NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F061115

Metagenome / Metatranscriptome Family F061115

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F061115
Family Type Metagenome / Metatranscriptome
Number of Sequences 132
Average Sequence Length 57 residues
Representative Sequence MPAIPKTELRTTTRGLKVCRIACMILLGATLAGCDKCGGWLMQGESQVCREQAPRPQ
Number of Associated Samples 123
Number of Associated Scaffolds 132

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 62.60 %
% of genes near scaffold ends (potentially truncated) 39.39 %
% of genes from short scaffolds (< 2000 bps) 90.15 %
Associated GOLD sequencing projects 114
AlphaFold2 3D model prediction No

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (98.485 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil
(20.454 % of family members)
Environment Ontology (ENVO) Unclassified
(38.636 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(59.848 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: Yes Secondary Structure distribution: α-helix: 45.61%    β-sheet: 0.00%    Coil/Unstructured: 54.39%
Feature Viewer
Powered by Feature Viewer


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 132 Family Scaffolds
PF04055Radical_SAM 6.82
PF00596Aldolase_II 4.55
PF01904DUF72 2.27
PF08240ADH_N 0.76

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 132 Family Scaffolds
COG1801Sugar isomerase-related protein YecE, UPF0759/DUF72 familyGeneral function prediction only [R] 2.27


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms98.48 %
UnclassifiedrootN/A1.52 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2199352025|deepsgr__Contig_186678All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria601Open in IMG/M
3300001991|JGI24743J22301_10017681All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1341Open in IMG/M
3300002075|JGI24738J21930_10112452All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860587Open in IMG/M
3300002239|JGI24034J26672_10123399All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria503Open in IMG/M
3300002244|JGI24742J22300_10009409All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1612Open in IMG/M
3300002568|C688J35102_119835495All Organisms → cellular organisms → Bacteria → Proteobacteria788Open in IMG/M
3300002568|C688J35102_120487279All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1109Open in IMG/M
3300004463|Ga0063356_105708716All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales534Open in IMG/M
3300004463|Ga0063356_105748396All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae532Open in IMG/M
3300004479|Ga0062595_100838877All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria764Open in IMG/M
3300004479|Ga0062595_101624342All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales604Open in IMG/M
3300005093|Ga0062594_101969122All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae623Open in IMG/M
3300005163|Ga0066823_10035015All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales851Open in IMG/M
3300005169|Ga0066810_10024622All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC68601032Open in IMG/M
3300005327|Ga0070658_11315030All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria628Open in IMG/M
3300005335|Ga0070666_10869840All Organisms → cellular organisms → Bacteria → Proteobacteria666Open in IMG/M
3300005336|Ga0070680_100405104All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1163Open in IMG/M
3300005338|Ga0068868_100588322All Organisms → cellular organisms → Bacteria → Proteobacteria985Open in IMG/M
3300005339|Ga0070660_101093805All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860675Open in IMG/M
3300005340|Ga0070689_100269371All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1410Open in IMG/M
3300005341|Ga0070691_10152450All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC68601186Open in IMG/M
3300005345|Ga0070692_10576856All Organisms → cellular organisms → Bacteria → Proteobacteria741Open in IMG/M
3300005367|Ga0070667_102352399All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria502Open in IMG/M
3300005436|Ga0070713_100586355All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC68601058Open in IMG/M
3300005441|Ga0070700_101022420All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales681Open in IMG/M
3300005445|Ga0070708_100738212All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860926Open in IMG/M
3300005535|Ga0070684_100068387All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales3121Open in IMG/M
3300005543|Ga0070672_100490504All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC68601062Open in IMG/M
3300005544|Ga0070686_100217562All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1379Open in IMG/M
3300005546|Ga0070696_100908534All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860731Open in IMG/M
3300005548|Ga0070665_100603632All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1110Open in IMG/M
3300005564|Ga0070664_101251082All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales701Open in IMG/M
3300005615|Ga0070702_100305872All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC68601102Open in IMG/M
3300005719|Ga0068861_102522992All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales518Open in IMG/M
3300005843|Ga0068860_100873428All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860915Open in IMG/M
