| Basic Information | |
|---|---|
| Family ID | F061125 |
| Family Type | Metagenome |
| Number of Sequences | 132 |
| Average Sequence Length | 42 residues |
| Representative Sequence | PAGSFIVIPAGVPHFVAAKGGTVIIQLNGNGKFQTDYVEK |
| Number of Associated Samples | 110 |
| Number of Associated Scaffolds | 132 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.76 % |
| % of genes near scaffold ends (potentially truncated) | 97.73 % |
| % of genes from short scaffolds (< 2000 bps) | 94.70 % |
| Associated GOLD sequencing projects | 103 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.27 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (92.424 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere (6.818 % of family members) |
| Environment Ontology (ENVO) | Unclassified (48.485 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (70.455 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 0.00% Coil/Unstructured: 100.00% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.27 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 132 Family Scaffolds |
|---|---|---|
| PF08840 | BAAT_C | 3.03 |
| PF07606 | DUF1569 | 3.03 |
| PF13646 | HEAT_2 | 2.27 |
| PF01915 | Glyco_hydro_3_C | 1.52 |
| PF00924 | MS_channel | 1.52 |
| PF01370 | Epimerase | 1.52 |
| PF03130 | HEAT_PBS | 1.52 |
| PF07589 | PEP-CTERM | 1.52 |
| PF00892 | EamA | 1.52 |
| PF05977 | MFS_3 | 1.52 |
| PF12680 | SnoaL_2 | 1.52 |
| PF01522 | Polysacc_deac_1 | 1.52 |
| PF00501 | AMP-binding | 1.52 |
| PF00072 | Response_reg | 1.52 |
| PF02517 | Rce1-like | 0.76 |
| PF07676 | PD40 | 0.76 |
| PF14534 | DUF4440 | 0.76 |
| PF13649 | Methyltransf_25 | 0.76 |
| PF08241 | Methyltransf_11 | 0.76 |
| PF13531 | SBP_bac_11 | 0.76 |
| PF04073 | tRNA_edit | 0.76 |
| PF16694 | Cytochrome_P460 | 0.76 |
| PF00723 | Glyco_hydro_15 | 0.76 |
| PF00326 | Peptidase_S9 | 0.76 |
| PF04775 | Bile_Hydr_Trans | 0.76 |
| PF14081 | DUF4262 | 0.76 |
| PF14905 | OMP_b-brl_3 | 0.76 |
| PF00144 | Beta-lactamase | 0.76 |
| PF00211 | Guanylate_cyc | 0.76 |
| PF03544 | TonB_C | 0.76 |
| PF00011 | HSP20 | 0.76 |
| PF03050 | DDE_Tnp_IS66 | 0.76 |
| PF14066 | DUF4256 | 0.76 |
| PF12695 | Abhydrolase_5 | 0.76 |
| PF04392 | ABC_sub_bind | 0.76 |
| PF06210 | DUF1003 | 0.76 |
| COG ID | Name | Functional Category | % Frequency in 132 Family Scaffolds |
|---|---|---|---|
| COG0668 | Small-conductance mechanosensitive channel | Cell wall/membrane/envelope biogenesis [M] | 1.52 |
| COG0726 | Peptidoglycan/xylan/chitin deacetylase, PgdA/NodB/CDA1 family | Cell wall/membrane/envelope biogenesis [M] | 1.52 |
| COG1472 | Periplasmic beta-glucosidase and related glycosidases | Carbohydrate transport and metabolism [G] | 1.52 |
| COG3264 | Small-conductance mechanosensitive channel MscK | Cell wall/membrane/envelope biogenesis [M] | 1.52 |
| COG2814 | Predicted arabinose efflux permease AraJ, MFS family | Carbohydrate transport and metabolism [G] | 1.52 |
| COG4449 | Predicted protease, Abi (CAAX) family | General function prediction only [R] | 0.76 |
| COG0071 | Small heat shock protein IbpA, HSP20 family | Posttranslational modification, protein turnover, chaperones [O] | 0.76 |
| COG4420 | Uncharacterized membrane protein | Function unknown [S] | 0.76 |
| COG3436 | Transposase | Mobilome: prophages, transposons [X] | 0.76 |
| COG3387 | Glucoamylase (glucan-1,4-alpha-glucosidase), GH15 family | Carbohydrate transport and metabolism [G] | 0.76 |
| COG2984 | ABC-type uncharacterized transport system, periplasmic component | General function prediction only [R] | 0.76 |
| COG2367 | Beta-lactamase class A | Defense mechanisms [V] | 0.76 |
| COG2114 | Adenylate cyclase, class 3 | Signal transduction mechanisms [T] | 0.76 |
| COG1686 | D-alanyl-D-alanine carboxypeptidase | Cell wall/membrane/envelope biogenesis [M] | 0.76 |
| COG1680 | CubicO group peptidase, beta-lactamase class C family | Defense mechanisms [V] | 0.76 |
| COG1266 | Membrane protease YdiL, CAAX protease family | Posttranslational modification, protein turnover, chaperones [O] | 0.76 |
| COG0810 | Periplasmic protein TonB, links inner and outer membranes | Cell wall/membrane/envelope biogenesis [M] | 0.76 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 92.42 % |
| Unclassified | root | N/A | 7.58 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2170459016|G1P06HT02F0RHB | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 595 | Open in IMG/M |
| 3300000043|ARcpr5yngRDRAFT_c019000 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 580 | Open in IMG/M |
| 3300000364|INPhiseqgaiiFebDRAFT_104990681 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 741 | Open in IMG/M |
| 3300000559|F14TC_104979091 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 570 | Open in IMG/M |
| 3300001989|JGI24739J22299_10266749 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 502 | Open in IMG/M |
