Basic Information | |
---|---|
Family ID | F061094 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 132 |
Average Sequence Length | 39 residues |
Representative Sequence | MDHMGIGVLAISAGLSLSALFALLLLKARPAAAPVPA |
Number of Associated Samples | 97 |
Number of Associated Scaffolds | 132 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 6.06 % |
% of genes near scaffold ends (potentially truncated) | 77.27 % |
% of genes from short scaffolds (< 2000 bps) | 90.91 % |
Associated GOLD sequencing projects | 87 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.46 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (93.939 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (46.970 % of family members) |
Environment Ontology (ENVO) | Unclassified (58.333 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (46.970 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 38.46% β-sheet: 0.00% Coil/Unstructured: 61.54% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.46 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 132 Family Scaffolds |
---|---|---|
PF07690 | MFS_1 | 26.52 |
PF00496 | SBP_bac_5 | 4.55 |
PF02417 | Chromate_transp | 1.52 |
PF00144 | Beta-lactamase | 0.76 |
PF00702 | Hydrolase | 0.76 |
PF00571 | CBS | 0.76 |
PF00126 | HTH_1 | 0.76 |
PF01425 | Amidase | 0.76 |
PF00275 | EPSP_synthase | 0.76 |
PF01545 | Cation_efflux | 0.76 |
PF01527 | HTH_Tnp_1 | 0.76 |
PF00583 | Acetyltransf_1 | 0.76 |
PF13432 | TPR_16 | 0.76 |
PF13847 | Methyltransf_31 | 0.76 |
PF09851 | SHOCT | 0.76 |
PF01451 | LMWPc | 0.76 |
PF00072 | Response_reg | 0.76 |
COG ID | Name | Functional Category | % Frequency in 132 Family Scaffolds |
---|---|---|---|
COG2059 | Chromate transport protein ChrA | Inorganic ion transport and metabolism [P] | 1.52 |
COG0053 | Divalent metal cation (Fe/Co/Zn/Cd) efflux pump | Inorganic ion transport and metabolism [P] | 0.76 |
COG0154 | Asp-tRNAAsn/Glu-tRNAGln amidotransferase A subunit or related amidase | Translation, ribosomal structure and biogenesis [J] | 0.76 |
COG1230 | Co/Zn/Cd efflux system component | Inorganic ion transport and metabolism [P] | 0.76 |
COG1680 | CubicO group peptidase, beta-lactamase class C family | Defense mechanisms [V] | 0.76 |
COG1686 | D-alanyl-D-alanine carboxypeptidase | Cell wall/membrane/envelope biogenesis [M] | 0.76 |
COG2367 | Beta-lactamase class A | Defense mechanisms [V] | 0.76 |
COG3965 | Predicted Co/Zn/Cd cation transporter, cation efflux family | Inorganic ion transport and metabolism [P] | 0.76 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 93.94 % |
Unclassified | root | N/A | 6.06 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300004082|Ga0062384_101220171 | Not Available | 547 | Open in IMG/M |
3300004633|Ga0066395_10841406 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 553 | Open in IMG/M |
3300005540|Ga0066697_10291610 | Not Available | 961 | Open in IMG/M |
3300005554|Ga0066661_10688435 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 601 | Open in IMG/M |
3300005557|Ga0066704_10730704 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 621 | Open in IMG/M |
3300005712|Ga0070764_10724181 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 614 | Open in IMG/M |
3300005764|Ga0066903_101374996 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1324 | Open in IMG/M |
3300005764|Ga0066903_106901155 | Not Available | 589 | Open in IMG/M |
3300005764|Ga0066903_108091129 | All Organisms → cellular organisms → Bacteria | 539 | Open in IMG/M |
3300006046|Ga0066652_100487088 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1143 | Open in IMG/M |
3300006176|Ga0070765_100081939 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2739 | Open in IMG/M |
3300006904|Ga0075424_102515063 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 539 | Open in IMG/M |
3300006954|Ga0079219_10595601 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 807 | Open in IMG/M |
3300007258|Ga0099793_10369480 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 703 | Open in IMG/M |
3300009545|Ga0105237_11858294 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 610 | Open in IMG/M |
3300009792|Ga0126374_10667047 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 777 | Open in IMG/M |
3300010046|Ga0126384_10477335 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1070 | Open in IMG/M |