3300005843|Ga0068860_101207036All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria777Open in IMG/M
3300006028|Ga0070717_11047742All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860743Open in IMG/M
3300006038|Ga0075365_10055800All Organisms → cellular organisms → Bacteria → Proteobacteria2624Open in IMG/M
3300006038|Ga0075365_10544767All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860821Open in IMG/M
3300006058|Ga0075432_10502738All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860540Open in IMG/M
3300006175|Ga0070712_101287818All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria637Open in IMG/M
3300006196|Ga0075422_10161370All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales902Open in IMG/M
3300006237|Ga0097621_100677850All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860948Open in IMG/M
3300006576|Ga0074047_12058354All Organisms → cellular organisms → Bacteria → Proteobacteria1108Open in IMG/M
3300006578|Ga0074059_10010745All Organisms → cellular organisms → Bacteria → Proteobacteria916Open in IMG/M
3300006580|Ga0074049_13003145All Organisms → cellular organisms → Bacteria → Proteobacteria692Open in IMG/M
3300006845|Ga0075421_100616284All Organisms → cellular organisms → Bacteria → Proteobacteria1273Open in IMG/M
3300006852|Ga0075433_11834227All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860521Open in IMG/M
3300006880|Ga0075429_100497103All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1069Open in IMG/M
3300009011|Ga0105251_10416962All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860619Open in IMG/M
3300009036|Ga0105244_10550787All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860531Open in IMG/M
3300009092|Ga0105250_10324030All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales670Open in IMG/M
3300009098|Ga0105245_12804151All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860540Open in IMG/M
3300009148|Ga0105243_10157055All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1957Open in IMG/M
3300009148|Ga0105243_10918033All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria872Open in IMG/M
3300009156|Ga0111538_10083644All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales4060Open in IMG/M
3300009545|Ga0105237_10269977All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae1704Open in IMG/M
3300010036|Ga0126305_10735150All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860668Open in IMG/M
3300010040|Ga0126308_10490150All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860829Open in IMG/M
3300010373|Ga0134128_10125749All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC68602905Open in IMG/M
3300011119|Ga0105246_10357602All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1199Open in IMG/M
3300011119|Ga0105246_10419951Not Available1116Open in IMG/M
3300012469|Ga0150984_114661227All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860513Open in IMG/M
3300012895|Ga0157309_10231536All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria594Open in IMG/M
3300012910|Ga0157308_10345335All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860560Open in IMG/M
3300012911|Ga0157301_10121981All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales795Open in IMG/M
3300012914|Ga0157297_10141410All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales774Open in IMG/M
3300012915|Ga0157302_10351319All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860591Open in IMG/M
3300012951|Ga0164300_10801585All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860584Open in IMG/M
3300012955|Ga0164298_11182636All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860578Open in IMG/M
3300012958|Ga0164299_10679375All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860717Open in IMG/M
3300012986|Ga0164304_10279642All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1133Open in IMG/M
3300012989|Ga0164305_10257227All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC68601265Open in IMG/M
3300013102|Ga0157371_11006133All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria636Open in IMG/M
3300013105|Ga0157369_11561159All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860671Open in IMG/M
3300013307|Ga0157372_12034861All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria660Open in IMG/M
3300014968|Ga0157379_10912099All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860834Open in IMG/M
3300015201|Ga0173478_10552535All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860588Open in IMG/M
3300015371|Ga0132258_13753542All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC68601035Open in IMG/M
3300015374|Ga0132255_102209076All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales839Open in IMG/M
3300017792|Ga0163161_10836378All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860776Open in IMG/M
3300017965|Ga0190266_10594439All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860668Open in IMG/M
3300018000|Ga0184604_10062874All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC68601061Open in IMG/M
3300018066|Ga0184617_1094997All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860826Open in IMG/M
3300018469|Ga0190270_10870119All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860916Open in IMG/M
3300019362|Ga0173479_10429436All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860646Open in IMG/M
