NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F061094

Metagenome / Metatranscriptome Family F061094

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F061094
Family Type Metagenome / Metatranscriptome
Number of Sequences 132
Average Sequence Length 39 residues
Representative Sequence MDHMGIGVLAISAGLSLSALFALLLLKARPAAAPVPA
Number of Associated Samples 97
Number of Associated Scaffolds 132

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 6.06 %
% of genes near scaffold ends (potentially truncated) 77.27 %
% of genes from short scaffolds (< 2000 bps) 90.91 %
Associated GOLD sequencing projects 87
AlphaFold2 3D model prediction Yes
3D model pTM-score0.46

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (93.939 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(46.970 % of family members)
Environment Ontology (ENVO) Unclassified
(58.333 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(46.970 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: Yes Secondary Structure distribution: α-helix: 38.46%    β-sheet: 0.00%    Coil/Unstructured: 61.54%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.46
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 132 Family Scaffolds
PF07690MFS_1 26.52
PF00496SBP_bac_5 4.55
PF02417Chromate_transp 1.52
PF00144Beta-lactamase 0.76
PF00702Hydrolase 0.76
PF00571CBS 0.76
PF00126HTH_1 0.76
PF01425Amidase 0.76
PF00275EPSP_synthase 0.76
PF01545Cation_efflux 0.76
PF01527HTH_Tnp_1 0.76
PF00583Acetyltransf_1 0.76
PF13432TPR_16 0.76
PF13847Methyltransf_31 0.76
PF09851SHOCT 0.76
PF01451LMWPc 0.76
PF00072Response_reg 0.76

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 132 Family Scaffolds
COG2059Chromate transport protein ChrAInorganic ion transport and metabolism [P] 1.52
COG0053Divalent metal cation (Fe/Co/Zn/Cd) efflux pumpInorganic ion transport and metabolism [P] 0.76
COG0154Asp-tRNAAsn/Glu-tRNAGln amidotransferase A subunit or related amidaseTranslation, ribosomal structure and biogenesis [J] 0.76
COG1230Co/Zn/Cd efflux system componentInorganic ion transport and metabolism [P] 0.76
COG1680CubicO group peptidase, beta-lactamase class C familyDefense mechanisms [V] 0.76
COG1686D-alanyl-D-alanine carboxypeptidaseCell wall/membrane/envelope biogenesis [M] 0.76
COG2367Beta-lactamase class ADefense mechanisms [V] 0.76
COG3965Predicted Co/Zn/Cd cation transporter, cation efflux familyInorganic ion transport and metabolism [P] 0.76


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms93.94 %
UnclassifiedrootN/A6.06 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300004082|Ga0062384_101220171Not Available547Open in IMG/M
3300004633|Ga0066395_10841406All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae553Open in IMG/M
3300005540|Ga0066697_10291610Not Available961Open in IMG/M
3300005554|Ga0066661_10688435All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium601Open in IMG/M
3300005557|Ga0066704_10730704All Organisms → cellular organisms → Bacteria → Proteobacteria621Open in IMG/M
3300005712|Ga0070764_10724181All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria614Open in IMG/M
3300005764|Ga0066903_101374996All Organisms → cellular organisms → Bacteria → Proteobacteria1324Open in IMG/M
3300005764|Ga0066903_106901155Not Available589Open in IMG/M
3300005764|Ga0066903_108091129All Organisms → cellular organisms → Bacteria539Open in IMG/M
3300006046|Ga0066652_100487088All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1143Open in IMG/M
3300006176|Ga0070765_100081939All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria2739Open in IMG/M
3300006904|Ga0075424_102515063All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria539Open in IMG/M
3300006954|Ga0079219_10595601All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria807Open in IMG/M
3300007258|Ga0099793_10369480All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium703Open in IMG/M
3300009545|Ga0105237_11858294All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium610Open in IMG/M
3300009792|Ga0126374_10667047All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium777Open in IMG/M
3300010046|Ga0126384_10477335All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1070Open in IMG/M
3300010048|Ga0126373_10289960All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1627Open in IMG/M
3300010159|Ga0099796_10037116All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1627Open in IMG/M
3300010360|Ga0126372_10736271All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium968Open in IMG/M