3300010048|Ga0126373_10289960 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1627 | Open in IMG/M |
3300010159|Ga0099796_10037116 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1627 | Open in IMG/M |
3300010360|Ga0126372_10736271 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 968 | Open in IMG/M |
3300010361|Ga0126378_10879019 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1003 | Open in IMG/M |
3300010366|Ga0126379_13070428 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 559 | Open in IMG/M |
3300012202|Ga0137363_10795710 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 802 | Open in IMG/M |
3300012582|Ga0137358_10390091 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Magnetospirillum → unclassified Magnetospirillum → Magnetospirillum sp. UT-4 | 942 | Open in IMG/M |
3300012685|Ga0137397_10640982 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 790 | Open in IMG/M |
3300012918|Ga0137396_10179398 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1552 | Open in IMG/M |
3300012924|Ga0137413_10106327 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1761 | Open in IMG/M |
3300012927|Ga0137416_10420630 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1136 | Open in IMG/M |
3300016319|Ga0182033_10557570 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 991 | Open in IMG/M |
3300016319|Ga0182033_10603372 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 954 | Open in IMG/M |
3300016319|Ga0182033_11021118 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 736 | Open in IMG/M |
3300016341|Ga0182035_10610869 | Not Available | 943 | Open in IMG/M |
3300016341|Ga0182035_10964142 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 755 | Open in IMG/M |
3300016341|Ga0182035_10973567 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 751 | Open in IMG/M |
3300016357|Ga0182032_11864501 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 526 | Open in IMG/M |
3300016387|Ga0182040_10016717 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 3959 | Open in IMG/M |
3300016387|Ga0182040_10609388 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 885 | Open in IMG/M |
3300016387|Ga0182040_10997620 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 698 | Open in IMG/M |
3300016387|Ga0182040_11712313 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 537 | Open in IMG/M |
3300016404|Ga0182037_10665720 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 889 | Open in IMG/M |
3300016422|Ga0182039_10131115 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae | 1908 | Open in IMG/M |
3300018090|Ga0187770_11127227 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 633 | Open in IMG/M |
3300020579|Ga0210407_11325413 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 537 | Open in IMG/M |
3300020580|Ga0210403_10313358 | Not Available | 1285 | Open in IMG/M |
3300020581|Ga0210399_10523555 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 984 | Open in IMG/M |
3300020581|Ga0210399_10739720 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Cupriavidus → Cupriavidus pinatubonensis → Cupriavidus pinatubonensis JMP134 | 806 | Open in IMG/M |
3300020583|Ga0210401_10270786 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 1558 | Open in IMG/M |
3300020583|Ga0210401_10547328 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae | 1020 | Open in IMG/M |
3300020583|Ga0210401_10852706 | Not Available | 770 | Open in IMG/M |
3300021088|Ga0210404_10035161 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2273 | Open in IMG/M |
3300021358|Ga0213873_10127075 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 752 | Open in IMG/M |
3300021444|Ga0213878_10509082 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 530 | Open in IMG/M |
3300021474|Ga0210390_10495055 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1030 | Open in IMG/M |
3300021560|Ga0126371_11869326 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 720 | Open in IMG/M |
3300022530|Ga0242658_1152764 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 597 | Open in IMG/M |
3300026494|Ga0257159_1035500 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 835 | Open in IMG/M |
3300026542|Ga0209805_1064855 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1789 | Open in IMG/M |