3300020005|Ga0193697_1056755All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales970Open in IMG/M
3300021082|Ga0210380_10010290All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales3898Open in IMG/M
3300024055|Ga0247794_10289788All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860549Open in IMG/M
3300025321|Ga0207656_10335706All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales753Open in IMG/M
3300025899|Ga0207642_10302789All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales927Open in IMG/M
3300025900|Ga0207710_10217914All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales947Open in IMG/M
3300025911|Ga0207654_11198537All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860553Open in IMG/M
3300025918|Ga0207662_10275694All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1111Open in IMG/M
3300025919|Ga0207657_10110782All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales2267Open in IMG/M
3300025924|Ga0207694_10837324All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria777Open in IMG/M
3300025925|Ga0207650_10003604All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales10627Open in IMG/M
3300025930|Ga0207701_11259779All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales608Open in IMG/M
3300025932|Ga0207690_10030272All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC68603450Open in IMG/M
3300025933|Ga0207706_10453599All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC68601109Open in IMG/M
3300025936|Ga0207670_10067460All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales2461Open in IMG/M
3300025937|Ga0207669_11162590All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria653Open in IMG/M
3300025940|Ga0207691_10004035All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales14229Open in IMG/M
3300025941|Ga0207711_10423625All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1238Open in IMG/M
3300026023|Ga0207677_10565127All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860993Open in IMG/M
3300026067|Ga0207678_10230163All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC68601587Open in IMG/M
3300027383|Ga0209213_1009327All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1765Open in IMG/M
3300027388|Ga0208995_1001369All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales3839Open in IMG/M
3300027523|Ga0208890_1001679All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales2254Open in IMG/M
3300027909|Ga0209382_10987356All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860879Open in IMG/M
3300028381|Ga0268264_10972437All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae855Open in IMG/M
3300028381|Ga0268264_11602559All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria662Open in IMG/M
3300028587|Ga0247828_10352346All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860831Open in IMG/M
3300028592|Ga0247822_11042716All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria677Open in IMG/M
3300028710|Ga0307322_10113119All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860705Open in IMG/M
3300028712|Ga0307285_10020091All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1531Open in IMG/M
3300028713|Ga0307303_10112199All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860632Open in IMG/M
3300028718|Ga0307307_10214158All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860611Open in IMG/M
3300028721|Ga0307315_10116314All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria796Open in IMG/M
3300028782|Ga0307306_10011318All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1914Open in IMG/M
3300028796|Ga0307287_10160201All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860855Open in IMG/M
3300028810|Ga0307294_10018947All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1793Open in IMG/M
3300028819|Ga0307296_10520261All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria651Open in IMG/M
3300028875|Ga0307289_10118477All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1084Open in IMG/M
3300031184|Ga0307499_10043907All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1070Open in IMG/M
3300031184|Ga0307499_10303224All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria527Open in IMG/M
3300031547|Ga0310887_10491223All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860738Open in IMG/M
3300031847|Ga0310907_10425492All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860697Open in IMG/M
3300031854|Ga0310904_11100895All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860569Open in IMG/M
3300031944|Ga0310884_10999997All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria520Open in IMG/M
3300032174|Ga0307470_10256294All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1159Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil20.45%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere6.82%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil5.30%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere5.30%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere5.30%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil4.55%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere4.55%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere3.79%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere3.03%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere3.03%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere3.03%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil2.27%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere2.27%