| 3300003994|Ga0055435_10221704 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium KBS 83 | 550 | Open in IMG/M |
| 3300004156|Ga0062589_100014172 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3489 | Open in IMG/M |
| 3300004281|Ga0066397_10160565 | All Organisms → cellular organisms → Bacteria | 520 | Open in IMG/M |
| 3300004479|Ga0062595_100299107 | All Organisms → cellular organisms → Bacteria | 1083 | Open in IMG/M |
| 3300005093|Ga0062594_102405112 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 576 | Open in IMG/M |
| 3300005294|Ga0065705_10042269 | All Organisms → cellular organisms → Bacteria | 1498 | Open in IMG/M |
| 3300005332|Ga0066388_104010063 | All Organisms → cellular organisms → Bacteria | 751 | Open in IMG/M |
| 3300005332|Ga0066388_108771954 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium KBS 83 | 502 | Open in IMG/M |
| 3300005336|Ga0070680_100306830 | All Organisms → cellular organisms → Bacteria | 1346 | Open in IMG/M |
| 3300005340|Ga0070689_102102270 | All Organisms → cellular organisms → Bacteria | 517 | Open in IMG/M |
| 3300005364|Ga0070673_100339763 | All Organisms → cellular organisms → Bacteria | 1330 | Open in IMG/M |
| 3300005364|Ga0070673_101907411 | All Organisms → cellular organisms → Bacteria | 563 | Open in IMG/M |
| 3300005438|Ga0070701_10243469 | All Organisms → cellular organisms → Bacteria | 1083 | Open in IMG/M |
| 3300005444|Ga0070694_101360497 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 598 | Open in IMG/M |
| 3300005455|Ga0070663_100227217 | All Organisms → cellular organisms → Bacteria | 1468 | Open in IMG/M |
| 3300005466|Ga0070685_10986646 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 631 | Open in IMG/M |
| 3300005518|Ga0070699_101418754 | All Organisms → cellular organisms → Bacteria | 637 | Open in IMG/M |
| 3300005526|Ga0073909_10262069 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 772 | Open in IMG/M |
| 3300005544|Ga0070686_100387491 | All Organisms → cellular organisms → Bacteria | 1059 | Open in IMG/M |
| 3300005545|Ga0070695_100739902 | All Organisms → cellular organisms → Bacteria | 783 | Open in IMG/M |
| 3300005548|Ga0070665_100533989 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1185 | Open in IMG/M |
| 3300005575|Ga0066702_10330863 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 927 | Open in IMG/M |
| 3300005578|Ga0068854_101644863 | All Organisms → cellular organisms → Bacteria | 586 | Open in IMG/M |
| 3300005617|Ga0068859_101243839 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 820 | Open in IMG/M |
| 3300005617|Ga0068859_102057592 | All Organisms → cellular organisms → Bacteria | 630 | Open in IMG/M |
| 3300005618|Ga0068864_101769394 | All Organisms → cellular organisms → Bacteria | 623 | Open in IMG/M |
| 3300005618|Ga0068864_102226561 | All Organisms → cellular organisms → Bacteria | 554 | Open in IMG/M |
| 3300005718|Ga0068866_10113430 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium KBS 83 | 1516 | Open in IMG/M |
| 3300005764|Ga0066903_104100083 | All Organisms → cellular organisms → Bacteria | 780 | Open in IMG/M |
| 3300005841|Ga0068863_101188883 | All Organisms → cellular organisms → Bacteria | 768 | Open in IMG/M |
| 3300005842|Ga0068858_100416508 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1292 | Open in IMG/M |
| 3300005844|Ga0068862_100748330 | All Organisms → cellular organisms → Bacteria | 951 | Open in IMG/M |
| 3300006028|Ga0070717_10640631 | All Organisms → cellular organisms → Bacteria | 965 | Open in IMG/M |
| 3300006175|Ga0070712_100740839 | All Organisms → cellular organisms → Bacteria | 840 | Open in IMG/M |
| 3300006358|Ga0068871_102339027 | All Organisms → cellular organisms → Bacteria | 509 | Open in IMG/M |
| 3300006844|Ga0075428_101301864 | Not Available | 764 | Open in IMG/M |
| 3300006854|Ga0075425_100391610 | All Organisms → cellular organisms → Bacteria | 1601 | Open in IMG/M |
| 3300006904|Ga0075424_101269782 | Not Available | 783 | Open in IMG/M |
| 3300009012|Ga0066710_100661657 | All Organisms → cellular organisms → Bacteria | 1590 | Open in IMG/M |
| 3300009094|Ga0111539_10729165 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium KBS 83 | 1154 | Open in IMG/M |
| 3300009094|Ga0111539_12687405 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 577 | Open in IMG/M |
| 3300009098|Ga0105245_12191067 | Not Available | 606 | Open in IMG/M |
| 3300009098|Ga0105245_12933831 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 529 | Open in IMG/M |
| 3300009147|Ga0114129_10249193 | All Organisms → cellular organisms → Bacteria | 2385 | Open in IMG/M |
| 3300009148|Ga0105243_10370492 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1321 | Open in IMG/M |
| 3300009148|Ga0105243_10832782 | All Organisms → cellular organisms → Bacteria | 912 | Open in IMG/M |
| 3300009156|Ga0111538_13958258 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 512 | Open in IMG/M |
