHGLFRTKYVGK*
Ga0075425_10039161013300006854Populus RhizospherePGSFILIPAGVPHFVAVKKGTVVVQLSGTGKFQTDYLEK*
Ga0075424_10126978213300006904Populus RhizosphereIIAAGVPHFVAAKEGAVVVQLSGSGKFQPDSLEK*
Ga0066710_10066165733300009012Grasslands SoilPGSFVVIPAGVPHFVATKEETVVVQTSGHGLFRTDFLEK
Ga0111539_1072916513300009094Populus RhizosphereSFDSTQLKGYPAGSFIVIPAGVPHFASAKDGAVIIQLEGNGKFQTDYVEQ*
Ga0111539_1268740513300009094Populus RhizosphereSFIVIHARVPHFVAAEKGAVVVQVSGTGKFQTEYLEK*
Ga0105245_1219106723300009098Miscanthus RhizosphereSAGSFIVIPADVAHFLATREGPVIVQVSGHGMFRTHYVGK*
Ga0105245_1293383123300009098Miscanthus RhizosphereFIVIPAGMPHFVAAPEGEVIVQISGDGPFRTEFVE*
Ga0114129_1024919333300009147Populus RhizosphereGSFIFIPADVPHFLATKKEPVIVQVSGHGLFRTNYLQR*
Ga0105243_1037049223300009148Miscanthus RhizosphereKAYPAGSFIVIPAGTPHFVATKDSAVVVQLSGTEKFRTDYVEK*
Ga0105243_1083278213300009148Miscanthus RhizosphereLKGYPAGSFILIPAGVPHFVAARDGSVIVQLNGDGKFGTDYLEK*
Ga0111538_1395825813300009156Populus RhizosphereIVIHARVPHFVAAEKGAVVVQVSGTGKFQTEYLEK*
Ga0105241_1018664333300009174Corn RhizosphereSFIVIPAGVPHFVAAKDGAVIIQLEGNGKFQTDYVEQ*
Ga0105241_1214159013300009174Corn RhizosphereSFIVIPASIPHFVAAKEGIVVVQLSGTGRFQTEYLEQ*
Ga0105241_1258958623300009174Corn RhizosphereAGSFILIPAGLPHFVAAKDSPVVIQLSGNGKFGTDYLEK*
Ga0105242_1021936313300009176Miscanthus RhizospherePAGSFIVIPAGVPHFVAAKDGAVIIQLEGNGKFQTDYVEQ*
Ga0105237_1021422053300009545Corn RhizosphereLKPYPAGSFIVIPAGVPHFVAAPEGVVIVQISGDGPFRTDFLEK*
Ga0105238_1255969913300009551Corn RhizosphereKLKGYPAGSFILIPAGVPHFVATKKDPVVVQLNGNGKFQTDYVEE*
Ga0126374_1084500713300009792Tropical Forest SoilLKGYPAGSFIVIPAHVPHFVAAKEGSVIIQLNGNGKFQTDYLEK*
Ga0126370_1087131613300010358Tropical Forest SoilPAGSFIVIPAEVTHFLATRKDAAVVQVSGHGIFRTKYLER*
Ga0126372_1236720423300010360Tropical Forest SoilYPAGSFIVIPAGVPHFVAAREGAVVVQLSGNGKFETIPLEK*
Ga0126379_1187322823300010366Tropical Forest SoilIVIPAGVRHFIAAKEGAVIIQLYGDGKFHTDYVEK*
Ga0105239_1021345813300010375Corn RhizosphereSFIVIPAGVPHFVAAKDGSVIVQVGGTGKFVTDYLEK*
Ga0126383_1110905513300010398Tropical Forest SoilGYPAGSFIVIPAGVPHFVATKEGMVIIQLNGNGKFQTDYVEK*
Ga0126383_1217166513300010398Tropical Forest SoilKGYPAGSFVSIPAGLSHFVAAMESPVIVHLSGGEKFRTVYVEK*
Ga0134127_1172570523300010399Terrestrial SoilVIIPAGLPHFVAAKDGSVIVQVNGTGKFATDFLEK*
Ga0134123_1022838223300010403Terrestrial SoilPAGSFIVIPANMPHFLATKEGPVIVQPSGRGIFRTNPLEK*
Ga0105246_1013139033300011119Miscanthus RhizosphereAYPAGSFIVIPAGTPHFVATKDSAVVVQLSGTEKFRTDYVEK*
Ga0137364_1114464813300012198Vadose Zone SoilSFIVSPAGVPHFVAAKDGAVIIQLEGNGKFQTDYVEQ*
Ga0137383_1001839213300012199Vadose Zone SoilKGYPAGSFIVIPAGVPHFVAAKDGAVIVQVSSVGKFVTDYLEK*
Ga0137381_1130781923300012207Vadose Zone SoilKLKGYPAGSFTVTPAGVPHVVAAKDGAVIVQVSGVGKFVTDYLEK*