Corn, Switchgrass And Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere2.27%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere2.27%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere2.27%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere2.27%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment1.52%
Serpentine SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil1.52%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil1.52%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil1.52%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere1.52%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere1.52%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere1.52%
Arabidopsis Thaliana RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere1.52%
Populus EndosphereHost-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere1.52%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment0.76%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil0.76%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.76%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere0.76%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil0.76%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere0.76%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.76%
Miscanthus RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere0.76%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.76%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere0.76%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2199352025Soil microbial communities from Rothamsted, UK, for project Deep Soil - DEEP SOILEnvironmentalOpen in IMG/M
3300001991Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2Host-AssociatedOpen in IMG/M
3300002075Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4Host-AssociatedOpen in IMG/M
3300002239Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2Host-AssociatedOpen in IMG/M
3300002244Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1Host-AssociatedOpen in IMG/M
3300002568Grasslands soil microbial communities from Hopland, California, USA - 2EnvironmentalOpen in IMG/M
3300004463Combined assembly of Arabidopsis thaliana microbial communitiesHost-AssociatedOpen in IMG/M
3300004479Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAsEnvironmentalOpen in IMG/M
3300005093Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All BlocksEnvironmentalOpen in IMG/M
3300005163Soil and rhizosphere microbial communities from Laval, Canada - mgHMBEnvironmentalOpen in IMG/M
3300005169Soil and rhizosphere microbial communities from Laval, Canada - mgHPAEnvironmentalOpen in IMG/M
3300005327Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaGHost-AssociatedOpen in IMG/M
3300005335Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaGHost-AssociatedOpen in IMG/M
3300005336Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaGEnvironmentalOpen in IMG/M
3300005338Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2Host-AssociatedOpen in IMG/M
3300005339Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaGHost-AssociatedOpen in IMG/M
3300005340Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaGEnvironmentalOpen in IMG/M
3300005341Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaGEnvironmentalOpen in IMG/M
3300005345Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaGEnvironmentalOpen in IMG/M
3300005367Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaGHost-AssociatedOpen in IMG/M
3300005436Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaGEnvironmentalOpen in IMG/M
3300005441Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaGEnvironmentalOpen in IMG/M
3300005445Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaGEnvironmentalOpen in IMG/M
3300005535Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaGEnvironmentalOpen in IMG/M
3300005543Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaGHost-AssociatedOpen in IMG/M
3300005544Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaGEnvironmentalOpen in IMG/M
3300005546Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaGEnvironmentalOpen in IMG/M
3300005548Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaGHost-AssociatedOpen in IMG/M
3300005564Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaGHost-AssociatedOpen in IMG/M
3300005615Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaGEnvironmentalOpen in IMG/M
3300005719Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2Host-AssociatedOpen in IMG/M
3300005843Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2Host-AssociatedOpen in IMG/M
3300006028Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaGEnvironmentalOpen in IMG/M
3300006038Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5Host-AssociatedOpen in IMG/M
3300006058Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1Host-AssociatedOpen in IMG/M
3300006175Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaGEnvironmentalOpen in IMG/M
3300006196Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1Host-AssociatedOpen in IMG/M
3300006237Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2)Host-AssociatedOpen in IMG/M