3300027651|Ga0209217_1026601 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1830 | Open in IMG/M |
3300027783|Ga0209448_10321253 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 506 | Open in IMG/M |
3300027874|Ga0209465_10516717 | All Organisms → cellular organisms → Bacteria | 596 | Open in IMG/M |
3300027889|Ga0209380_10418986 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 785 | Open in IMG/M |
3300028536|Ga0137415_11199827 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 574 | Open in IMG/M |
3300031231|Ga0170824_102805835 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 882 | Open in IMG/M |
3300031231|Ga0170824_108324123 | All Organisms → cellular organisms → Bacteria | 504 | Open in IMG/M |
3300031446|Ga0170820_13343755 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 629 | Open in IMG/M |
3300031474|Ga0170818_104995885 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1030 | Open in IMG/M |
3300031474|Ga0170818_110362596 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1348 | Open in IMG/M |
3300031543|Ga0318516_10566620 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 649 | Open in IMG/M |
3300031546|Ga0318538_10376451 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 767 | Open in IMG/M |
3300031549|Ga0318571_10176006 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 753 | Open in IMG/M |
3300031572|Ga0318515_10439162 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 698 | Open in IMG/M |
3300031573|Ga0310915_10297813 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1139 | Open in IMG/M |
3300031640|Ga0318555_10587394 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 603 | Open in IMG/M |
3300031679|Ga0318561_10012907 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3698 | Open in IMG/M |
3300031679|Ga0318561_10085107 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1643 | Open in IMG/M |
3300031679|Ga0318561_10775334 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 527 | Open in IMG/M |
3300031680|Ga0318574_10172434 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1236 | Open in IMG/M |
3300031682|Ga0318560_10009715 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 4095 | Open in IMG/M |
3300031719|Ga0306917_10581856 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 880 | Open in IMG/M |
3300031723|Ga0318493_10833930 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 520 | Open in IMG/M |
3300031736|Ga0318501_10402692 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 739 | Open in IMG/M |
3300031744|Ga0306918_10164461 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1649 | Open in IMG/M |
3300031744|Ga0306918_10182693 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1571 | Open in IMG/M |
3300031751|Ga0318494_10444757 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 754 | Open in IMG/M |
3300031751|Ga0318494_10833677 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 540 | Open in IMG/M |
3300031763|Ga0318537_10075053 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1241 | Open in IMG/M |
3300031763|Ga0318537_10239229 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 674 | Open in IMG/M |
3300031765|Ga0318554_10285422 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 939 | Open in IMG/M |
3300031765|Ga0318554_10579919 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 633 | Open in IMG/M |
3300031770|Ga0318521_10475030 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 750 | Open in IMG/M |
3300031770|Ga0318521_10548072 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 697 | Open in IMG/M |
3300031778|Ga0318498_10443824 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 574 | Open in IMG/M |
3300031782|Ga0318552_10189501 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1039 | Open in IMG/M |
3300031782|Ga0318552_10623383 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 550 | Open in IMG/M |
3300031798|Ga0318523_10104193 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1394 | Open in IMG/M |
3300031798|Ga0318523_10142762 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1189 | Open in IMG/M |
3300031805|Ga0318497_10357619 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 816 | Open in IMG/M |