3300010361|Ga0126378_10879019All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1003Open in IMG/M
3300010366|Ga0126379_13070428All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium559Open in IMG/M
3300012202|Ga0137363_10795710All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria802Open in IMG/M
3300012582|Ga0137358_10390091All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Magnetospirillum → unclassified Magnetospirillum → Magnetospirillum sp. UT-4942Open in IMG/M
3300012685|Ga0137397_10640982All Organisms → cellular organisms → Bacteria → Proteobacteria790Open in IMG/M
3300012918|Ga0137396_10179398All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1552Open in IMG/M
3300012924|Ga0137413_10106327All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1761Open in IMG/M
3300012927|Ga0137416_10420630All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1136Open in IMG/M
3300016319|Ga0182033_10557570All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium991Open in IMG/M
3300016319|Ga0182033_10603372All Organisms → cellular organisms → Bacteria → Proteobacteria954Open in IMG/M
3300016319|Ga0182033_11021118All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium736Open in IMG/M
3300016341|Ga0182035_10610869Not Available943Open in IMG/M
3300016341|Ga0182035_10964142All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium755Open in IMG/M
3300016341|Ga0182035_10973567All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria751Open in IMG/M
3300016357|Ga0182032_11864501All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium526Open in IMG/M
3300016387|Ga0182040_10016717All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales3959Open in IMG/M
3300016387|Ga0182040_10609388All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium885Open in IMG/M
3300016387|Ga0182040_10997620All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium698Open in IMG/M
3300016387|Ga0182040_11712313All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium537Open in IMG/M
3300016404|Ga0182037_10665720All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium889Open in IMG/M
3300016422|Ga0182039_10131115All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae1908Open in IMG/M
3300018090|Ga0187770_11127227All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium633Open in IMG/M
3300020579|Ga0210407_11325413All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium537Open in IMG/M
3300020580|Ga0210403_10313358Not Available1285Open in IMG/M
3300020581|Ga0210399_10523555All Organisms → cellular organisms → Bacteria → Proteobacteria984Open in IMG/M
3300020581|Ga0210399_10739720All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Cupriavidus → Cupriavidus pinatubonensis → Cupriavidus pinatubonensis JMP134806Open in IMG/M
3300020583|Ga0210401_10270786All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales1558Open in IMG/M
3300020583|Ga0210401_10547328All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae1020Open in IMG/M
3300020583|Ga0210401_10852706Not Available770Open in IMG/M
3300021088|Ga0210404_10035161All Organisms → cellular organisms → Bacteria → Proteobacteria2273Open in IMG/M
3300021358|Ga0213873_10127075All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium752Open in IMG/M
3300021444|Ga0213878_10509082All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium530Open in IMG/M
3300021474|Ga0210390_10495055All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1030Open in IMG/M
3300021560|Ga0126371_11869326All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium720Open in IMG/M
3300022530|Ga0242658_1152764All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium597Open in IMG/M
3300026494|Ga0257159_1035500All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium835Open in IMG/M
3300026542|Ga0209805_1064855All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1789Open in IMG/M
3300027651|Ga0209217_1026601All Organisms → cellular organisms → Bacteria → Proteobacteria1830Open in IMG/M
3300027783|Ga0209448_10321253All Organisms → cellular organisms → Bacteria → Proteobacteria506Open in IMG/M
3300027874|Ga0209465_10516717All Organisms → cellular organisms → Bacteria596Open in IMG/M
3300027889|Ga0209380_10418986All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium785Open in IMG/M
3300028536|Ga0137415_11199827All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium574Open in IMG/M
3300031231|Ga0170824_102805835All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium882Open in IMG/M
3300031231|Ga0170824_108324123All Organisms → cellular organisms → Bacteria504Open in IMG/M