3300006576Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLPA (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006578Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLMA (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006580Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLPC (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006845Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5Host-AssociatedOpen in IMG/M
3300006852Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2Host-AssociatedOpen in IMG/M
3300006880Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3Host-AssociatedOpen in IMG/M
3300009011Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaGHost-AssociatedOpen in IMG/M
3300009036Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaGHost-AssociatedOpen in IMG/M
3300009092Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaGHost-AssociatedOpen in IMG/M
3300009098Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaGHost-AssociatedOpen in IMG/M
3300009148Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaGHost-AssociatedOpen in IMG/M
3300009156Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009545Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaGHost-AssociatedOpen in IMG/M
3300010036Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot26EnvironmentalOpen in IMG/M
3300010040Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot55EnvironmentalOpen in IMG/M
3300010373Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4EnvironmentalOpen in IMG/M
3300011119Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaGHost-AssociatedOpen in IMG/M
3300012212Combined assembly of Hopland grassland soilHost-AssociatedOpen in IMG/M
3300012469Combined assembly of Soil carbon rhizosphereHost-AssociatedOpen in IMG/M
3300012895Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S208-509C-2EnvironmentalOpen in IMG/M
3300012910Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S198-509B-2EnvironmentalOpen in IMG/M
3300012911Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S088-202R-2EnvironmentalOpen in IMG/M
3300012914Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S028-104C-2EnvironmentalOpen in IMG/M
3300012915Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S103-311B-2EnvironmentalOpen in IMG/M
3300012951Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MGEnvironmentalOpen in IMG/M
3300012955Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MGEnvironmentalOpen in IMG/M
3300012958Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MGEnvironmentalOpen in IMG/M
3300012986Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MGEnvironmentalOpen in IMG/M
3300012989Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MGEnvironmentalOpen in IMG/M
3300013102Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaGHost-AssociatedOpen in IMG/M
3300013105Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaGHost-AssociatedOpen in IMG/M
3300013307Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaGHost-AssociatedOpen in IMG/M
3300014968Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaGHost-AssociatedOpen in IMG/M
3300015201Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S014-104B-1 (version 2)EnvironmentalOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300017792Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaGHost-AssociatedOpen in IMG/M
3300017965Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 220 TEnvironmentalOpen in IMG/M
3300018000Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_5_coexEnvironmentalOpen in IMG/M
3300018066Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_5_b1EnvironmentalOpen in IMG/M
3300018469Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 TEnvironmentalOpen in IMG/M
3300019362Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S104-311B-1 (version 2)EnvironmentalOpen in IMG/M
3300020005Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3m2EnvironmentalOpen in IMG/M
3300021082Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_coex redoEnvironmentalOpen in IMG/M
3300024055Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S046-202B-6EnvironmentalOpen in IMG/M
3300025321Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025899Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025900Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025911Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025918Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025919Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025924Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025925Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025930Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes)EnvironmentalOpen in IMG/M
3300025932Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025933Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025936Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025937Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025940Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025941Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026023Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026067Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300027383Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM1_M2 (SPAdes)EnvironmentalOpen in IMG/M