Ga0137369_1076968523300012355Vadose Zone SoilLGEGTKFDPTTLKAYPAGSFILIPAGVPHLVATKEDAVIIQLSGNGKFQTDYVEK*
Ga0157332_104289923300012511SoilFIVIPPDVPHFLATKEGPVIVQPSGRGIFRTNPLEK*
Ga0137416_1078125433300012927Vadose Zone SoilIIPAGVPHFVATKEGPVIVQLNGTAKWDTHYIEK*
Ga0137416_1185605013300012927Vadose Zone SoilSFIMIPAGVPHFVATKEGPVVGQLNGTGKWDTHYIEK*
Ga0164298_1089529613300012955SoilKGYPAGSFIVIPAGVPHFVAAKGGTVIIQLNGNGKFQTDYVEK*
Ga0126369_1192929723300012971Tropical Forest SoilGEGTKFNATNLKGYPAGSFIVIPAGVPHFVAAKEGAVIVQLYGNGKFQTDYVEK*
Ga0126369_1203578723300012971Tropical Forest SoilIVIPAGVPHFMAAKDGGVIVQPSGTGKFGTDYLEK*
Ga0164304_1031388213300012986SoilKLRGYPRGSFIVIPASVPHFVAAEKGAVVVQVSGAGKFQTAYVEK*
Ga0164307_1102477913300012987SoilFDLTNLKGYPAGSFIVIPAGVAHFVAAKDGIVIVQLNGNGKFHTDYLEK*
Ga0163162_1041483213300013306Switchgrass RhizosphereIVIPAGTPHFVATKDGPVIVQLTGTEEFRTDYLEK*
Ga0163162_1087031813300013306Switchgrass RhizosphereGTKFDSARLKSYPAHSFIVIPAGLPHFVATKEGAVVIQLSGVRKFETSYVEK*
Ga0163162_1148236913300013306Switchgrass RhizosphereLKGYPAGSFIVIPSGVPHFVAAKDGSVVVQVSGIGKFNTDYLEK*
Ga0157375_1064036613300013308Miscanthus RhizosphereSARLKSYPAHSFIVIPAGLPHFVATKEGAVVIQLSGVRKFETSYVEK*
Ga0157375_1078894333300013308Miscanthus RhizosphereAYPAGSFIVIPAGVPHFLATKAGPVIVQASGQGIFRTKYVEE*
Ga0157375_1105022633300013308Miscanthus RhizosphereLKGYPAGSFIVIPAGVPHFVAAKNGSVIVQINGTGKFATDYLEK*
Ga0182008_1068961723300014497RhizosphereRGYPSGSFIVIPAGVAHFVAAKESAVVVQLNGTGKFGTDYLER*
Ga0157377_1089795023300014745Miscanthus RhizosphereGYPAGSFIVIPAGVPHFLAAMNGPVIVQVSGTGRFATDYLEK*
Ga0157379_1051068733300014968Switchgrass RhizosphereFIVIPAGVPHFLATKAGPVIVQASGQGMFRTKYVEE*
Ga0157376_1108384023300014969Miscanthus RhizosphereGSFILIPAGVPHFVAATEGDVIIQLSGNRKFQTDYVEQ*
Ga0132256_10087832833300015372Arabidopsis RhizosphereFKSANLKAYPAGSFILIPAGVPHFVTATDSDVIIQLSGNGKFHTDYVEK*
Ga0132256_10229417313300015372Arabidopsis RhizosphereYPAGSFIVIPAGVPHFVAANDGTVVVQLSGTRKFQTDYLEK*
Ga0132255_10114935933300015374Arabidopsis RhizosphereSFIVIPAGVPHFVAAKDGAVTIQLEGNGKFQTDYVEQ*
Ga0132255_10534579923300015374Arabidopsis RhizosphereFVVVPAGVPHFVAAKDGSVIVQVSGTGKFGTDYLEK*
Ga0182032_1007374133300016357SoilGSFVVIPAGVPHFVATKDGTVVVQLSGVRKFQTDYVEEYR
Ga0163161_1161099413300017792Switchgrass RhizosphereFIVIPAGVPHFVAAKNGSVIVQINGTGKFATDYLEK
Ga0247800_108161613300023263SoilIVIPAGTPHFVAAESGAVVVQVSGTGTFQTEYVEK
Ga0207707_1058384223300025912Corn RhizosphereSSEGTKFNSTNLKGYPAGSFIVIPAGLPHFVATKESIAVVQLNGSGKFRTDYVEK
Ga0207671_1021704243300025914Corn RhizosphereLKPYPAGSFIVIPAGVPHFVAAPEGVVIVQISGDGPFRTDFLEK
Ga0207663_1059793813300025916Corn, Switchgrass And Miscanthus RhizosphereTKLIGYPAGSFIVVPAGVPHFVGAKDGAVIIQLEGNGKFQTDYVEQ
Ga0207660_1174284913300025917Corn RhizosphereKFNSTKLKGYPAGSFILIPAGVPHFVATKKDPVVVQLNGNGKFQTDYVEE