3300031446|Ga0170820_13343755All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium629Open in IMG/M
3300031474|Ga0170818_104995885All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1030Open in IMG/M
3300031474|Ga0170818_110362596All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1348Open in IMG/M
3300031543|Ga0318516_10566620All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium649Open in IMG/M
3300031546|Ga0318538_10376451All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium767Open in IMG/M
3300031549|Ga0318571_10176006All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium753Open in IMG/M
3300031572|Ga0318515_10439162All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium698Open in IMG/M
3300031573|Ga0310915_10297813All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1139Open in IMG/M
3300031640|Ga0318555_10587394All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium603Open in IMG/M
3300031679|Ga0318561_10012907All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales3698Open in IMG/M
3300031679|Ga0318561_10085107All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1643Open in IMG/M
3300031679|Ga0318561_10775334All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium527Open in IMG/M
3300031680|Ga0318574_10172434All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1236Open in IMG/M
3300031682|Ga0318560_10009715All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria4095Open in IMG/M
3300031719|Ga0306917_10581856All Organisms → cellular organisms → Bacteria → Proteobacteria880Open in IMG/M
3300031723|Ga0318493_10833930All Organisms → cellular organisms → Bacteria → Proteobacteria520Open in IMG/M
3300031736|Ga0318501_10402692All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium739Open in IMG/M
3300031744|Ga0306918_10164461All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1649Open in IMG/M
3300031744|Ga0306918_10182693All Organisms → cellular organisms → Bacteria → Proteobacteria1571Open in IMG/M
3300031751|Ga0318494_10444757All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium754Open in IMG/M
3300031751|Ga0318494_10833677All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium540Open in IMG/M
3300031763|Ga0318537_10075053All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1241Open in IMG/M
3300031763|Ga0318537_10239229All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium674Open in IMG/M
3300031765|Ga0318554_10285422All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium939Open in IMG/M
3300031765|Ga0318554_10579919All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria633Open in IMG/M
3300031770|Ga0318521_10475030All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium750Open in IMG/M
3300031770|Ga0318521_10548072All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium697Open in IMG/M
3300031778|Ga0318498_10443824All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium574Open in IMG/M
3300031782|Ga0318552_10189501All Organisms → cellular organisms → Bacteria → Proteobacteria1039Open in IMG/M
3300031782|Ga0318552_10623383All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium550Open in IMG/M
3300031798|Ga0318523_10104193All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1394Open in IMG/M
3300031798|Ga0318523_10142762All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria1189Open in IMG/M
3300031805|Ga0318497_10357619All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium816Open in IMG/M
3300031835|Ga0318517_10229714All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium837Open in IMG/M
3300031835|Ga0318517_10383391All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria635Open in IMG/M
3300031846|Ga0318512_10100864All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1357Open in IMG/M
3300031879|Ga0306919_11064574All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium617Open in IMG/M
3300031890|Ga0306925_10112331All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria2909Open in IMG/M
3300031890|Ga0306925_10278642Not Available1800Open in IMG/M
3300031893|Ga0318536_10145535All Organisms → cellular organisms → Bacteria → Proteobacteria1203Open in IMG/M
3300031941|Ga0310912_10660435Not Available812Open in IMG/M
3300031941|Ga0310912_11059685All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium620Open in IMG/M
3300031941|Ga0310912_11220282All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria572Open in IMG/M
3300031942|Ga0310916_10093796All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales2399Open in IMG/M