3300027388Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM2_O2 (SPAdes)EnvironmentalOpen in IMG/M
3300027523Soil and rhizosphere microbial communities from Laval, Canada - mgHPA (SPAdes)EnvironmentalOpen in IMG/M
3300027909Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes)Host-AssociatedOpen in IMG/M
3300028381Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300028587Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day3EnvironmentalOpen in IMG/M
3300028592Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Cellulose_Day30EnvironmentalOpen in IMG/M
3300028710Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_380EnvironmentalOpen in IMG/M
3300028712Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_139EnvironmentalOpen in IMG/M
3300028713Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_184EnvironmentalOpen in IMG/M
3300028718Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_194EnvironmentalOpen in IMG/M
3300028721Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_355EnvironmentalOpen in IMG/M
3300028782Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_193EnvironmentalOpen in IMG/M
3300028796Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_141EnvironmentalOpen in IMG/M
3300028810Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_151EnvironmentalOpen in IMG/M
3300028819Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_153EnvironmentalOpen in IMG/M
3300028875Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_143EnvironmentalOpen in IMG/M
3300031184Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 13_SEnvironmentalOpen in IMG/M
3300031547Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D4EnvironmentalOpen in IMG/M
3300031847Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D4EnvironmentalOpen in IMG/M
3300031854Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D1EnvironmentalOpen in IMG/M
3300031944Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D1EnvironmentalOpen in IMG/M
3300032174Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
deepsgr_032083902199352025SoilMPAIPKTELRTTTRGLKVCRIACMILFGATLAGCDKCGGWLMQGESQVCREQAPRPQ
JGI24743J22301_1001768133300001991Corn, Switchgrass And Miscanthus RhizosphereMPAIPKTELRTTTRGLKVCRIACMILFGATLAGCDKCGGWLMQGESQVCREQAPXPQ*
JGI24738J21930_1011245213300002075Corn RhizosphereIPKTELRTTTRGLKVCRIACMILFGATLAGCDKCGGWLMQGESQVCREQAPRPQ*
JGI24034J26672_1012339923300002239Corn, Switchgrass And Miscanthus RhizosphereMPAIPKTELRTTTRGLKVCRIACMILFGATLAGCDKCGGWLMQGESQVCREQAPPP
JGI24742J22300_1000940913300002244Corn, Switchgrass And Miscanthus RhizosphereMPAIPKTELRTTTRGLKVCRIACMILFGATLAGCDKCGGWLMQGESQVCREQAPRP
C688J35102_11983549523300002568SoilMPAISKTELSTTMRGLKVCRIICLILLGATLAGCDKCGGWLMQGESQVCRDQAPRPQ*
C688J35102_12048727923300002568SoilMPAIPKTELRTTPRGLKVCRIACMILLGATLAGCDKCGGWLMQGESQVCREQAPRPQ*
Ga0063356_10570871623300004463Arabidopsis Thaliana RhizosphereAIPKTELRTTTRGLKVCRIACMILLGATLAGCDKCGGWLMQGESQVCREQAPRPQ*
Ga0063356_10574839613300004463Arabidopsis Thaliana RhizosphereMSADPKADRRATTGGIKVRRIICMALLGVTLAGCDKCGGWWSPMRGESQVCREQAPQPQ*
Ga0062595_10083887723300004479SoilMPAIPKTELRTTTRGLKVCRIACMILFGATLAGCDKCGGWLMQGESQVCREQAPPPQ*
Ga0062595_10162434213300004479SoilMPAIPKTELRTTTRGLKVCRIACMILLGATLAGCDKCGGWLMQGESQACREQAPRPQ*
Ga0062594_10196912223300005093SoilMSADPKADRRATTGGIKVRRIICMALLGVTLAGCDKCGGWWSPMRGESQVCREQA
Ga0066823_1003501513300005163SoilMPAIPKTELRTTTRGLKVCRIACMILLGATLAGCDKCGGWLMQGESQACR
Ga0066810_1002462213300005169SoilRVAMPAIPKTELRTTTRGLKVCRIACMILFGATLAGCDKCGGWLMQGERQVCREQAPPPQ
Ga0070658_1131503013300005327Corn RhizosphereMPAIPKTELRTTTRGLKVCRIACMILFGATLAGCDKCGGWLMQGESQVCREQAPRPQ*
Ga0070666_1086984013300005335Switchgrass RhizosphereKTELRTTTRGLKVCRIACMILLGVTLAGCDKCGGWLMQGESQVCREQAPRSQ*
Ga0070680_10040510423300005336Corn RhizosphereMPAIPKTELRTTTRGLTVCRIACMILLGATLAGCDKCGGWLMQGESQACREQAPRPQ*
Ga0068868_10058832223300005338Miscanthus RhizosphereMQAILKTELRTTTRGLKVCRIACMILLGVTLAGCDKCGGWQMQSESQACREQAPRPQ*
Ga0070660_10109380513300005339Corn RhizosphereRVAMPAIPKTELRTTTRGLKVCRIVCMILFGATLAGCDKCGGWLMQGESQACREQAPRPQ
Ga0070689_10026937133300005340Switchgrass RhizosphereMPAIPKTELRTTTRGLKVCRIVCMILFGATLAGCDKCGGWLMQGESQVCREQAPRPQ*
Ga0070691_1015245023300005341Corn, Switchgrass And Miscanthus RhizosphereRTTTRGLKVCRIACMILFGATLAGCDKCGGWLMQGESQVCREQAPPPQ*
Ga0070692_1057685623300005345Corn, Switchgrass And Miscanthus RhizosphereDPKADRRATTGGIKAQRIICMALLGVTLAGCDKCGGWWSPMRGESQVCREQAPQPQ*
Ga0070667_10235239913300005367Switchgrass RhizosphereMSADPKADRRATTGGIKARRIICMVLLGVTLAGCDKCGGWWSPMRGESQVCREQAPQPQ*
Ga0070713_10058635513300005436Corn, Switchgrass And Miscanthus RhizosphereVAMPAIPKTELRTTTRGLKVCRIACMILFGATLAGCDKCGGWLMQGESQVCREQAPRPQ*
Ga0070700_10102242023300005441Corn, Switchgrass And Miscanthus RhizosphereMPAIPKTELRTTTRGRKVCRIACMILLGATLAGCDKCGGWLMQGESQACREQAPRPQ*
Ga0070708_10073821213300005445Corn, Switchgrass And Miscanthus RhizosphereMPAIPKAELRTTTRGLKVCRIACMILFGATLAGCDKCGGWLMQGESQVCREQAPRPQ*
Ga0070684_10006838743300005535Corn RhizosphereMSADPKADRRATTGGIKAQRIICMALLGVTLAGCDKCGGWWSPMRGESQVCREQAPQPQ*
Ga0070672_10049050423300005543Miscanthus RhizosphereRVAMPAIPKTELRTTTRGLKVCRIACMILFGATLAGCDKCGGWLMQGESQVCREQAPRPQ
Ga0070686_10021756233300005544Switchgrass RhizosphereMSADPKADRRATTGDIKARRIICMVLLGVTLAGCDKCGGWWSPMRGESQACREQAPQP