| 3300009174|Ga0105241_10186643 | All Organisms → cellular organisms → Bacteria | 1724 | Open in IMG/M |
| 3300009174|Ga0105241_12141590 | Not Available | 553 | Open in IMG/M |
| 3300009174|Ga0105241_12589586 | All Organisms → cellular organisms → Bacteria | 509 | Open in IMG/M |
| 3300009176|Ga0105242_10219363 | All Organisms → cellular organisms → Bacteria | 1699 | Open in IMG/M |
| 3300009545|Ga0105237_10214220 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 1926 | Open in IMG/M |
| 3300009551|Ga0105238_12559699 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium KBS 83 | 546 | Open in IMG/M |
| 3300009792|Ga0126374_10845007 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 704 | Open in IMG/M |
| 3300010358|Ga0126370_10871316 | All Organisms → cellular organisms → Bacteria | 810 | Open in IMG/M |
| 3300010360|Ga0126372_12367204 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 581 | Open in IMG/M |
| 3300010366|Ga0126379_11873228 | Not Available | 703 | Open in IMG/M |
| 3300010375|Ga0105239_10213458 | All Organisms → cellular organisms → Bacteria | 2163 | Open in IMG/M |
| 3300010398|Ga0126383_11109055 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 881 | Open in IMG/M |
| 3300010398|Ga0126383_12171665 | Not Available | 642 | Open in IMG/M |
| 3300010399|Ga0134127_11725705 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 702 | Open in IMG/M |
| 3300010403|Ga0134123_10228382 | All Organisms → cellular organisms → Bacteria | 1604 | Open in IMG/M |
| 3300011119|Ga0105246_10131390 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1871 | Open in IMG/M |
| 3300012198|Ga0137364_11144648 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 584 | Open in IMG/M |
| 3300012199|Ga0137383_10018392 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 4814 | Open in IMG/M |
| 3300012207|Ga0137381_11307819 | All Organisms → cellular organisms → Bacteria | 618 | Open in IMG/M |
| 3300012355|Ga0137369_10769685 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 658 | Open in IMG/M |
| 3300012511|Ga0157332_1042899 | Not Available | 623 | Open in IMG/M |
| 3300012927|Ga0137416_10781254 | All Organisms → cellular organisms → Bacteria | 843 | Open in IMG/M |
| 3300012927|Ga0137416_11856050 | All Organisms → cellular organisms → Bacteria | 551 | Open in IMG/M |
| 3300012955|Ga0164298_10895296 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 645 | Open in IMG/M |
| 3300012971|Ga0126369_11929297 | All Organisms → cellular organisms → Bacteria | 679 | Open in IMG/M |
| 3300012971|Ga0126369_12035787 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 662 | Open in IMG/M |
| 3300012986|Ga0164304_10313882 | All Organisms → cellular organisms → Bacteria | 1080 | Open in IMG/M |
| 3300012987|Ga0164307_11024779 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium KBS 83 | 673 | Open in IMG/M |
| 3300013306|Ga0163162_10414832 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1479 | Open in IMG/M |
| 3300013306|Ga0163162_10870318 | All Organisms → cellular organisms → Bacteria | 1015 | Open in IMG/M |
| 3300013306|Ga0163162_11482369 | All Organisms → cellular organisms → Bacteria | 773 | Open in IMG/M |
| 3300013308|Ga0157375_10640366 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1220 | Open in IMG/M |
| 3300013308|Ga0157375_10788943 | All Organisms → cellular organisms → Bacteria | 1099 | Open in IMG/M |
| 3300013308|Ga0157375_11050226 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 952 | Open in IMG/M |
| 3300014497|Ga0182008_10689617 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 582 | Open in IMG/M |
| 3300014745|Ga0157377_10897950 | All Organisms → cellular organisms → Bacteria | 662 | Open in IMG/M |
| 3300014968|Ga0157379_10510687 | All Organisms → cellular organisms → Bacteria | 1115 | Open in IMG/M |
| 3300014969|Ga0157376_11083840 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 826 | Open in IMG/M |
| 3300015372|Ga0132256_100878328 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1013 | Open in IMG/M |
| 3300015372|Ga0132256_102294173 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_2_20CM_56_17 | 643 | Open in IMG/M |
| 3300015374|Ga0132255_101149359 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium KBS 83 | 1168 | Open in IMG/M |
| 3300015374|Ga0132255_105345799 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 543 | Open in IMG/M |
| 3300016357|Ga0182032_10073741 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium KBS 83 | 2317 | Open in IMG/M |
| 3300017792|Ga0163161_11610994 | All Organisms → cellular organisms → Bacteria | 573 | Open in IMG/M |
| 3300023263|Ga0247800_1081616 | Not Available | 633 | Open in IMG/M |
| 3300025912|Ga0207707_10583842 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium KBS 83 | 947 | Open in IMG/M |
| 3300025914|Ga0207671_10217042 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 1498 | Open in IMG/M |