3300031942|Ga0310916_10666893All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales881Open in IMG/M
3300031942|Ga0310916_11017428All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium691Open in IMG/M
3300031945|Ga0310913_10895356All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium624Open in IMG/M
3300031946|Ga0310910_10770251All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium759Open in IMG/M
3300031947|Ga0310909_10069964All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium2754Open in IMG/M
3300031954|Ga0306926_10280898All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium2061Open in IMG/M
3300031954|Ga0306926_11152975All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium913Open in IMG/M
3300031959|Ga0318530_10043017All Organisms → cellular organisms → Bacteria → Proteobacteria1673Open in IMG/M
3300031959|Ga0318530_10104373All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1129Open in IMG/M
3300031962|Ga0307479_11206757All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium720Open in IMG/M
3300032001|Ga0306922_10031450All Organisms → cellular organisms → Bacteria → Proteobacteria5402Open in IMG/M
3300032001|Ga0306922_10225542All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium2012Open in IMG/M
3300032025|Ga0318507_10334287All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium659Open in IMG/M
3300032041|Ga0318549_10338986All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium677Open in IMG/M
3300032043|Ga0318556_10010864All Organisms → cellular organisms → Bacteria → Proteobacteria3797Open in IMG/M
3300032052|Ga0318506_10168544All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium962Open in IMG/M
3300032052|Ga0318506_10418604All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium594Open in IMG/M
3300032052|Ga0318506_10434186All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium582Open in IMG/M
3300032059|Ga0318533_11188004All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium558Open in IMG/M
3300032060|Ga0318505_10130010All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1158Open in IMG/M
3300032076|Ga0306924_10999603All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium918Open in IMG/M
3300032076|Ga0306924_11471695All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria723Open in IMG/M
3300032091|Ga0318577_10601370All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium522Open in IMG/M
3300032261|Ga0306920_101928648All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium829Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil46.97%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil19.70%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil6.82%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil5.30%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil3.79%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil3.79%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil3.79%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil2.27%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil1.52%
Bulk SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Bulk Soil0.76%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil0.76%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil0.76%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland0.76%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil0.76%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere0.76%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere0.76%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.76%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300004082Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3EnvironmentalOpen in IMG/M
3300004633Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBioEnvironmentalOpen in IMG/M
3300005540Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146EnvironmentalOpen in IMG/M
3300005554Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110EnvironmentalOpen in IMG/M
3300005557Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153EnvironmentalOpen in IMG/M
3300005712Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4EnvironmentalOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300006046Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101EnvironmentalOpen in IMG/M
3300006176Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5EnvironmentalOpen in IMG/M
3300006904Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3Host-AssociatedOpen in IMG/M
3300006954Agricultural soil microbial communities from Georgia to study Nitrogen management - GA ControlEnvironmentalOpen in IMG/M