3300031835|Ga0318517_10229714 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 837 | Open in IMG/M |
3300031835|Ga0318517_10383391 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 635 | Open in IMG/M |
3300031846|Ga0318512_10100864 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1357 | Open in IMG/M |
3300031879|Ga0306919_11064574 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 617 | Open in IMG/M |
3300031890|Ga0306925_10112331 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2909 | Open in IMG/M |
3300031890|Ga0306925_10278642 | Not Available | 1800 | Open in IMG/M |
3300031893|Ga0318536_10145535 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1203 | Open in IMG/M |
3300031941|Ga0310912_10660435 | Not Available | 812 | Open in IMG/M |
3300031941|Ga0310912_11059685 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 620 | Open in IMG/M |
3300031941|Ga0310912_11220282 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 572 | Open in IMG/M |
3300031942|Ga0310916_10093796 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 2399 | Open in IMG/M |
3300031942|Ga0310916_10666893 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 881 | Open in IMG/M |
3300031942|Ga0310916_11017428 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 691 | Open in IMG/M |
3300031945|Ga0310913_10895356 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 624 | Open in IMG/M |
3300031946|Ga0310910_10770251 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 759 | Open in IMG/M |
3300031947|Ga0310909_10069964 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 2754 | Open in IMG/M |
3300031954|Ga0306926_10280898 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 2061 | Open in IMG/M |
3300031954|Ga0306926_11152975 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 913 | Open in IMG/M |
3300031959|Ga0318530_10043017 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1673 | Open in IMG/M |
3300031959|Ga0318530_10104373 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1129 | Open in IMG/M |
3300031962|Ga0307479_11206757 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 720 | Open in IMG/M |
3300032001|Ga0306922_10031450 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 5402 | Open in IMG/M |
3300032001|Ga0306922_10225542 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 2012 | Open in IMG/M |
3300032025|Ga0318507_10334287 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 659 | Open in IMG/M |
3300032041|Ga0318549_10338986 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 677 | Open in IMG/M |
3300032043|Ga0318556_10010864 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3797 | Open in IMG/M |
3300032052|Ga0318506_10168544 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 962 | Open in IMG/M |
3300032052|Ga0318506_10418604 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 594 | Open in IMG/M |
3300032052|Ga0318506_10434186 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 582 | Open in IMG/M |
3300032059|Ga0318533_11188004 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 558 | Open in IMG/M |
3300032060|Ga0318505_10130010 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1158 | Open in IMG/M |
3300032076|Ga0306924_10999603 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 918 | Open in IMG/M |
3300032076|Ga0306924_11471695 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 723 | Open in IMG/M |
3300032091|Ga0318577_10601370 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 522 | Open in IMG/M |
3300032261|Ga0306920_101928648 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 829 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 46.97% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 19.70% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 6.82% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 5.30% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 3.79% |
Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 3.79% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 3.79% |
Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 2.27% |
Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 1.52% |
Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Bulk Soil | 0.76% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.76% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.76% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.76% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.76% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.76% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.76% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.76% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300004082 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3 | Environmental | Open in IMG/M |
3300004633 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio | Environmental | Open in IMG/M |
3300005540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 | Environmental | Open in IMG/M |
3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
3300005557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 | Environmental | Open in IMG/M |
3300005712 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 | Environmental | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Environmental | Open in IMG/M |
3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
3300018090 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Host-Associated | Open in IMG/M |
3300021444 | Vellozia epidendroides bulk soil microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - BS_R02 | Environmental | Open in IMG/M |
3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
3300022530 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-30-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300026494 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-07-A | Environmental | Open in IMG/M |
3300026542 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 (SPAdes) | Environmental | Open in IMG/M |
3300027651 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M2 (SPAdes) | Environmental | Open in IMG/M |
3300027783 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM2 (SPAdes) | Environmental | Open in IMG/M |
3300027874 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes) | Environmental | Open in IMG/M |
3300027889 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes) | Environmental | Open in IMG/M |
3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031446 | Fir Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031474 | Fir Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
3300031546 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23 | Environmental | Open in IMG/M |
3300031549 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f24 | Environmental | Open in IMG/M |
3300031572 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19 | Environmental | Open in IMG/M |
3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
3300031640 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23 | Environmental | Open in IMG/M |
3300031679 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23 | Environmental | Open in IMG/M |
3300031680 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22 | Environmental | Open in IMG/M |
3300031682 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22 | Environmental | Open in IMG/M |
3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
3300031723 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23 | Environmental | Open in IMG/M |
3300031736 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21 | Environmental | Open in IMG/M |
3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
3300031751 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24 | Environmental | Open in IMG/M |
3300031763 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f29 | Environmental | Open in IMG/M |
3300031765 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22 | Environmental | Open in IMG/M |
3300031770 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17 | Environmental | Open in IMG/M |
3300031778 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f24 | Environmental | Open in IMG/M |
3300031782 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f20 | Environmental | Open in IMG/M |
3300031798 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f19 | Environmental | Open in IMG/M |
3300031805 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23 | Environmental | Open in IMG/M |
3300031835 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f21 | Environmental | Open in IMG/M |
3300031846 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f19 | Environmental | Open in IMG/M |