| 3300025916|Ga0207663_10597938 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 866 | Open in IMG/M |
| 3300025917|Ga0207660_11742849 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium KBS 83 | 500 | Open in IMG/M |
| 3300025920|Ga0207649_11691088 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium KBS 83 | 501 | Open in IMG/M |
| 3300025923|Ga0207681_10347947 | All Organisms → cellular organisms → Bacteria | 1186 | Open in IMG/M |
| 3300025923|Ga0207681_10679135 | All Organisms → cellular organisms → Bacteria | 855 | Open in IMG/M |
| 3300025924|Ga0207694_11549897 | All Organisms → cellular organisms → Bacteria | 559 | Open in IMG/M |
| 3300025924|Ga0207694_11658411 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium KBS 83 | 538 | Open in IMG/M |
| 3300025926|Ga0207659_10249113 | All Organisms → cellular organisms → Bacteria | 1441 | Open in IMG/M |
| 3300025927|Ga0207687_10262273 | All Organisms → cellular organisms → Bacteria | 1378 | Open in IMG/M |
| 3300025927|Ga0207687_11768269 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 529 | Open in IMG/M |
| 3300025930|Ga0207701_10178371 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1875 | Open in IMG/M |
| 3300025931|Ga0207644_11763976 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 518 | Open in IMG/M |
| 3300025932|Ga0207690_11585851 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 547 | Open in IMG/M |
| 3300025935|Ga0207709_10300927 | All Organisms → cellular organisms → Bacteria | 1192 | Open in IMG/M |
| 3300025939|Ga0207665_10266612 | All Organisms → cellular organisms → Bacteria | 1270 | Open in IMG/M |
| 3300025939|Ga0207665_10651850 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_2_20CM_56_17 | 825 | Open in IMG/M |
| 3300025945|Ga0207679_11571231 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 603 | Open in IMG/M |
| 3300025949|Ga0207667_11223046 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_2_20CM_56_17 | 730 | Open in IMG/M |
| 3300025960|Ga0207651_10853727 | All Organisms → cellular organisms → Bacteria | 809 | Open in IMG/M |
| 3300026023|Ga0207677_10172957 | All Organisms → cellular organisms → Bacteria | 1691 | Open in IMG/M |
| 3300026089|Ga0207648_11480526 | Not Available | 638 | Open in IMG/M |
| 3300026548|Ga0209161_10385004 | All Organisms → cellular organisms → Bacteria | 618 | Open in IMG/M |
| 3300027765|Ga0209073_10454123 | All Organisms → cellular organisms → Bacteria | 534 | Open in IMG/M |
| 3300028379|Ga0268266_10451317 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1222 | Open in IMG/M |
| 3300030496|Ga0268240_10191893 | All Organisms → cellular organisms → Bacteria | 519 | Open in IMG/M |
| 3300031744|Ga0306918_10984679 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 655 | Open in IMG/M |
| 3300031854|Ga0310904_10793774 | All Organisms → cellular organisms → Bacteria | 662 | Open in IMG/M |
| 3300031908|Ga0310900_10905420 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 720 | Open in IMG/M |
| 3300032003|Ga0310897_10106104 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1124 | Open in IMG/M |
| 3300032008|Ga0318562_10624342 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 622 | Open in IMG/M |
| 3300032180|Ga0307471_103329103 | All Organisms → cellular organisms → Bacteria | 569 | Open in IMG/M |
| 3300033289|Ga0310914_10126703 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2229 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 6.82% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 6.82% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 6.82% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 6.06% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 6.06% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 5.30% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 5.30% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 4.55% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 3.79% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.03% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 3.03% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 3.03% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 3.03% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 2.27% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 2.27% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 2.27% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 2.27% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 2.27% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 2.27% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 2.27% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 2.27% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.52% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.52% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.52% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 