Ga0070696_10090853423300005546Corn, Switchgrass And Miscanthus RhizosphereMTSTNGFIDRGAERVAMPAIPKTELRTTTRGLTVCRIACMILLGATLAGCDKCGGWLMQGESQACREQAPRPQ*
Ga0070665_10060363223300005548Switchgrass RhizosphereMPAIPKTELRTTTRGLKVCRIACMILLGATLAGCDKCGGWLMQGESQVCREQAPRPQ*
Ga0070664_10125108223300005564Corn RhizosphereMPAIPKTELRTTTRGLKVCRIACMILLGATLAGCDKCGGWQMQSESQACREQAPRPQ*
Ga0070702_10030587213300005615Corn, Switchgrass And Miscanthus RhizosphereGLRSRRRARLVMSADPKADRRATTGGIKAQRIICMALLGVTLAGCDKCGGWWSPMRGESQVCREQAPQPQ*
Ga0068861_10252299223300005719Switchgrass RhizosphereAIPKTELRTTTRGLKVCRIACMILLGATLAGCDKCGGWLMQGESQACREQAPRPQ*
Ga0068860_10087342823300005843Switchgrass RhizosphereRTTTRGLKVCRIACMILFGATLAGCDKCGGWLMQGESQVCREQAPRPQ*
Ga0068860_10120703623300005843Switchgrass RhizosphereMSADPKADRRATTGGIKAQRIICMALLGVTLAGCDKCGGWWSPM
Ga0070717_1104774223300006028Corn, Switchgrass And Miscanthus RhizosphereMQAILKTELRTTTRGLKVCRIACMILFGATLAGCDKCGGWLMQGESQVCREQAPRPQ*
Ga0075365_1005580033300006038Populus EndosphereMPAIAKTELRTATRGLKICRIVCMILFGATLAGCDKCGGWLMQGESQVCREQAPRPQ*
Ga0075365_1054476723300006038Populus EndosphereAIPKTELRTTTRGLKVCRIACMILFGATLAGCDKCGGWLMQGESQVCREQAPRPQ*
Ga0075432_1050273813300006058Populus RhizosphereMSADPKADRRATTGGIKARRIICMALLGVTLAGCDKCGGWWSPMRGESQVCREQAPQPQ*
Ga0070712_10128781823300006175Corn, Switchgrass And Miscanthus RhizosphereMSADPKADRRATTGGIKARRIICMALLGVTLAGCDKCGGWWSPMRGESQVCREQARQPQ*
Ga0075422_1016137013300006196Populus RhizosphereMSADPKADRRATTGGIKAQRIICMALLGVTLAGCDKCGGWWSPMRGESQ
Ga0097621_10067785013300006237Miscanthus RhizosphereRVAMPAIPKTELRTTTRGLKVCRIVCMILFGATLAGCDKCGGWLMQGESQVCREQAPRPQ
Ga0074047_1205835423300006576SoilRTTTRGLKVCRIACMILLGATLAGCDKCGGWLMQGESQACREQAPRPQ*
Ga0074059_1001074523300006578SoilKTELRTTTRGLKVCRIACMILLGATLAGCDKCGGWLMQGESQACREQAPRPQ*
Ga0074049_1300314523300006580SoilPAIPKTELRTTTRGLKVCRIACMILLGATLAGCDKCGGWLMQGESQACREQAPRPQ*
Ga0075421_10061628423300006845Populus RhizosphereMSADPKADRRAATGGIKAQRIICMALLGVTLAGCDKCGGWWSPMRGESQVCREQAPQPQ*
Ga0075433_1183422723300006852Populus RhizosphereMPAIPKTELRTTTRGLKVCRIVCMILFGATLAGCDKCGGWLMQGESQVCREQAPPPQ*
Ga0075429_10049710333300006880Populus RhizosphereMPAILKSELRTITRGLKVCRIACMILLGVTLAGCDKCGGWQMQGESQACREQAPRPQ*
Ga0105251_1041696223300009011Switchgrass RhizosphereARLVMSADPKADRRATTGGIKAQRIICMALLGVTLAGCDKCGGWWSPMRGESQVCREQAPQPQ*
Ga0105244_1055078713300009036Miscanthus RhizosphereMISANGFIDRGAEGRVAMPAIAKTELRTATRGLKICRIVCMILFGATLAGCDKCGGWLMQGESQVCREQAPRPQ*
Ga0105250_1032403023300009092Switchgrass RhizosphereMMSTNGFIDRGAERVAMPAIPKTELRTTTRGLKVCRIACMILFGATLAGCDKCGGWLMQGESQVCREQAPRPQ*
Ga0105245_1280415123300009098Miscanthus RhizosphereKTELRTTTRGLKVCRIACMILLGVTLAGCDKCGGWQMQSESQACREQAPRPQ*
Ga0105243_1015705533300009148Miscanthus RhizosphereMMSTNGFIDRGAERVAMPAIPKTELRTTTRGLKVCRIACMILFGATLAGCDKCGGWLMQGESQVCREQAPPPQ*
Ga0105243_1091803323300009148Miscanthus RhizosphereMPAIPKTELRTTTRGLTVCRIACMILLGATLAGCDKCGGWLMQGESQVCREQAPRPQ*
Ga0111538_1008364433300009156Populus RhizosphereMSADPKADGRATTGGIKARRIICMALLGVTLAGCDKCGGWWSPMRGESQVCREQAPQPQ*
Ga0105237_1026997733300009545Corn RhizosphereMPAIPKTELRTTPRGLKVCRIACMILLGATLAGCDKCGGWLMQGESQACREQAPRPQ*
Ga0126305_1073515023300010036Serpentine SoilMPAILKTELRTTTRGLKVCRIACMILLGVTLAGCDKCGGWQMQGESQACREQAPRPQ*
Ga0126308_1049015023300010040Serpentine SoilMPAILKTELRTTTRGLKVCRIACMILLGVALAGCDKCGGWQMQGESQACREQAPRPQ*
Ga0134128_1012574943300010373Terrestrial SoilMPADPKADRRATTGGIKARRIICMALLGVTLAGCDKCGGWWSPMRGESQVCREQAPQPQ*
Ga0105246_1035760223300011119Miscanthus RhizosphereMPAIPKTELRTTTRGRKVCRIACMILLGATLAGCDKCGGWLMQGESQVCREQAPRPQ*
Ga0105246_1041995133300011119Miscanthus RhizosphereMSADPKADRRATTGGIKAQRIICMALLGVTLAGCDKCGGWWSPMRGASAVCGEQAPQPQ*
Ga0150985_10561157123300012212Avena Fatua RhizosphereMPAIPKTELRTTTRGRKVCRIACMILLGATLAGCDKCGGWLMQGES
Ga0150984_11466122713300012469Avena Fatua RhizospherePAIPKTELRTTTRGRKVCRIACMILVGATLAGCDKCGGWLMQGESQACREQAPRPQ*
Ga0157309_1023153613300012895SoilMSADPKADRRATTGGIKAQRIICMALLGVTLAGCDKCGGWWSPMRGESQACREQAPQPQ*
Ga0157308_1034533523300012910SoilATTRGLKVCRIACMILFGATLAGCDKCGGWLMQGESQVCREQAPPPQ*
Ga0157301_1012198123300012911SoilMPAIPKTELRTTTGGRKVCRIACMILLGATLAGCDKCGGWLMQGESQVCREQAPRPQ*
Ga0157297_1014141023300012914SoilMSADPKADRRATTGGIKAQRIICMALLGVTLAGCDKCGGWLMQGESQVCREQAPRPQ*
Ga0157302_1035131923300012915SoilMSADPKADRRATTGGIKVRRIICMALLGVTLAGCDKCGGWWSPMRGESQACREQAPQPQ*
Ga0164300_1080158513300012951SoilMPAIPKTELRMTRRGLKVCRIVCMILFGATLAGCDKCGGWLMQGESQACREQAPRPQ*
Ga0164298_1118263613300012955SoilMISTNGFTDRGAEGRVAMPAIAKTELRTATRGLKICRIVCMILFGATLAGCDKCGGWLMQGESQVCREQAPRPQ*
Ga0164299_1067937523300012958SoilMPAIPKTELRTTPRDLKVCRIACMILLGATLAGCDKCGGWLMQGESQACREQAPRPQ*
Ga0164304_1027964223300012986SoilMMSTNGFIDRGAERVAMPAIPKAELRTTTRGLKVCRIACMILFGATLAGCDKCGGWLMQGESQVCREQAPRPQ*
Ga0164305_1025722713300012989SoilMQAILKTELRTTTRGLKVCRIACMILFGATLAGCDKCGGWLMQGESQVCREQAPPPQ*
Ga0157371_1100613323300013102Corn RhizosphereMSADPKADRRATTGGIKARRIICMALLGVTLAGCDKCGGWWSPMRGE
Ga0157369_1156115913300013105Corn RhizosphereMMSTNGFIDRGTERVAMPAIPKTELRTTTRGLKVCRIACMILFGSTLAGCDKCGGWLMQGESQVCREQAPRPQ*
Ga0157372_1203486113300013307Corn RhizosphereMSADPKADRRATTGGMTAQRIICMALLGVALAACATCAGRWSPMRGAS
Ga0157379_1091209913300014968Switchgrass RhizosphereMSTNGFIDRGAERVAMPAIPKTELRTTTRGLKVCRIACMILFGATLAGCDKCGGWLMQGESQVCREQAPPPQ*
Ga0173478_1055253523300015201SoilMISTNGFTDRGAEGRVAMPAIAKTELRTATRGLKICRIVCMILFGATLAGCDKCGGWLMQGESQVCREQAPPPQ*