3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
3300031893 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f28 | Environmental | Open in IMG/M |
3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
3300031945 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082 | Environmental | Open in IMG/M |
3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
3300031959 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f24 | Environmental | Open in IMG/M |
3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
3300032025 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f20 | Environmental | Open in IMG/M |
3300032041 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f22 | Environmental | Open in IMG/M |
3300032043 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f24 | Environmental | Open in IMG/M |
3300032052 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f19 | Environmental | Open in IMG/M |
3300032059 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27 | Environmental | Open in IMG/M |
3300032060 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f18 | Environmental | Open in IMG/M |
3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
3300032091 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f25 | Environmental | Open in IMG/M |
3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
Ga0062384_1012201712 | 3300004082 | Bog Forest Soil | IFGMLMDHMGVDVVGISAGLSLSALIALLLLRTRPQPVPAPAE* |
Ga0066395_108414062 | 3300004633 | Tropical Forest Soil | MLCRIGEHLGIGVLAISTGLSLSALVALLLLKARPAPAPIAA* |
Ga0066697_102916102 | 3300005540 | Soil | MGIGVLAISAGLSLSALVALLLLKARPTPAPVAA* |
Ga0066661_106884351 | 3300005554 | Soil | MGIGVLAISAGLSLSALVAMSLLKARPVPAPVAA* |
Ga0066704_107307042 | 3300005557 | Soil | SPLLFGLLMDHMGIGVLAISAGLSLSALLMLRAKPTAALLR* |
Ga0070764_107241812 | 3300005712 | Soil | FGLLMDQMGIGVVAISAGLSLSAFFALLILRARPTAAPAPA* |
Ga0066903_1013749962 | 3300005764 | Tropical Forest Soil | MDYMGIGVLAISAGLSLSVLFALLMLSAIPTAAPAPT* |
Ga0066903_1069011552 | 3300005764 | Tropical Forest Soil | MGIGMLAISAGLSLGAFVALLLLKARPAAAPVPA* |
Ga0066903_1080911291 | 3300005764 | Tropical Forest Soil | MDYMGTGVLAISAGLSLSAFFALLLLKARPAAAPVPA* |
Ga0066652_1004870881 | 3300006046 | Soil | MGIGVLAISAGLSLSALGALLLLKARPTPAPVAA* |
Ga0070765_1000819393 | 3300006176 | Soil | MDEMGIGVLAISAGLSLSALFALLLLKARPAAAPVPA* |
Ga0075424_1025150632 | 3300006904 | Populus Rhizosphere | FGLLMDQMGLGVLAISAGLSLSAFFALLMLKARPAAAPMPA* |
Ga0079219_105956011 | 3300006954 | Agricultural Soil | LFGMLMDYMGTGVLAISAGLSLSALCALLLLKARPAAAPVPA* |
Ga0099793_103694802 | 3300007258 | Vadose Zone Soil | MDEMGVGVLAISAGLSLSALFALLLLKARPAAAPVPA* |
Ga0105237_118582942 | 3300009545 | Corn Rhizosphere | DAGGIAAPLFGLLMDRMGIGVVAISAGLSLSAFFALLTLRARPRAAAPAPA* |
Ga0126374_106670472 | 3300009792 | Tropical Forest Soil | LLMDYMGIGVLAVSAGLSLSALFALLMLRARPTAAPAPA* |
Ga0126384_104773352 | 3300010046 | Tropical Forest Soil | MGIGVLAISAGLSLSALVALLLLKGRPAPAPLTA* |
Ga0126373_102899604 | 3300010048 | Tropical Forest Soil | MDTMGIAVIAVSAGLSLGACVALLLLKARPATAPASA* |
Ga0099796_100371162 | 3300010159 | Vadose Zone Soil | MDHMGIGVLAISASLSLSAFFALLMLKARAAAAPVPA* |
Ga0126372_107362712 | 3300010360 | Tropical Forest Soil | GLLMDHMGIGVLAVSVGLSLSAFFALLLLKARPATAPVPA* |
Ga0126378_108790192 | 3300010361 | Tropical Forest Soil | AALRPLIDRMGIGVLAISPGLSLSALVALLLLKGRPAPAPLTA* |
Ga0126379_130704282 | 3300010366 | Tropical Forest Soil | RPLIDRMGIGVLAISAGLSLSALVALLLLKGRPAPAPLTA* |
Ga0137363_107957103 | 3300012202 | Vadose Zone Soil | LLMDYMGIGVLAISAGLSLSALFALLLLKARPAAAPVLA* |
Ga0137358_103900912 | 3300012582 | Vadose Zone Soil | MGLGALAISAGLSLAALLALLMLRAHPARLPLPAE* |
Ga0137397_106409822 | 3300012685 | Vadose Zone Soil | MDEMGVGVLAISAGLSLSALFALLLLKARPAATPVPA* |
Ga0137396_101793982 | 3300012918 | Vadose Zone Soil | MMDRLGIGVLAISAGLSLSALVALLKLRARPTAAPAPA* |
Ga0137413_101063272 | 3300012924 | Vadose Zone Soil | MDHMGIGVLAISASLSLSAFFALLMLKARPAAAPSPA* |
Ga0137416_104206302 | 3300012927 | Vadose Zone Soil | LMDRMGIGVLAISAGLSLSAFFALLILRARPTAAPAPA* |
Ga0182033_105575702 | 3300016319 | Soil | FLMDYMGIGVLAISAGLSLSALFALLMLRTRPTAAPAPA |
Ga0182033_106033721 | 3300016319 | Soil | LLFGLLMDYMGIGVLAISAGLSLSALVALLLLRARPTAAPAPA |
Ga0182033_110211181 | 3300016319 | Soil | MDYLGIGVIAVSAGLSLSAFGALLLLKARQATAPAPA |