1.52% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 1.52% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 0.76% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.76% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.76% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.76% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.76% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.76% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.76% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere | 0.76% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.76% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.76% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.76% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.76% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.76% |
| Switchgrass, Maize And Mischanthus Litter | Engineered → Solid Waste → Grass → Composting → Unclassified → Switchgrass, Maize And Mischanthus Litter | 0.76% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2170459016 | Litter degradation ZMR2 | Engineered | Open in IMG/M |
| 3300000043 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere | Host-Associated | Open in IMG/M |
| 3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000559 | Amended soil microbial communities from Kansas Great Prairies, USA - control no BrdU total DNA F1.4 TC clc assemly | Environmental | Open in IMG/M |
| 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Host-Associated | Open in IMG/M |
| 3300003994 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqA_D2 | Environmental | Open in IMG/M |
| 3300004156 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1 | Environmental | Open in IMG/M |
| 3300004281 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 30 MoBio | Environmental | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
| 3300005294 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk Soil | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Environmental | Open in IMG/M |
| 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Environmental | Open in IMG/M |
| 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Environmental | Open in IMG/M |
| 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Environmental | Open in IMG/M |
| 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Host-Associated | Open in IMG/M |
| 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Environmental | Open in IMG/M |
| 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
| 3300005526 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 | Environmental | Open in IMG/M |
| 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Environmental | Open in IMG/M |
| 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Environmental | Open in IMG/M |
| 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005575 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 | Environmental | Open in IMG/M |
| 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Host-Associated | Open in IMG/M |
| 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
| 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Host-Associated | Open in IMG/M |
| 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
| 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Host-Associated | Open in IMG/M |
| 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Host-Associated | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Host-Associated | Open in IMG/M |
| 3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
| 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
| 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Host-Associated | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012355 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaG | Environmental | Open in IMG/M |
| 3300012511 | Unplanted soil (control) microbial communities from North Carolina - M.Soil.8.old.080610_10 | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012955 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012986 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG | Environmental | Open in IMG/M |
| 3300012987 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MG | Environmental | Open in IMG/M |
| 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
| 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Host-Associated | Open in IMG/M |
| 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
| 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Host-Associated | Open in IMG/M |
| 3300023263 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S092-311B-6 | Environmental | Open in IMG/M |
| 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025930 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) | Environmental | Open in IMG/M |