3300007258Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3EnvironmentalOpen in IMG/M
3300009545Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaGHost-AssociatedOpen in IMG/M
3300009792Tropical forest soil microbial communities from Panama - MetaG Plot_12EnvironmentalOpen in IMG/M
3300010046Tropical forest soil microbial communities from Panama - MetaG Plot_36EnvironmentalOpen in IMG/M
3300010048Tropical forest soil microbial communities from Panama - MetaG Plot_11EnvironmentalOpen in IMG/M
3300010159Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3EnvironmentalOpen in IMG/M
3300010360Tropical forest soil microbial communities from Panama - MetaG Plot_6EnvironmentalOpen in IMG/M
3300010361Tropical forest soil microbial communities from Panama - MetaG Plot_23EnvironmentalOpen in IMG/M
3300010366Tropical forest soil microbial communities from Panama - MetaG Plot_24EnvironmentalOpen in IMG/M
3300012202Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaGEnvironmentalOpen in IMG/M
3300012582Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaGEnvironmentalOpen in IMG/M
3300012685Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaGEnvironmentalOpen in IMG/M
3300012918Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaGEnvironmentalOpen in IMG/M
3300012924Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012927Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300016319Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00HEnvironmentalOpen in IMG/M
3300016341Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170EnvironmentalOpen in IMG/M
3300016357Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000EnvironmentalOpen in IMG/M
3300016387Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176EnvironmentalOpen in IMG/M
3300016404Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082EnvironmentalOpen in IMG/M
3300016422Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111EnvironmentalOpen in IMG/M
3300018090Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MGEnvironmentalOpen in IMG/M
3300020579Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-MEnvironmentalOpen in IMG/M
3300020580Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-MEnvironmentalOpen in IMG/M
3300020581Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-MEnvironmentalOpen in IMG/M
3300020583Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-MEnvironmentalOpen in IMG/M
3300021088Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-MEnvironmentalOpen in IMG/M
3300021358Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3Host-AssociatedOpen in IMG/M
3300021444Vellozia epidendroides bulk soil microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - BS_R02EnvironmentalOpen in IMG/M
3300021474Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-OEnvironmentalOpen in IMG/M
3300021560Tropical forest soil microbial communities from Panama - MetaG Plot_4EnvironmentalOpen in IMG/M
3300022530Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-30-O (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300026494Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-07-AEnvironmentalOpen in IMG/M
3300026542Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 (SPAdes)EnvironmentalOpen in IMG/M
3300027651Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M2 (SPAdes)EnvironmentalOpen in IMG/M
3300027783Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM2 (SPAdes)EnvironmentalOpen in IMG/M
3300027874Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes)EnvironmentalOpen in IMG/M
3300027889Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes)EnvironmentalOpen in IMG/M
3300028536Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300031231Coassembly Site 11 (all samples) - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031446Fir Summer Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031474Fir Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031543Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20EnvironmentalOpen in IMG/M
3300031546Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23EnvironmentalOpen in IMG/M
3300031549Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f24EnvironmentalOpen in IMG/M
3300031572Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19EnvironmentalOpen in IMG/M
3300031573Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111EnvironmentalOpen in IMG/M
3300031640Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23EnvironmentalOpen in IMG/M