Ga0182035_106108692 | 3300016341 | Soil | MDHMSIGVLAISAGLSLSALLALLLLKARPTAAPVPA |
Ga0182035_109641423 | 3300016341 | Soil | DYMGIGVLAISAGLSLSALVALLKLRARPTAAPAPA |
Ga0182035_109735672 | 3300016341 | Soil | LFGLLMDRMGIGVLAISAGLSLSALVALLLLKARPAAAPAAA |
Ga0182032_118645012 | 3300016357 | Soil | DYMGIGVITVSAGLSLSAFVALLLLRARAAAPAPA |
Ga0182040_100167171 | 3300016387 | Soil | VPADVLMDYMGIGVIAVSAGLSLSTCVGLLLLRAGPA |
Ga0182040_106093882 | 3300016387 | Soil | MDHMGIGVLAVSAGLSLSAFFALLLLKARPATAPVPA |
Ga0182040_109976202 | 3300016387 | Soil | MDYLDIGVLAISAGLSLSALFALLMLKARPTAAPAPA |
Ga0182040_117123132 | 3300016387 | Soil | FGLLMDYMGIGVLAISAGLSLSALFALLMLRARPAAAPAPA |
Ga0182037_106657201 | 3300016404 | Soil | LLFGFLMDYMGIGVLAISAGLSLSALCALLMLRARPTAGPAPA |
Ga0182039_101311152 | 3300016422 | Soil | MDHMGIGVLAISAGLSLSALFALLLLNARPAAAPVPA |
Ga0187770_111272271 | 3300018090 | Tropical Peatland | MDHMGVAVLAVSAGLSLSAFLALLLLKARPNAAPAPA |
Ga0210407_113254132 | 3300020579 | Soil | GVLMDEMGIGVLAISAGLSLSALFALLLLKARPATAPVPA |
Ga0210403_103133581 | 3300020580 | Soil | MFGLLMDRMGVGVLAVSAGLSLSAFVALLLLKARTAAAPVPA |
Ga0210399_105235551 | 3300020581 | Soil | MDRMGIGVLAISAGLSLSAIFALLILRARPTAAPASA |
Ga0210399_107397201 | 3300020581 | Soil | MDHMGIGVLPISAGLSLSAFFALLILRARPTAAPAPA |
Ga0210401_102707863 | 3300020583 | Soil | RMGVGVLAISAGLSLSAFVALMLLKTRPAAAPVPA |
Ga0210401_105473283 | 3300020583 | Soil | LLMDHMGVGALAISAGLSLSALSALLLLKARPAAPPVPA |
Ga0210401_108527061 | 3300020583 | Soil | MDRMGIGVLAISAGLGLSAFVALLLLKARPAAAPVAA |
Ga0210404_100351613 | 3300021088 | Soil | LMMDRIGVGVLAISAGLSLSALVALMLLKTRPAAAPVPA |
Ga0213873_101270751 | 3300021358 | Rhizosphere | SHGLHGIGVLAISAGLSLSALFALLMLRARPTVAPAPA |
Ga0213878_105090821 | 3300021444 | Bulk Soil | HMGVGVLAISAGLGLSAFFALLILRARPATMAAAT |
Ga0210390_104950551 | 3300021474 | Soil | DHMGIGVLAISAGLSLSAFFALLILRARPTAAPAPA |
Ga0126371_118693262 | 3300021560 | Tropical Forest Soil | DRMGIDVLAISAGLSLSALVALLLLKARPAVAPVAA |
Ga0242658_11527642 | 3300022530 | Soil | MDRMGIGVLAISAGLSLSAFFALLILRARPTAAPAPA |
Ga0257159_10355001 | 3300026494 | Soil | EMGIGVLAISAGLSLSALFALLLLKARPAAAPVPA |
Ga0209805_10648551 | 3300026542 | Soil | SVRDHMGIGVLAISAGLSLSARVALLLLKAQPTPAPVAA |
Ga0209217_10266013 | 3300027651 | Forest Soil | MDRLGIGVMAISAGLSLSALVALLKLRARPTAAPAPA |
Ga0209448_103212531 | 3300027783 | Bog Forest Soil | LFGLLMDEMGIGVLAISAGLSLSALFALLLLKARPAAAPVPA |
Ga0209465_105167172 | 3300027874 | Tropical Forest Soil | MLCRIGEHLGIGVLAISTGLSLSALVALLLLKARPAPAPIAA |
Ga0209380_104189861 | 3300027889 | Soil | FGLLMDEMGIGVLAISAGLSLSALFALLLLKARPAAAPVPA |
Ga0137415_111998272 | 3300028536 | Vadose Zone Soil | TQAASPLLFGLLMGHMGIGVLAISAGLSLSALLMLRAKPTAALLR |
Ga0170824_1028058351 | 3300031231 | Forest Soil | LMDQMGIGVVAISAGLSLSAFFALLLLKARSAPTPVAA |
Ga0170824_1083241231 | 3300031231 | Forest Soil | FGLLMDYMGVGVLAISAGLSLSALFALLLLKARPAAAPVPA |
Ga0170820_133437551 | 3300031446 | Forest Soil | LFGPLMDRMGIGVLAISAGLRLSAFFALLILRARPTAAPAPA |
Ga0170818_1049958851 | 3300031474 | Forest Soil | GLLMDHMGIGVLAISASLSLSAFFALLMLKARPAAAPSPA |
Ga0170818_1103625962 | 3300031474 | Forest Soil | GLLMDHMGIGVLAVSAGLSMSAFVALLLLKARPAAAHVPA |
Ga0318516_105666202 | 3300031543 | Soil | GLLMDRMGIGVIAVSAGLSLSAFAALLLLKSRPAGAPAPA |
Ga0318538_103764512 | 3300031546 | Soil | LMDHIGIGVLAVSAGLSLSALFALLLLRARPTAAPATA |
Ga0318571_101760062 | 3300031549 | Soil | MDYMGIGVLAISAGLSLSALFALLMLRTRPTAAPAPA |
Ga0318515_104391622 | 3300031572 | Soil | YIGIGVIAVSASLSLSAFVALLLLKARQATAPAPA |
Ga0310915_102978131 | 3300031573 | Soil | LLMDRMGIGVIAVSAGLSLTAFAAMLLLKARPRAAPVPA |
Ga0318555_105873942 | 3300031640 | Soil | DYMGIGVLAVSAGLSLSALVALLMLRARPTAAPAPA |
Ga0318561_100129071 | 3300031679 | Soil | LFGLLMDYMGIGVLAISAGLSLSALFALLMLRARPAAAPAPA |
Ga0318561_100851071 | 3300031679 | Soil | LMDYMGIGVIAVSAGLSLSAFAALLLLKARPSSTAPAPA |
Ga0318561_107753341 | 3300031679 | Soil | LMDHVGIGVLAVSAGLSLSALFALLLLRARPTAAPATA |
Ga0318574_101724341 | 3300031680 | Soil | GLLIDYMGIGVLAISAGLSLSALFALLMLRARPTAAPAPA |
Ga0318560_100097157 | 3300031682 | Soil | RTGIGVLAISAGLSLSALVALVLLKARPAPAPVAA |
Ga0306917_105818562 | 3300031719 | Soil | TQAASPVLFGILMDYMGIGVIAVSAGLSLSAFVALLLLKAQPAAAPAPA |
Ga0318493_108339302 | 3300031723 | Soil | GLLMDTMGIGVFAVSAGLSLSACVALLLLKARPAAAPAAA |
Ga0318501_104026921 | 3300031736 | Soil | YLGIGVIAVSAGLSLSAFGALLLLKARQATAPAPA |