| 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026548 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 (SPAdes) | Environmental | Open in IMG/M |
| 3300027765 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 (SPAdes) | Environmental | Open in IMG/M |
| 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300030496 | Bulk soil microbial communities from Mexico - Penjamo (Pe) metaG (v2) | Environmental | Open in IMG/M |
| 3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
| 3300031854 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D1 | Environmental | Open in IMG/M |
| 3300031908 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D1 | Environmental | Open in IMG/M |
| 3300032003 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D1 | Environmental | Open in IMG/M |
| 3300032008 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f18 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| 2ZMR_03789190 | 2170459016 | Switchgrass, Maize And Mischanthus Litter | GSFILIPAGAPHFVATRESPAVLQLSGTGKFHTDYVEK |
| ARcpr5yngRDRAFT_0190001 | 3300000043 | Arabidopsis Rhizosphere | PAGSFIVIPAGVPHFVAAKGGTVIIQLNGNGKFQTDYVEK* |
| INPhiseqgaiiFebDRAFT_1049906811 | 3300000364 | Soil | RRYPRGSFIVIPAGVPHFVAAENGPVVVQVSGTGRFHTDYLEK* |
| F14TC_1049790912 | 3300000559 | Soil | VIPAGVPHFAASKEGGVIVQLNGAGSFATEYLENE |
| JGI24739J22299_102667491 | 3300001989 | Corn Rhizosphere | STNLKGYPAGSFIVIPAGLPHFVATKESIAVVQLNGSGKFRTDYVEK* |
| Ga0055435_102217041 | 3300003994 | Natural And Restored Wetlands | PAGSFIVIPARVPHFVAARESGVIVQLCGTAKFSTDYLEK* |
| Ga0062589_1000141725 | 3300004156 | Soil | YPAHSFIVIPAGLPHFVATKEGAVVIQLSGVRKFETSYVEK* |
| Ga0066397_101605652 | 3300004281 | Tropical Forest Soil | YPAGSFIVIPAGVPHFVAAKDGNVIVQLYGNGKFHTDPVEK* |
| Ga0062595_1002991071 | 3300004479 | Soil | TRFDAAKLRGYPRGSFIVIPAGVPHFVAAEKGAVVVQVSGAGKFQTAYVEK* |
| Ga0062594_1024051121 | 3300005093 | Soil | GYGPGSFVIIPAGLPHFVAAKDGSVIVQVNGTGKFATDFLEK* |
| Ga0065705_100422691 | 3300005294 | Switchgrass Rhizosphere | QGYPAGSFIVIPAGTPHFVATNNGVVVVQLTGTEKFRTDYLEK* |
| Ga0066388_1040100631 | 3300005332 | Tropical Forest Soil | YTPGSFIVIPAGVPHFVATKESTVVVQLSGNGKFQTDYLEK* |
| Ga0066388_1087719541 | 3300005332 | Tropical Forest Soil | AYPAGSFILIPAGVPHFVGAIEGDVIIQLSGNGKFQTDYIEK* |
| Ga0070680_1003068301 | 3300005336 | Corn Rhizosphere | KLRAYPAGSFIVIPAGVPHFLATKAGPVIVQASGQGIFRTKYVEE* |
| Ga0070689_1021022701 | 3300005340 | Switchgrass Rhizosphere | YPAGSFIVIPAGVPHFVATRESSVIVQLNGNGKFRTDYVEE* |
| Ga0070673_1003397631 | 3300005364 | Switchgrass Rhizosphere | AGSFIVIPAGVPHFVATRESSVIVQLNGNGKFRTDYVEE* |
| Ga0070673_1019074111 | 3300005364 | Switchgrass Rhizosphere | EGEKFDIAKLKGYPAGSFIVIPSGVPHFVTAKDGSVVVQVSGIGKFNTDYLEK* |
| Ga0070701_102434691 | 3300005438 | Corn, Switchgrass And Miscanthus Rhizosphere | DSTKLKGYPAGTFIVIPAGVPHFVAAKDGAVIIQLEGNGKFQTDYVEQ* |
| Ga0070694_1013604972 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | NLKGYPAGSFIVIPAGLPHFVATKESIAVVQLNGSGKFRTDYVEK* |
| Ga0070663_1002272174 | 3300005455 | Corn Rhizosphere | AHSFIVIPAGLPHFVATKEGAVVIQLSGVRKFETSYVEK* |
| Ga0070685_109866462 | 3300005466 | Switchgrass Rhizosphere | GYAAGSFIVIPAGTPHFVAAESGAVVVQVSGTGTFQTEYVEK* |
| Ga0070699_1014187542 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | LKGYPAGSFIVIPAGVPHFVAAKDGAVIVQVSGKGKFGTDYLEK* |
| Ga0073909_102620692 | 3300005526 | Surface Soil | NLKAYPAGSFIDIPAGVPHFVAAKEGIVIVQLNGNGKFQTDSVEK* |
| Ga0070672_1001436503 | 3300005543 | Miscanthus Rhizosphere | GSFIVIPADVPHFLATKEGPVIVQPSGRGIFRTSPLEK* |
| Ga0070686_1003874911 | 3300005544 | Switchgrass Rhizosphere | YPAGSFIVIPADVPHFLATKEGPVIVQPSGRGIFRTNPLEK* |
| Ga0070695_1007399022 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | AKLKGYPAGSFIVIPAGTPHFVATKDSGVVVQLSGTVKFRTDYVER* |
| Ga0070665_1005339892 | 3300005548 | Switchgrass Rhizosphere | YAAGSFIVIPAGTPHFVAAESGAVVVQVSGTGTFQTEYVEK* |
| Ga0066702_103308631 | 3300005575 | Soil | YPAGSFIVIPAGVPHFVAARDGAVIVQISGSGKVGADYLEK* |
| Ga0068854_1016448632 | 3300005578 | Corn Rhizosphere | AGSFILIPAGLPHFVAAKHSPVVIQLSGNGKFGTDYLEK* |
| Ga0068859_1012438391 | 3300005617 | Switchgrass Rhizosphere | GSFIVIPAGTPHFVAAESGAVVVQVSGTGTFQTEYVEK* |
| Ga0068859_1020575922 | 3300005617 | Switchgrass Rhizosphere | FIVIPAGVPHFVAAPEGEVIVQISGDGPFRTEFVE* |
| Ga0068864_1017693941 | 3300005618 | Switchgrass Rhizosphere | IVIPAGVPHFLAAMDGAVIVQVSGTGRFATDYLEK* |
| Ga0068864_1022265611 | 3300005618 | Switchgrass Rhizosphere | YPAGSFILIPAGLPHFVAAKHSPVVIQLSGNGKFGTDYLEK* |
| Ga0068866_101134302 | 3300005718 | Miscanthus Rhizosphere | YPAGSFIVIPAGLPHFVATKESIAVVQLNGSGKFRTDYVEK* |
| Ga0066903_1041000832 | 3300005764 | Tropical Forest Soil | AGSFIVIPAGVPHFLAAKDGAVMVQLSGTGKFGTDYLEK* |
| Ga0068863_1011888832 | 3300005841 | Switchgrass Rhizosphere | PYPAGSFIVIPARVPHFVAAPEGEVIVQISGDGPFRTEILEK* |
| Ga0068858_1004165082 | 3300005842 | Switchgrass Rhizosphere | LFIVIPAGLPHFVAAKDDSVIVQVSGTGKFTTDFLEK* |
| Ga0068862_1007483301 | 3300005844 | Switchgrass Rhizosphere | FIVIPAGVPHFVAAPEGVVIVQISGDGPFRTDFLEK* |