3300031679Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23EnvironmentalOpen in IMG/M
3300031680Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22EnvironmentalOpen in IMG/M
3300031682Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22EnvironmentalOpen in IMG/M
3300031719Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2)EnvironmentalOpen in IMG/M
3300031723Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23EnvironmentalOpen in IMG/M
3300031736Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21EnvironmentalOpen in IMG/M
3300031744Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2)EnvironmentalOpen in IMG/M
3300031751Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24EnvironmentalOpen in IMG/M
3300031763Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f29EnvironmentalOpen in IMG/M
3300031765Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22EnvironmentalOpen in IMG/M
3300031770Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17EnvironmentalOpen in IMG/M
3300031778Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f24EnvironmentalOpen in IMG/M
3300031782Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f20EnvironmentalOpen in IMG/M
3300031798Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f19EnvironmentalOpen in IMG/M
3300031805Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23EnvironmentalOpen in IMG/M
3300031835Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f21EnvironmentalOpen in IMG/M
3300031846Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f19EnvironmentalOpen in IMG/M
3300031879Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2)EnvironmentalOpen in IMG/M
3300031890Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2)EnvironmentalOpen in IMG/M
3300031893Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f28EnvironmentalOpen in IMG/M
3300031941Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080EnvironmentalOpen in IMG/M
3300031942Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176EnvironmentalOpen in IMG/M
3300031945Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082EnvironmentalOpen in IMG/M
3300031946Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172EnvironmentalOpen in IMG/M
3300031947Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000HEnvironmentalOpen in IMG/M
3300031954Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2)EnvironmentalOpen in IMG/M
3300031959Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f24EnvironmentalOpen in IMG/M
3300031962Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515EnvironmentalOpen in IMG/M
3300032001Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2)EnvironmentalOpen in IMG/M
3300032025Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f20EnvironmentalOpen in IMG/M
3300032041Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f22EnvironmentalOpen in IMG/M
3300032043Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f24EnvironmentalOpen in IMG/M
3300032052Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f19EnvironmentalOpen in IMG/M
3300032059Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27EnvironmentalOpen in IMG/M
3300032060Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f18EnvironmentalOpen in IMG/M
3300032076Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2)EnvironmentalOpen in IMG/M
3300032091Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f25EnvironmentalOpen in IMG/M
3300032261Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2)EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
Ga0062384_10122017123300004082Bog Forest SoilIFGMLMDHMGVDVVGISAGLSLSALIALLLLRTRPQPVPAPAE*
Ga0066395_1084140623300004633Tropical Forest SoilMLCRIGEHLGIGVLAISTGLSLSALVALLLLKARPAPAPIAA*
Ga0066697_1029161023300005540SoilMGIGVLAISAGLSLSALVALLLLKARPTPAPVAA*
Ga0066661_1068843513300005554SoilMGIGVLAISAGLSLSALVAMSLLKARPVPAPVAA*
Ga0066704_1073070423300005557SoilSPLLFGLLMDHMGIGVLAISAGLSLSALLMLRAKPTAALLR*
Ga0070764_1072418123300005712SoilFGLLMDQMGIGVVAISAGLSLSAFFALLILRARPTAAPAPA*
Ga0066903_10137499623300005764Tropical Forest SoilMDYMGIGVLAISAGLSLSVLFALLMLSAIPTAAPAPT*
Ga0066903_10690115523300005764Tropical Forest SoilMGIGMLAISAGLSLGAFVALLLLKARPAAAPVPA*
Ga0066903_10809112913300005764Tropical Forest SoilMDYMGTGVLAISAGLSLSAFFALLLLKARPAAAPVPA*
Ga0066652_10048708813300006046SoilMGIGVLAISAGLSLSALGALLLLKARPTPAPVAA*
Ga0070765_10008193933300006176SoilMDEMGIGVLAISAGLSLSALFALLLLKARPAAAPVPA*
Ga0075424_10251506323300006904Populus RhizosphereFGLLMDQMGLGVLAISAGLSLSAFFALLMLKARPAAAPMPA*
Ga0079219_1059560113300006954Agricultural SoilLFGMLMDYMGTGVLAISAGLSLSALCALLLLKARPAAAPVPA*