Ga0306918_101644613 | 3300031744 | Soil | VLMDYMGIGVIAVSAGLSLSTCVGLLLLRAGPATASAPA |
Ga0306918_101826934 | 3300031744 | Soil | ASPLLFGFLMDYMGIGVLAISAGLSLSALCALLMLRARPTAAPAPA |
Ga0318494_104447572 | 3300031751 | Soil | RMGIGVLAISAGLSLSALVALVLLKARPAPAPVAA |
Ga0318494_108336771 | 3300031751 | Soil | YMGIGVIAVSAGLSLSAFVALLLLKAQPAAAPAPA |
Ga0318537_100750531 | 3300031763 | Soil | LMDYMGIGVIAVSAGLSLSTCVGLLLLRAGPATASAPA |
Ga0318537_102392291 | 3300031763 | Soil | LLMDYIGIGVIAVSAILSLSAFVALLLLKARQATAPAPA |
Ga0318554_102854221 | 3300031765 | Soil | LLMDYMGIGVLAISAGLSLSALFALLMLRARPTAAPAPA |
Ga0318554_105799192 | 3300031765 | Soil | LLFGLLMDHMGIGVLAISAGLSLSALIALLLLKARPAPAVA |
Ga0318521_104750302 | 3300031770 | Soil | VLMDHMGIGVLSISAGLSVSAFFALLILRARPTAAPAPA |
Ga0318521_105480721 | 3300031770 | Soil | VFGLLMDTMGIGVFAVSAGLSLSACVALLLLKARPAAAPAAA |
Ga0318498_104438242 | 3300031778 | Soil | LFGLLMDHMGIGVLAVSAGLSLSALFALLLLRARPTAAPATA |
Ga0318552_101895012 | 3300031782 | Soil | MDYMGIGVIAVSAGLSLSACVALLLLKARPATAPAPA |
Ga0318552_106233831 | 3300031782 | Soil | DYMGIGVLAISAGLNLSALFALLMLRARPTAAPAPA |
Ga0318523_101041931 | 3300031798 | Soil | LMDRMGIGVLAISAGLSLSALVALVLLKARPAPAPVAA |
Ga0318523_101427623 | 3300031798 | Soil | DHMGIGVLAISAGLSLSALFALLMLRARPTAAPAPA |
Ga0318497_103576192 | 3300031805 | Soil | VRPPAVPADVLMDYMGIGVIAVSAGLSLSTCVGLLLLRAGPATASAPA |
Ga0318517_102297142 | 3300031835 | Soil | LMDYLGIGVIAVSAGLSLSAFGALLLLKARQATAPAPA |
Ga0318517_103833912 | 3300031835 | Soil | DTMGIGVFAVPAGLSLSACVALLLLKARPAAAPAAA |
Ga0318512_101008641 | 3300031846 | Soil | MDTMGIGAVAVSAGLSLSACVALLLLKARPATAPAPA |
Ga0306919_110645741 | 3300031879 | Soil | FGLLMDYMGTEVIAVSAGLSLSALVALLLLKARPAAAPAPA |
Ga0306925_101123315 | 3300031890 | Soil | VPADVLMDYMGIGVIAVSAGLSLSTCVGLLLLRAGPATASAPA |
Ga0306925_102786422 | 3300031890 | Soil | MDHMGIGVLAISAGLSLSALFALLLLKARPAAAPVPA |
Ga0318536_101455352 | 3300031893 | Soil | ASPLLFGVLMDYMGIGVLAISAGLSLSALFALLMLRARPTAAPAPA |
Ga0310912_106604352 | 3300031941 | Soil | MDHMGIGVLAIFAGLSLSAFFALLMLRARPTAAPATA |
Ga0310912_110596851 | 3300031941 | Soil | YMGIGVLAISAGLSLSALFALLMLRARPTAAPAPA |
Ga0310912_112202822 | 3300031941 | Soil | LLFGLLMDYMGTGVLAISAGLSLSALFALLMLRARPTAAPAPA |
Ga0310916_100937961 | 3300031942 | Soil | FGLLMDRMGIGVLAISAGLSLSALFALLMLRARPMAAPAPA |
Ga0310916_106668932 | 3300031942 | Soil | VLFGLLMDYLGIGVIAVSAGLSLSAFGALLLLKARQATAPAPA |
Ga0310916_110174282 | 3300031942 | Soil | MDYLDIGVLAISAGLSLSALFALLMLKARPTAALL |
Ga0310913_108953561 | 3300031945 | Soil | LLMDRMGIGVIAVSAGLSLSAFAALLLLKSRPAGAPAPA |
Ga0310910_107702512 | 3300031946 | Soil | LFGLLMDYLGIGVLAISAGLSLSAAFALLMLRARPTAAAAPA |
Ga0310909_100699644 | 3300031947 | Soil | FGLLMDYMGIGVLAISAGLSLSALFALLMLRARPTAAPAPA |
Ga0306926_102808983 | 3300031954 | Soil | YMGIGVLAISAGLSLSALCALLMLRARPTAAPAPA |
Ga0306926_111529752 | 3300031954 | Soil | LLFGLLMDYLGIGVIAVSAGLSLSACVALLVLKARPATAPAPA |
Ga0318530_100430173 | 3300031959 | Soil | LLFGLLTDHMGIGVLAISAGLSLSALFALLMLRARPTAAPAPA |
Ga0318530_101043731 | 3300031959 | Soil | FGLLMDHMGIGVLAVSAGLSLSALFALLLLRARPTAAPATA |
Ga0307479_112067572 | 3300031962 | Hardwood Forest Soil | MDEMGIGVLAISAGLSLSALFALLLLKARPAAAPVPA |
Ga0306922_100314505 | 3300032001 | Soil | GLLMDHMGIGVLSISAGLSLSALIALLLLKARPAPAPVVA |
Ga0306922_102255423 | 3300032001 | Soil | FLMDYMGIGVLAISAGLSLSALCALLMLRARPTAAPAPA |
Ga0318507_103342871 | 3300032025 | Soil | DYMGIGVLAILAGLSLSALFALLMLRPRPTAAPAPA |
Ga0318549_103389861 | 3300032041 | Soil | VLFGLLMDYMGTGVLAISAGLSLSALFALLMLSARPTAAPAPA |
Ga0318556_100108641 | 3300032043 | Soil | FDLLMDRMGIGVIAVSAGLSLTAFAAMLLLKARPRAAPVPA |
Ga0318506_101685441 | 3300032052 | Soil | FGLLMDTMGIGVFAVSAGLSLSACVALLLLKARPAAAPAAA |
Ga0318506_104186041 | 3300032052 | Soil | YMGTGVLAISAGLSLSALFALLMLSARPTAAPAPA |
Ga0318506_104341862 | 3300032052 | Soil | MDYLDIGVLAISAGLSLSALFALLMLKARPTAALLPPSSAA |
Ga0318533_111880042 | 3300032059 | Soil | LFMDHMSIGVLAISAGLSLSALLALLLLKARPAAAPVPA |
Ga0318505_101300101 | 3300032060 | Soil | DHMGIGVLAVSAGLSLSALFALLLLRARPTAAPATA |
Ga0306924_109996031 | 3300032076 | Soil | DRMGIGVLAISAGLSLSALFALLMLRARPMGAPAPA |
Ga0306924_114716952 | 3300032076 | Soil | DHMGIGVLAISAGLSLSALFALLLLKARPAAAPVPA |
Ga0318577_106013701 | 3300032091 | Soil | PTGPKDYMGIGVLAISAGLNLSALFALLMLRARPTAAPAPA |
Ga0306920_1019286482 | 3300032261 | Soil | GLLMDYMGIGVIAVSAGLSLSACIALLLLKARPATAPAPA |
⦗Top⦘ |