| Ga0070717_106406311 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | KFNPTNLKRYPAGSFIVIPAGVPHFVATRESSVIVQLNGNGKFRTDYVEE* |
| Ga0070712_1007408392 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | KLKGYPAGSFIVIPAGTPHFVATKDSGVVVQLSGTVKFRTDYVER* |
| Ga0068871_1023390271 | 3300006358 | Miscanthus Rhizosphere | KAYPAGSFILIPAGLPHFVAAKDSPVVIQLSGNGKFGTDYLEK* |
| Ga0075428_1013018641 | 3300006844 | Populus Rhizosphere | HIPSDVAHFLATKEGPVIVQVSGHGLFRTKYVGK* |
| Ga0075425_1003916101 | 3300006854 | Populus Rhizosphere | PGSFILIPAGVPHFVAVKKGTVVVQLSGTGKFQTDYLEK* |
| Ga0075424_1012697821 | 3300006904 | Populus Rhizosphere | IIAAGVPHFVAAKEGAVVVQLSGSGKFQPDSLEK* |
| Ga0066710_1006616573 | 3300009012 | Grasslands Soil | PGSFVVIPAGVPHFVATKEETVVVQTSGHGLFRTDFLEK |
| Ga0111539_107291651 | 3300009094 | Populus Rhizosphere | SFDSTQLKGYPAGSFIVIPAGVPHFASAKDGAVIIQLEGNGKFQTDYVEQ* |
| Ga0111539_126874051 | 3300009094 | Populus Rhizosphere | SFIVIHARVPHFVAAEKGAVVVQVSGTGKFQTEYLEK* |
| Ga0105245_121910672 | 3300009098 | Miscanthus Rhizosphere | SAGSFIVIPADVAHFLATREGPVIVQVSGHGMFRTHYVGK* |
| Ga0105245_129338312 | 3300009098 | Miscanthus Rhizosphere | FIVIPAGMPHFVAAPEGEVIVQISGDGPFRTEFVE* |
| Ga0114129_102491933 | 3300009147 | Populus Rhizosphere | GSFIFIPADVPHFLATKKEPVIVQVSGHGLFRTNYLQR* |
| Ga0105243_103704922 | 3300009148 | Miscanthus Rhizosphere | KAYPAGSFIVIPAGTPHFVATKDSAVVVQLSGTEKFRTDYVEK* |
| Ga0105243_108327821 | 3300009148 | Miscanthus Rhizosphere | LKGYPAGSFILIPAGVPHFVAARDGSVIVQLNGDGKFGTDYLEK* |
| Ga0111538_139582581 | 3300009156 | Populus Rhizosphere | IVIHARVPHFVAAEKGAVVVQVSGTGKFQTEYLEK* |
| Ga0105241_101866433 | 3300009174 | Corn Rhizosphere | SFIVIPAGVPHFVAAKDGAVIIQLEGNGKFQTDYVEQ* |
| Ga0105241_121415901 | 3300009174 | Corn Rhizosphere | SFIVIPASIPHFVAAKEGIVVVQLSGTGRFQTEYLEQ* |
| Ga0105241_125895862 | 3300009174 | Corn Rhizosphere | AGSFILIPAGLPHFVAAKDSPVVIQLSGNGKFGTDYLEK* |
| Ga0105242_102193631 | 3300009176 | Miscanthus Rhizosphere | PAGSFIVIPAGVPHFVAAKDGAVIIQLEGNGKFQTDYVEQ* |
| Ga0105237_102142205 | 3300009545 | Corn Rhizosphere | LKPYPAGSFIVIPAGVPHFVAAPEGVVIVQISGDGPFRTDFLEK* |
| Ga0105238_125596991 | 3300009551 | Corn Rhizosphere | KLKGYPAGSFILIPAGVPHFVATKKDPVVVQLNGNGKFQTDYVEE* |
| Ga0126374_108450071 | 3300009792 | Tropical Forest Soil | LKGYPAGSFIVIPAHVPHFVAAKEGSVIIQLNGNGKFQTDYLEK* |
| Ga0126370_108713161 | 3300010358 | Tropical Forest Soil | PAGSFIVIPAEVTHFLATRKDAAVVQVSGHGIFRTKYLER* |
| Ga0126372_123672042 | 3300010360 | Tropical Forest Soil | YPAGSFIVIPAGVPHFVAAREGAVVVQLSGNGKFETIPLEK* |
| Ga0126379_118732282 | 3300010366 | Tropical Forest Soil | IVIPAGVRHFIAAKEGAVIIQLYGDGKFHTDYVEK* |
| Ga0105239_102134581 | 3300010375 | Corn Rhizosphere | SFIVIPAGVPHFVAAKDGSVIVQVGGTGKFVTDYLEK* |
| Ga0126383_111090551 | 3300010398 | Tropical Forest Soil | GYPAGSFIVIPAGVPHFVATKEGMVIIQLNGNGKFQTDYVEK* |
| Ga0126383_121716651 | 3300010398 | Tropical Forest Soil | KGYPAGSFVSIPAGLSHFVAAMESPVIVHLSGGEKFRTVYVEK* |
| Ga0134127_117257052 | 3300010399 | Terrestrial Soil | VIIPAGLPHFVAAKDGSVIVQVNGTGKFATDFLEK* |
| Ga0134123_102283822 | 3300010403 | Terrestrial Soil | PAGSFIVIPANMPHFLATKEGPVIVQPSGRGIFRTNPLEK* |
| Ga0105246_101313903 | 3300011119 | Miscanthus Rhizosphere | AYPAGSFIVIPAGTPHFVATKDSAVVVQLSGTEKFRTDYVEK* |
| Ga0137364_111446481 | 3300012198 | Vadose Zone Soil | SFIVSPAGVPHFVAAKDGAVIIQLEGNGKFQTDYVEQ* |
| Ga0137383_100183921 | 3300012199 | Vadose Zone Soil | KGYPAGSFIVIPAGVPHFVAAKDGAVIVQVSSVGKFVTDYLEK* |
| Ga0137381_113078192 | 3300012207 | Vadose Zone Soil | KLKGYPAGSFTVTPAGVPHVVAAKDGAVIVQVSGVGKFVTDYLEK* |
| Ga0137369_107696852 | 3300012355 | Vadose Zone Soil | LGEGTKFDPTTLKAYPAGSFILIPAGVPHLVATKEDAVIIQLSGNGKFQTDYVEK* |
| Ga0157332_10428992 | 3300012511 | Soil | FIVIPPDVPHFLATKEGPVIVQPSGRGIFRTNPLEK* |
| Ga0137416_107812543 | 3300012927 | Vadose Zone Soil | IIPAGVPHFVATKEGPVIVQLNGTAKWDTHYIEK* |
| Ga0137416_118560501 | 3300012927 | Vadose Zone Soil | SFIMIPAGVPHFVATKEGPVVGQLNGTGKWDTHYIEK* |
| Ga0164298_108952961 | 3300012955 | Soil | KGYPAGSFIVIPAGVPHFVAAKGGTVIIQLNGNGKFQTDYVEK* |
| Ga0126369_119292972 | 3300012971 | Tropical Forest Soil | GEGTKFNATNLKGYPAGSFIVIPAGVPHFVAAKEGAVIVQLYGNGKFQTDYVEK* |
| Ga0126369_120357872 | 3300012971 | Tropical Forest Soil | IVIPAGVPHFMAAKDGGVIVQPSGTGKFGTDYLEK* |
| Ga0164304_103138821 | 3300012986 | Soil | KLRGYPRGSFIVIPASVPHFVAAEKGAVVVQVSGAGKFQTAYVEK* |
| Ga0164307_110247791 | 3300012987 | Soil | FDLTNLKGYPAGSFIVIPAGVAHFVAAKDGIVIVQLNGNGKFHTDYLEK* |
| Ga0163162_104148321 | 3300013306 | Switchgrass Rhizosphere | IVIPAGTPHFVATKDGPVIVQLTGTEEFRTDYLEK* |
| Ga0163162_108703181 | 3300013306 | Switchgrass Rhizosphere | GTKFDSARLKSYPAHSFIVIPAGLPHFVATKEGAVVIQLSGVRKFETSYVEK* |
| Ga0163162_114823691 | 3300013306 | Switchgrass Rhizosphere | LKGYPAGSFIVIPSGVPHFVAAKDGSVVVQVSGIGKFNTDYLEK* |
| Ga0157375_106403661 | 3300013308 | Miscanthus Rhizosphere | SARLKSYPAHSFIVIPAGLPHFVATKEGAVVIQLSGVRKFETSYVEK* |