Ga0099793_1036948023300007258Vadose Zone SoilMDEMGVGVLAISAGLSLSALFALLLLKARPAAAPVPA*
Ga0105237_1185829423300009545Corn RhizosphereDAGGIAAPLFGLLMDRMGIGVVAISAGLSLSAFFALLTLRARPRAAAPAPA*
Ga0126374_1066704723300009792Tropical Forest SoilLLMDYMGIGVLAVSAGLSLSALFALLMLRARPTAAPAPA*
Ga0126384_1047733523300010046Tropical Forest SoilMGIGVLAISAGLSLSALVALLLLKGRPAPAPLTA*
Ga0126373_1028996043300010048Tropical Forest SoilMDTMGIAVIAVSAGLSLGACVALLLLKARPATAPASA*
Ga0099796_1003711623300010159Vadose Zone SoilMDHMGIGVLAISASLSLSAFFALLMLKARAAAAPVPA*
Ga0126372_1073627123300010360Tropical Forest SoilGLLMDHMGIGVLAVSVGLSLSAFFALLLLKARPATAPVPA*
Ga0126378_1087901923300010361Tropical Forest SoilAALRPLIDRMGIGVLAISPGLSLSALVALLLLKGRPAPAPLTA*
Ga0126379_1307042823300010366Tropical Forest SoilRPLIDRMGIGVLAISAGLSLSALVALLLLKGRPAPAPLTA*
Ga0137363_1079571033300012202Vadose Zone SoilLLMDYMGIGVLAISAGLSLSALFALLLLKARPAAAPVLA*
Ga0137358_1039009123300012582Vadose Zone SoilMGLGALAISAGLSLAALLALLMLRAHPARLPLPAE*
Ga0137397_1064098223300012685Vadose Zone SoilMDEMGVGVLAISAGLSLSALFALLLLKARPAATPVPA*
Ga0137396_1017939823300012918Vadose Zone SoilMMDRLGIGVLAISAGLSLSALVALLKLRARPTAAPAPA*
Ga0137413_1010632723300012924Vadose Zone SoilMDHMGIGVLAISASLSLSAFFALLMLKARPAAAPSPA*
Ga0137416_1042063023300012927Vadose Zone SoilLMDRMGIGVLAISAGLSLSAFFALLILRARPTAAPAPA*
Ga0182033_1055757023300016319SoilFLMDYMGIGVLAISAGLSLSALFALLMLRTRPTAAPAPA
Ga0182033_1060337213300016319SoilLLFGLLMDYMGIGVLAISAGLSLSALVALLLLRARPTAAPAPA
Ga0182033_1102111813300016319SoilMDYLGIGVIAVSAGLSLSAFGALLLLKARQATAPAPA
Ga0182035_1061086923300016341SoilMDHMSIGVLAISAGLSLSALLALLLLKARPTAAPVPA
Ga0182035_1096414233300016341SoilDYMGIGVLAISAGLSLSALVALLKLRARPTAAPAPA
Ga0182035_1097356723300016341SoilLFGLLMDRMGIGVLAISAGLSLSALVALLLLKARPAAAPAAA
Ga0182032_1186450123300016357SoilDYMGIGVITVSAGLSLSAFVALLLLRARAAAPAPA
Ga0182040_1001671713300016387SoilVPADVLMDYMGIGVIAVSAGLSLSTCVGLLLLRAGPA
Ga0182040_1060938823300016387SoilMDHMGIGVLAVSAGLSLSAFFALLLLKARPATAPVPA
Ga0182040_1099762023300016387SoilMDYLDIGVLAISAGLSLSALFALLMLKARPTAAPAPA
Ga0182040_1171231323300016387SoilFGLLMDYMGIGVLAISAGLSLSALFALLMLRARPAAAPAPA
Ga0182037_1066572013300016404SoilLLFGFLMDYMGIGVLAISAGLSLSALCALLMLRARPTAGPAPA
Ga0182039_1013111523300016422SoilMDHMGIGVLAISAGLSLSALFALLLLNARPAAAPVPA
Ga0187770_1112722713300018090Tropical PeatlandMDHMGVAVLAVSAGLSLSAFLALLLLKARPNAAPAPA
Ga0210407_1132541323300020579SoilGVLMDEMGIGVLAISAGLSLSALFALLLLKARPATAPVPA
Ga0210403_1031335813300020580SoilMFGLLMDRMGVGVLAVSAGLSLSAFVALLLLKARTAAAPVPA
Ga0210399_1052355513300020581SoilMDRMGIGVLAISAGLSLSAIFALLILRARPTAAPASA
Ga0210399_1073972013300020581SoilMDHMGIGVLPISAGLSLSAFFALLILRARPTAAPAPA
Ga0210401_1027078633300020583SoilRMGVGVLAISAGLSLSAFVALMLLKTRPAAAPVPA
Ga0210401_1054732833300020583SoilLLMDHMGVGALAISAGLSLSALSALLLLKARPAAPPVPA
Ga0210401_1085270613300020583SoilMDRMGIGVLAISAGLGLSAFVALLLLKARPAAAPVAA
Ga0210404_1003516133300021088SoilLMMDRIGVGVLAISAGLSLSALVALMLLKTRPAAAPVPA
Ga0213873_1012707513300021358RhizosphereSHGLHGIGVLAISAGLSLSALFALLMLRARPTVAPAPA
Ga0213878_1050908213300021444Bulk SoilHMGVGVLAISAGLGLSAFFALLILRARPATMAAAT
Ga0210390_1049505513300021474SoilDHMGIGVLAISAGLSLSAFFALLILRARPTAAPAPA
Ga0126371_1186932623300021560Tropical Forest SoilDRMGIDVLAISAGLSLSALVALLLLKARPAVAPVAA
Ga0242658_115276423300022530SoilMDRMGIGVLAISAGLSLSAFFALLILRARPTAAPAPA
Ga0257159_103550013300026494SoilEMGIGVLAISAGLSLSALFALLLLKARPAAAPVPA
Ga0209805_106485513300026542SoilSVRDHMGIGVLAISAGLSLSARVALLLLKAQPTPAPVAA
Ga0209217_102660133300027651Forest SoilMDRLGIGVMAISAGLSLSALVALLKLRARPTAAPAPA
Ga0209448_1032125313300027783Bog Forest SoilLFGLLMDEMGIGVLAISAGLSLSALFALLLLKARPAAAPVPA
Ga0209465_1051671723300027874Tropical Forest SoilMLCRIGEHLGIGVLAISTGLSLSALVALLLLKARPAPAPIAA
Ga0209380_1041898613300027889SoilFGLLMDEMGIGVLAISAGLSLSALFALLLLKARPAAAPVPA
Ga0137415_1119982723300028536Vadose Zone SoilTQAASPLLFGLLMGHMGIGVLAISAGLSLSALLMLRAKPTAALLR
Ga0170824_10280583513300031231Forest SoilLMDQMGIGVVAISAGLSLSAFFALLLLKARSAPTPVAA
Ga0170824_10832412313300031231Forest SoilFGLLMDYMGVGVLAISAGLSLSALFALLLLKARPAAAPVPA
Ga0170820_1334375513300031446Forest SoilLFGPLMDRMGIGVLAISAGLRLSAFFALLILRARPTAAPAPA
Ga0170818_10499588513300031474Forest SoilGLLMDHMGIGVLAISASLSLSAFFALLMLKARPAAAPSPA
Ga0170818_11036259623300031474Forest SoilGLLMDHMGIGVLAVSAGLSMSAFVALLLLKARPAAAHVPA
Ga0318516_1056662023300031543SoilGLLMDRMGIGVIAVSAGLSLSAFAALLLLKSRPAGAPAPA
Ga0318538_1037645123300031546SoilLMDHIGIGVLAVSAGLSLSALFALLLLRARPTAAPATA
Ga0318571_1017600623300031549SoilMDYMGIGVLAISAGLSLSALFALLMLRTRPTAAPAPA
Ga0318515_1043916223300031572SoilYIGIGVIAVSASLSLSAFVALLLLKARQATAPAPA