Ga0132258_1375354213300015371Arabidopsis RhizosphereARLVMSADPKADRRATTGGIKAQRIICMALLGVTLAGCDKCGGWWSPMRGESQVCREQAPQPR*
Ga0132255_10220907623300015374Arabidopsis RhizosphereMPAIPKTELRATTRGLTVCRIACMILFGATLAGCDKCGGWLMQGESQVCREQAPPPQ*
Ga0163161_1083637813300017792Switchgrass RhizosphereELRTTPRGLKVCRIACMILLGATLAGCDKCGGWLMQGESQVCREQAPRPQ
Ga0190266_1059443923300017965SoilMPAILKTELRTTTRGLKVCRIACMILLGVTLAGCDKCGGWQMQGESQACREQAPRPQ
Ga0184604_1006287423300018000Groundwater SedimentMPAILKTELRTTTRGLKVCRIACMILLGATLAGCDKCGGWLMQGESQVCREQAPRPQ
Ga0184617_109499723300018066Groundwater SedimentMPAILKTELRTTTRGLKVCRIACMILLGVTLAGCDKCGGWLMQGESQACREQAPRPQ
Ga0190270_1087011923300018469SoilMPAIPKTELRTTTRGLKVCRIVCMILFGAALAGCDKCGGWLMQGESQVCREQAPRPQ
Ga0173479_1042943623300019362SoilMSADPKADRRATTGGIKVRRIICMALLGVTLAGCDKCGGWWSPMRGESQACREQAPQPQ
Ga0193697_105675523300020005SoilMPAIPKTELRTTTRGLKVCRIACMILLGATLAGCDKCGGWLMQGESQACREQAPRPQ
Ga0210380_1001029053300021082Groundwater SedimentMPAISKTELSTTMRGLKVCRIICLILLGATLAGCDKCGGWLMQGESQVCRDQAPRPQ
Ga0247794_1028978813300024055SoilRMMSTNGFIDRGAERVAMPAIPKTELRTTTRGLKVCRIACMILFGATLAGCDKCGGWLMQGESQVCREQAPPPQ
Ga0207656_1033570623300025321Corn RhizosphereMPAIPKTELRTTTRGLKVCRIACMILFGATLAGCDKCGGWLMQGESQVCREQAPPPQ
Ga0207642_1030278923300025899Miscanthus RhizosphereMPAIPKTELRTTTRGLTVCRIACMILLGATLAGCDKCGGWLMQGESQACREQAPRPQ
Ga0207710_1021791413300025900Switchgrass RhizosphereMSADPKADRRATTGGIKARRIICMALLGVTLAGCDKCGG
Ga0207654_1119853723300025911Corn RhizosphereRVAMPAIPKTELRTTTRGLKVCRIACMILFGATLAGCDKCGGWLMQGESQVCREQAPPPQ
Ga0207662_1027569433300025918Switchgrass RhizosphereMPAIPKTELRTTPRGLKVCRIACMILLGATLAGCDKCGGWLMQGESQVCREQAPRPQ
Ga0207657_1011078233300025919Corn RhizosphereMPAIPKTELRTTTRGLKVCRIVCMILFGATLAGCDKCGGWLMQGESQVCREQAPRPQ
Ga0207694_1083732413300025924Corn RhizosphereMPAIPKTELRTTPRGLKVCRIACMILLGATLAGCDKCGGWLMQGESQVCREQAPPPQ
Ga0207650_1000360483300025925Switchgrass RhizosphereMSADPKADRRATTGGIKAQRIICMALLGVTLAGCDKCGGWWSPMRGESQVCREQAPQPQ
Ga0207701_1125977923300025930Corn, Switchgrass And Miscanthus RhizosphereMPAIPKTELRTTTRGLKVCRIACMILLGVTLAGCDKCGGWLMQGESQVCREQAPRPQ
Ga0207690_1003027233300025932Corn RhizosphereMPAIPKTELRTTTRGLKVCRIVCMILFGATLAGCDKCGGWLMQGESQACREQAPRPQ
Ga0207706_1045359923300025933Corn RhizosphereTTRGLKVCRIACMILLGATLAGCDKCGGWLMQGESQACREQAPRPQ
Ga0207670_1006746033300025936Switchgrass RhizosphereMPAIPKTELRTTTRGLKVCRIACMILFGATLAGCDKCGGWLMQGESQVCREQAARPQ
Ga0207669_1116259023300025937Miscanthus RhizosphereMPAIPKTELRTTTRGRKVCRIACMILLGATLAGCDKCGGWLMQGESQACREQAPRPQ
Ga0207691_10004035113300025940Miscanthus RhizosphereMPAIPKTELRTTPRGLKVCRIACMILLGATLAGCDKCGGWLMQGESQACREQAPRPQ
Ga0207711_1042362533300025941Switchgrass RhizosphereMPAIPKAELRTTTRGLKVCRIACMILFGATLAGCDKCGGWLMQGESQVCREQAPRPQ
Ga0207677_1056512713300026023Miscanthus RhizosphereAIPKTELRTTTRGLKVCRIVCMILFGATLAGCDKCGGWLMQGESQVCREQAPRPQ
Ga0207678_1023016333300026067Corn RhizosphereMPAIPKTELRTTTRGRKVCRIACMILVGATLAGCDKCGGWLMQGESQVCREQAPRPQ
Ga0209213_100932733300027383Forest SoilMPAIPKSDRRATKPSMKVRHIICMILLGATLAGCDKCGDWWSPMRGESQVCREQAPRPQ
Ga0208995_100136923300027388Forest SoilMPAIPKSDRRATKPSMKVRHIVCMILLGATLAGCDKCGDWWSPMRGESQVCREQAPRPQ
Ga0208890_100167923300027523SoilMPAIPKTELRTTTRGLKVCRIACMILLGATLAGCDKCGGWLMQGESQVCREQAPPPQ
Ga0209382_1098735613300027909Populus RhizosphereMSADPKADRRAATGGIKAQRIICMALLGVTLAGCDKCGGWWSPMRGESQVCREQAPQPQ
Ga0268264_1097243713300028381Switchgrass RhizosphereMSADPKADRRATTGGIKAQRIICMALLGVTLAGCDKCGGWWSPMRGESQVCREQAPQP
Ga0268264_1160255913300028381Switchgrass RhizosphereMPAIPKTELRTTTRGLKVCRIACMILLGATLAGCDKCGGWLMQGESQV
Ga0247828_1035234613300028587SoilVAMPAIPKTELRTTTRGLKVCRIACMILLGATLAGCDKCGGWLMQGESQACREQAPRPQ
Ga0247822_1104271623300028592SoilMPAIPKTELRTTTRGLKVCRIACMILFGATLAGCDKCGGWLMQGESQVCREQAPRPL
Ga0307322_1011311923300028710SoilTELRTTTRGLLVCRIACMILLGVTLAGCDKCGGWQMQGESQACREQAPRPQ
Ga0307285_1002009123300028712SoilMPAILKTELRTTTRGLLVCRIACMILLGVTLAGCDKCGGWQMQGESQACREQAPRPQ
Ga0307303_1011219923300028713SoilMPAISKTELSTTMRGLKVCRIICLILLGATLAGCDKCGGWLMQGESQACREQAPRPQ
Ga0307307_1021415823300028718SoilELSTTMRGLKVCRIICLILLGATLAGCDKCGGWLMQGESQVCRDQAPRPQ
Ga0307315_1011631423300028721SoilMPAILKTELRTTTRGLLVCRIACMILLGVTLAGCDKCGGWLMQGESQACREQAPRPQ
Ga0307306_1001131823300028782SoilMQAILKTELRTTTRGLKVCRIACMILLGVTLAGCDKCGGWQMQSESQACREQAPRPQ
Ga0307287_1016020123300028796SoilPKTELRTTTRGLKVCRIACMILLGATLAGCDKCGGWLMQGESQACREQAPRPQ
Ga0307294_1001894713300028810SoilMPAILKTELRTTTRGLKVCRIACMILLGVTLAGCDKCGGWQMQSESQACREQAPRPQ
Ga0307296_1052026113300028819SoilMPAIPKTELRTTTRGLKVCRIACMILLGATLAGCDKCGGWLMQGESQACREQAP
Ga0307289_1011847733300028875SoilMPAISKTELSTTMRGLKVCRIICLILLGATLAGCDKCGGWLMQGESQVCRDQAP
Ga0307499_1004390723300031184SoilMPAISKTELSTTMRGLKVCRIICLILLGATLAGCDKCGGWLMQGESQVCREQAPRPQ
Ga0307499_1030322423300031184SoilMPAIPKTELRTTTRGLKVCRIVCMILFGATLAGCDKCGGWLMQGESQVCRE
Ga0310887_1049122323300031547SoilMSADPKADRRATTGGIKVRRIICMALLGVTLAGCDKCGGWWSPMRGESQVCREQAPQPQ
Ga0310907_1042549223300031847SoilMSADPKADRRATTGGIKARRIICMALLGVTLAGCDKCGGWWSPMRGESQVCREQAPQPQ
Ga0310904_1110089513300031854SoilMSADPKADRRATTGGIKARRIICMVLLGVTLAGCDKCGGWWSPMRGESQVCREQAPQPQ
Ga0310884_1099999713300031944SoilMSADPKADRRATTGGIKARRIICMALLGVTLAGCDKCGGWWSPMRGESQACREQAPQPQ
Ga0307470_1025629423300032174Hardwood Forest SoilMPAIPKTELRTTTRGLTVCRIACMILLGATLAGCDKCGGWLMQGESQVCREQAPRPQ


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.