| Ga0157375_107889433 | 3300013308 | Miscanthus Rhizosphere | AYPAGSFIVIPAGVPHFLATKAGPVIVQASGQGIFRTKYVEE* |
| Ga0157375_110502263 | 3300013308 | Miscanthus Rhizosphere | LKGYPAGSFIVIPAGVPHFVAAKNGSVIVQINGTGKFATDYLEK* |
| Ga0182008_106896172 | 3300014497 | Rhizosphere | RGYPSGSFIVIPAGVAHFVAAKESAVVVQLNGTGKFGTDYLER* |
| Ga0157377_108979502 | 3300014745 | Miscanthus Rhizosphere | GYPAGSFIVIPAGVPHFLAAMNGPVIVQVSGTGRFATDYLEK* |
| Ga0157379_105106873 | 3300014968 | Switchgrass Rhizosphere | FIVIPAGVPHFLATKAGPVIVQASGQGMFRTKYVEE* |
| Ga0157376_110838402 | 3300014969 | Miscanthus Rhizosphere | GSFILIPAGVPHFVAATEGDVIIQLSGNRKFQTDYVEQ* |
| Ga0132256_1008783283 | 3300015372 | Arabidopsis Rhizosphere | FKSANLKAYPAGSFILIPAGVPHFVTATDSDVIIQLSGNGKFHTDYVEK* |
| Ga0132256_1022941731 | 3300015372 | Arabidopsis Rhizosphere | YPAGSFIVIPAGVPHFVAANDGTVVVQLSGTRKFQTDYLEK* |
| Ga0132255_1011493593 | 3300015374 | Arabidopsis Rhizosphere | SFIVIPAGVPHFVAAKDGAVTIQLEGNGKFQTDYVEQ* |
| Ga0132255_1053457992 | 3300015374 | Arabidopsis Rhizosphere | FVVVPAGVPHFVAAKDGSVIVQVSGTGKFGTDYLEK* |
| Ga0182032_100737413 | 3300016357 | Soil | GSFVVIPAGVPHFVATKDGTVVVQLSGVRKFQTDYVEEYR |
| Ga0163161_116109941 | 3300017792 | Switchgrass Rhizosphere | FIVIPAGVPHFVAAKNGSVIVQINGTGKFATDYLEK |
| Ga0247800_10816161 | 3300023263 | Soil | IVIPAGTPHFVAAESGAVVVQVSGTGTFQTEYVEK |
| Ga0207707_105838422 | 3300025912 | Corn Rhizosphere | SSEGTKFNSTNLKGYPAGSFIVIPAGLPHFVATKESIAVVQLNGSGKFRTDYVEK |
| Ga0207671_102170424 | 3300025914 | Corn Rhizosphere | LKPYPAGSFIVIPAGVPHFVAAPEGVVIVQISGDGPFRTDFLEK |
| Ga0207663_105979381 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | TKLIGYPAGSFIVVPAGVPHFVGAKDGAVIIQLEGNGKFQTDYVEQ |
| Ga0207660_117428491 | 3300025917 | Corn Rhizosphere | KFNSTKLKGYPAGSFILIPAGVPHFVATKKDPVVVQLNGNGKFQTDYVEE |
| Ga0207649_116910881 | 3300025920 | Corn Rhizosphere | QRFDPLKLKSYPAGSFIVVPAGVAHFASAKDGDVVVQLNGTEKFGTDYLEK |
| Ga0207681_103479472 | 3300025923 | Switchgrass Rhizosphere | LKPYPAGSFIVIPAGVPHFVAAPKGEVIVQISGDGPFRTEILEK |
| Ga0207681_106791352 | 3300025923 | Switchgrass Rhizosphere | KAYPAGSFIVIPADVPHFLATKEGPVIVQPSGRGIFRTNPLEK |
| Ga0207694_115498972 | 3300025924 | Corn Rhizosphere | PAGSFIVIPAGVPHFVATRESSVIVQLNGNGKFRTDYVEE |
| Ga0207694_116584111 | 3300025924 | Corn Rhizosphere | KGYPAGSFILIPAGVPHFVATKKDPVVVQLNGNGKFQTDYVEE |
| Ga0207659_102491131 | 3300025926 | Miscanthus Rhizosphere | AGSFIVIPAGVPHFLATKEGPVIVQVSGHGVFRTNYVEK |
| Ga0207687_102622731 | 3300025927 | Miscanthus Rhizosphere | AHSFIVIPAGLPHFVATKEGAVVIQLSGVRKFETSYVEK |
| Ga0207687_117682691 | 3300025927 | Miscanthus Rhizosphere | FIVIPAGMPHFVAAPEGEVIVQISGDGPFRTEFVE |
| Ga0207701_101783713 | 3300025930 | Corn, Switchgrass And Miscanthus Rhizosphere | VTTSIVIPAGTPHFVAAESGAVVVQVSGTGTFQTEYVEK |
| Ga0207644_117639761 | 3300025931 | Switchgrass Rhizosphere | GYPAGSFIVIPAALPHFVATKESIAVVQLNGSGKFRTDYVEK |
| Ga0207690_115858511 | 3300025932 | Corn Rhizosphere | GSFIVIPAGLPHFVATKESIAVVQLNGSGKFRTDYVEK |
| Ga0207709_103009274 | 3300025935 | Miscanthus Rhizosphere | AGSFILIPAGVPHFVAARDGSVIVQLNGDGKFGTDYLEK |
| Ga0207665_102666122 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | EGTKFDSTTLKAYPAGSFILIPAGVPHFVATKENAAIIQLSGNGKFQTDYVEK |
| Ga0207665_106518502 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | KLKRYPAGSFIVIPAGVPHFVAANDGTVVVQLSGTRKFQTDYLEK |
| Ga0207679_115712312 | 3300025945 | Corn Rhizosphere | GSFIVIPAGTPHFVAAESGAVVVQVSGTGTFQTEYVEK |
| Ga0207667_112230462 | 3300025949 | Corn Rhizosphere | FDPAKLKRYPAGSFIVIPAGVPHFVAANEGTVVVQLTGTRKFQTDYLEK |
| Ga0207651_108537271 | 3300025960 | Switchgrass Rhizosphere | IPAGTPHFVAANDGVVVVQLSGTEKFRTDYLEKSQP |
| Ga0207677_101729571 | 3300026023 | Miscanthus Rhizosphere | GSFILIPAGLPHFVAAKHSPVVIQLSGNGKFGTDYLEK |
| Ga0207648_114805261 | 3300026089 | Miscanthus Rhizosphere | PAGIFIVIPAVMPHFVAAPEGEVIVQISGDGPFRTEFVE |
| Ga0209161_103850042 | 3300026548 | Soil | PAGSFILIPAGVPHFVAAMDGTVIIQLSGNGKFQTDYVEK |
| Ga0209073_104541232 | 3300027765 | Agricultural Soil | SFIVIPAGVPHFVAAKDGPVIVQLGGTTKFSTEYVEK |
| Ga0268266_104513171 | 3300028379 | Switchgrass Rhizosphere | KLRGYAAGSFIVIPAGTPHFVAAESGAVVVQVSGTGTFQTEYVEK |
| Ga0268240_101918932 | 3300030496 | Soil | KGYPAGSFVVIPAGVPHFVTAQEGAVIVQISGTGKFGTDYLEK |
| Ga0306918_109846791 | 3300031744 | Soil | AKLTGYPAGSFVVIPAGVPHFVATKDGTVVVQLSGVRKFQTDYVEEYR |
| Ga0310904_107937742 | 3300031854 | Soil | TKLKPYPAGSFILIPADVPHFLATREGPVIVQASGRGMFRTTYLEK |
| Ga0310900_109054202 | 3300031908 | Soil | FDVAKLTAYPSGSFIVIHARVPHFVAAEKGAVVVQVSGTGKFQTEYLEK |
| Ga0310897_101061041 | 3300032003 | Soil | PAGSFIVIPAGVPHFLATKAGPVIVQASGQGMFRTKYVEE |
| Ga0318562_106243421 | 3300032008 | Soil | FVVIPAGVPHFVATKDGTVVVQLSGVRKFQTDYVEEYR |
| Ga0307471_1033291031 | 3300032180 | Hardwood Forest Soil | AGSFILIPAGVPHFVAATEGDVIIQLSGNGKFQTDYVEQ |
| Ga0310914_101267032 | 3300033289 | Soil | AGSFVVIPAGVPHFVATKDGTVVVQLSGVRKFQTDYVEEYR |
| ⦗Top⦘ |