Ga0310915_1029781313300031573SoilLLMDRMGIGVIAVSAGLSLTAFAAMLLLKARPRAAPVPA
Ga0318555_1058739423300031640SoilDYMGIGVLAVSAGLSLSALVALLMLRARPTAAPAPA
Ga0318561_1001290713300031679SoilLFGLLMDYMGIGVLAISAGLSLSALFALLMLRARPAAAPAPA
Ga0318561_1008510713300031679SoilLMDYMGIGVIAVSAGLSLSAFAALLLLKARPSSTAPAPA
Ga0318561_1077533413300031679SoilLMDHVGIGVLAVSAGLSLSALFALLLLRARPTAAPATA
Ga0318574_1017243413300031680SoilGLLIDYMGIGVLAISAGLSLSALFALLMLRARPTAAPAPA
Ga0318560_1000971573300031682SoilRTGIGVLAISAGLSLSALVALVLLKARPAPAPVAA
Ga0306917_1058185623300031719SoilTQAASPVLFGILMDYMGIGVIAVSAGLSLSAFVALLLLKAQPAAAPAPA
Ga0318493_1083393023300031723SoilGLLMDTMGIGVFAVSAGLSLSACVALLLLKARPAAAPAAA
Ga0318501_1040269213300031736SoilYLGIGVIAVSAGLSLSAFGALLLLKARQATAPAPA
Ga0306918_1016446133300031744SoilVLMDYMGIGVIAVSAGLSLSTCVGLLLLRAGPATASAPA
Ga0306918_1018269343300031744SoilASPLLFGFLMDYMGIGVLAISAGLSLSALCALLMLRARPTAAPAPA
Ga0318494_1044475723300031751SoilRMGIGVLAISAGLSLSALVALVLLKARPAPAPVAA
Ga0318494_1083367713300031751SoilYMGIGVIAVSAGLSLSAFVALLLLKAQPAAAPAPA
Ga0318537_1007505313300031763SoilLMDYMGIGVIAVSAGLSLSTCVGLLLLRAGPATASAPA
Ga0318537_1023922913300031763SoilLLMDYIGIGVIAVSAILSLSAFVALLLLKARQATAPAPA
Ga0318554_1028542213300031765SoilLLMDYMGIGVLAISAGLSLSALFALLMLRARPTAAPAPA
Ga0318554_1057991923300031765SoilLLFGLLMDHMGIGVLAISAGLSLSALIALLLLKARPAPAVA
Ga0318521_1047503023300031770SoilVLMDHMGIGVLSISAGLSVSAFFALLILRARPTAAPAPA
Ga0318521_1054807213300031770SoilVFGLLMDTMGIGVFAVSAGLSLSACVALLLLKARPAAAPAAA
Ga0318498_1044382423300031778SoilLFGLLMDHMGIGVLAVSAGLSLSALFALLLLRARPTAAPATA
Ga0318552_1018950123300031782SoilMDYMGIGVIAVSAGLSLSACVALLLLKARPATAPAPA
Ga0318552_1062338313300031782SoilDYMGIGVLAISAGLNLSALFALLMLRARPTAAPAPA
Ga0318523_1010419313300031798SoilLMDRMGIGVLAISAGLSLSALVALVLLKARPAPAPVAA
Ga0318523_1014276233300031798SoilDHMGIGVLAISAGLSLSALFALLMLRARPTAAPAPA
Ga0318497_1035761923300031805SoilVRPPAVPADVLMDYMGIGVIAVSAGLSLSTCVGLLLLRAGPATASAPA
Ga0318517_1022971423300031835SoilLMDYLGIGVIAVSAGLSLSAFGALLLLKARQATAPAPA
Ga0318517_1038339123300031835SoilDTMGIGVFAVPAGLSLSACVALLLLKARPAAAPAAA
Ga0318512_1010086413300031846SoilMDTMGIGAVAVSAGLSLSACVALLLLKARPATAPAPA
Ga0306919_1106457413300031879SoilFGLLMDYMGTEVIAVSAGLSLSALVALLLLKARPAAAPAPA
Ga0306925_1011233153300031890SoilVPADVLMDYMGIGVIAVSAGLSLSTCVGLLLLRAGPATASAPA
Ga0306925_1027864223300031890SoilMDHMGIGVLAISAGLSLSALFALLLLKARPAAAPVPA
Ga0318536_1014553523300031893SoilASPLLFGVLMDYMGIGVLAISAGLSLSALFALLMLRARPTAAPAPA
Ga0310912_1066043523300031941SoilMDHMGIGVLAIFAGLSLSAFFALLMLRARPTAAPATA
Ga0310912_1105968513300031941SoilYMGIGVLAISAGLSLSALFALLMLRARPTAAPAPA
Ga0310912_1122028223300031941SoilLLFGLLMDYMGTGVLAISAGLSLSALFALLMLRARPTAAPAPA
Ga0310916_1009379613300031942SoilFGLLMDRMGIGVLAISAGLSLSALFALLMLRARPMAAPAPA
Ga0310916_1066689323300031942SoilVLFGLLMDYLGIGVIAVSAGLSLSAFGALLLLKARQATAPAPA
Ga0310916_1101742823300031942SoilMDYLDIGVLAISAGLSLSALFALLMLKARPTAALL
Ga0310913_1089535613300031945SoilLLMDRMGIGVIAVSAGLSLSAFAALLLLKSRPAGAPAPA
Ga0310910_1077025123300031946SoilLFGLLMDYLGIGVLAISAGLSLSAAFALLMLRARPTAAAAPA
Ga0310909_1006996443300031947SoilFGLLMDYMGIGVLAISAGLSLSALFALLMLRARPTAAPAPA
Ga0306926_1028089833300031954SoilYMGIGVLAISAGLSLSALCALLMLRARPTAAPAPA
Ga0306926_1115297523300031954SoilLLFGLLMDYLGIGVIAVSAGLSLSACVALLVLKARPATAPAPA
Ga0318530_1004301733300031959SoilLLFGLLTDHMGIGVLAISAGLSLSALFALLMLRARPTAAPAPA
Ga0318530_1010437313300031959SoilFGLLMDHMGIGVLAVSAGLSLSALFALLLLRARPTAAPATA
Ga0307479_1120675723300031962Hardwood Forest SoilMDEMGIGVLAISAGLSLSALFALLLLKARPAAAPVPA
Ga0306922_1003145053300032001SoilGLLMDHMGIGVLSISAGLSLSALIALLLLKARPAPAPVVA
Ga0306922_1022554233300032001SoilFLMDYMGIGVLAISAGLSLSALCALLMLRARPTAAPAPA
Ga0318507_1033428713300032025SoilDYMGIGVLAILAGLSLSALFALLMLRPRPTAAPAPA
Ga0318549_1033898613300032041SoilVLFGLLMDYMGTGVLAISAGLSLSALFALLMLSARPTAAPAPA
Ga0318556_1001086413300032043SoilFDLLMDRMGIGVIAVSAGLSLTAFAAMLLLKARPRAAPVPA
Ga0318506_1016854413300032052SoilFGLLMDTMGIGVFAVSAGLSLSACVALLLLKARPAAAPAAA
Ga0318506_1041860413300032052SoilYMGTGVLAISAGLSLSALFALLMLSARPTAAPAPA
Ga0318506_1043418623300032052SoilMDYLDIGVLAISAGLSLSALFALLMLKARPTAALLPPSSAA
Ga0318533_1118800423300032059SoilLFMDHMSIGVLAISAGLSLSALLALLLLKARPAAAPVPA
Ga0318505_1013001013300032060SoilDHMGIGVLAVSAGLSLSALFALLLLRARPTAAPATA
Ga0306924_1099960313300032076SoilDRMGIGVLAISAGLSLSALFALLMLRARPMGAPAPA
Ga0306924_1147169523300032076SoilDHMGIGVLAISAGLSLSALFALLLLKARPAAAPVPA
Ga0318577_1060137013300032091SoilPTGPKDYMGIGVLAISAGLNLSALFALLMLRARPTAAPAPA
Ga0306920_10192864823300032261SoilGLLMDYMGIGVIAVSAGLSLSACIALLLLKARPATAPAPA


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.