Ga0207649_1169108813300025920Corn RhizosphereQRFDPLKLKSYPAGSFIVVPAGVAHFASAKDGDVVVQLNGTEKFGTDYLEK
Ga0207681_1034794723300025923Switchgrass RhizosphereLKPYPAGSFIVIPAGVPHFVAAPKGEVIVQISGDGPFRTEILEK
Ga0207681_1067913523300025923Switchgrass RhizosphereKAYPAGSFIVIPADVPHFLATKEGPVIVQPSGRGIFRTNPLEK
Ga0207694_1154989723300025924Corn RhizospherePAGSFIVIPAGVPHFVATRESSVIVQLNGNGKFRTDYVEE
Ga0207694_1165841113300025924Corn RhizosphereKGYPAGSFILIPAGVPHFVATKKDPVVVQLNGNGKFQTDYVEE
Ga0207659_1024911313300025926Miscanthus RhizosphereAGSFIVIPAGVPHFLATKEGPVIVQVSGHGVFRTNYVEK
Ga0207687_1026227313300025927Miscanthus RhizosphereAHSFIVIPAGLPHFVATKEGAVVIQLSGVRKFETSYVEK
Ga0207687_1176826913300025927Miscanthus RhizosphereFIVIPAGMPHFVAAPEGEVIVQISGDGPFRTEFVE
Ga0207701_1017837133300025930Corn, Switchgrass And Miscanthus RhizosphereVTTSIVIPAGTPHFVAAESGAVVVQVSGTGTFQTEYVEK
Ga0207644_1176397613300025931Switchgrass RhizosphereGYPAGSFIVIPAALPHFVATKESIAVVQLNGSGKFRTDYVEK
Ga0207690_1158585113300025932Corn RhizosphereGSFIVIPAGLPHFVATKESIAVVQLNGSGKFRTDYVEK
Ga0207709_1030092743300025935Miscanthus RhizosphereAGSFILIPAGVPHFVAARDGSVIVQLNGDGKFGTDYLEK
Ga0207665_1026661223300025939Corn, Switchgrass And Miscanthus RhizosphereEGTKFDSTTLKAYPAGSFILIPAGVPHFVATKENAAIIQLSGNGKFQTDYVEK
Ga0207665_1065185023300025939Corn, Switchgrass And Miscanthus RhizosphereKLKRYPAGSFIVIPAGVPHFVAANDGTVVVQLSGTRKFQTDYLEK
Ga0207679_1157123123300025945Corn RhizosphereGSFIVIPAGTPHFVAAESGAVVVQVSGTGTFQTEYVEK
Ga0207667_1122304623300025949Corn RhizosphereFDPAKLKRYPAGSFIVIPAGVPHFVAANEGTVVVQLTGTRKFQTDYLEK
Ga0207651_1085372713300025960Switchgrass RhizosphereIPAGTPHFVAANDGVVVVQLSGTEKFRTDYLEKSQP
Ga0207677_1017295713300026023Miscanthus RhizosphereGSFILIPAGLPHFVAAKHSPVVIQLSGNGKFGTDYLEK
Ga0207648_1148052613300026089Miscanthus RhizospherePAGIFIVIPAVMPHFVAAPEGEVIVQISGDGPFRTEFVE
Ga0209161_1038500423300026548SoilPAGSFILIPAGVPHFVAAMDGTVIIQLSGNGKFQTDYVEK
Ga0209073_1045412323300027765Agricultural SoilSFIVIPAGVPHFVAAKDGPVIVQLGGTTKFSTEYVEK
Ga0268266_1045131713300028379Switchgrass RhizosphereKLRGYAAGSFIVIPAGTPHFVAAESGAVVVQVSGTGTFQTEYVEK
Ga0268240_1019189323300030496SoilKGYPAGSFVVIPAGVPHFVTAQEGAVIVQISGTGKFGTDYLEK
Ga0306918_1098467913300031744SoilAKLTGYPAGSFVVIPAGVPHFVATKDGTVVVQLSGVRKFQTDYVEEYR
Ga0310904_1079377423300031854SoilTKLKPYPAGSFILIPADVPHFLATREGPVIVQASGRGMFRTTYLEK
Ga0310900_1090542023300031908SoilFDVAKLTAYPSGSFIVIHARVPHFVAAEKGAVVVQVSGTGKFQTEYLEK
Ga0310897_1010610413300032003SoilPAGSFIVIPAGVPHFLATKAGPVIVQASGQGMFRTKYVEE
Ga0318562_1062434213300032008SoilFVVIPAGVPHFVATKDGTVVVQLSGVRKFQTDYVEEYR
Ga0307471_10332910313300032180Hardwood Forest SoilAGSFILIPAGVPHFVAATEGDVIIQLSGNGKFQTDYVEQ
Ga0310914_1012670323300033289SoilAGSFVVIPAGVPHFVATKDGTVVVQLSGVRKFQTDYVEEYR


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.