Basic Information | |
---|---|
Family ID | F061083 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 132 |
Average Sequence Length | 38 residues |
Representative Sequence | MIHRTFFLHYRLVREAVTTVVTIGTALLVSYLILWARL |
Number of Associated Samples | 98 |
Number of Associated Scaffolds | 132 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Unclassified |
% of genes with valid RBS motifs | 85.61 % |
% of genes near scaffold ends (potentially truncated) | 15.15 % |
% of genes from short scaffolds (< 2000 bps) | 69.70 % |
Associated GOLD sequencing projects | 92 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.50 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Unclassified (53.788 % of family members) |
NCBI Taxonomy ID | N/A |
Taxonomy | N/A |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (15.909 % of family members) |
Environment Ontology (ENVO) | Unclassified (24.242 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (48.485 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 53.03% β-sheet: 0.00% Coil/Unstructured: 46.97% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.50 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 132 Family Scaffolds |
---|---|---|
PF02954 | HTH_8 | 23.48 |
PF08448 | PAS_4 | 6.06 |
PF13188 | PAS_8 | 6.06 |
PF01590 | GAF | 3.03 |
PF13492 | GAF_3 | 3.03 |
PF14870 | PSII_BNR | 2.27 |
PF12698 | ABC2_membrane_3 | 0.76 |
PF04185 | Phosphoesterase | 0.76 |
PF06182 | ABC2_membrane_6 | 0.76 |
PF02738 | MoCoBD_1 | 0.76 |
PF00753 | Lactamase_B | 0.76 |
PF02518 | HATPase_c | 0.76 |
PF00512 | HisKA | 0.76 |
PF12860 | PAS_7 | 0.76 |
PF12679 | ABC2_membrane_2 | 0.76 |
PF00005 | ABC_tran | 0.76 |
PF00145 | DNA_methylase | 0.76 |
PF04055 | Radical_SAM | 0.76 |
PF04365 | BrnT_toxin | 0.76 |
COG ID | Name | Functional Category | % Frequency in 132 Family Scaffolds |
---|---|---|---|
COG0270 | DNA-cytosine methylase | Replication, recombination and repair [L] | 0.76 |
COG2929 | Ribonuclease BrnT, toxin component of the BrnT-BrnA toxin-antitoxin system | Defense mechanisms [V] | 0.76 |
COG3511 | Phospholipase C | Cell wall/membrane/envelope biogenesis [M] | 0.76 |
COG3694 | ABC-type uncharacterized transport system, permease component | General function prediction only [R] | 0.76 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
Unclassified | root | N/A | 53.79 % |
All Organisms | root | All Organisms | 46.21 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300000567|JGI12270J11330_10017692 | All Organisms → cellular organisms → Bacteria | 4491 | Open in IMG/M |
3300005534|Ga0070735_10002090 | All Organisms → cellular organisms → Bacteria | 18401 | Open in IMG/M |
3300005534|Ga0070735_10296640 | Not Available | 975 | Open in IMG/M |
3300005538|Ga0070731_10013085 | All Organisms → cellular organisms → Bacteria | 6004 | Open in IMG/M |
3300005541|Ga0070733_10567267 | Not Available | 760 | Open in IMG/M |
3300005542|Ga0070732_10004423 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 7601 | Open in IMG/M |
3300005542|Ga0070732_10264229 | Not Available | 1031 | Open in IMG/M |
3300005542|Ga0070732_10562208 | Not Available | 692 | Open in IMG/M |
3300005602|Ga0070762_10515729 | Not Available | 785 | Open in IMG/M |
3300005764|Ga0066903_101609760 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1232 | Open in IMG/M |
3300005921|Ga0070766_10001381 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium URHE0068 | 11859 | Open in IMG/M |
3300005921|Ga0070766_10288606 | Not Available | 1051 | Open in IMG/M |
3300006050|Ga0075028_100267806 | Not Available | 943 | Open in IMG/M |
3300006059|Ga0075017_100615090 | Not Available | 831 | Open in IMG/M |
3300006176|Ga0070765_100416948 | Not Available | 1255 | Open in IMG/M |
3300009088|Ga0099830_10731949 | Not Available | 815 | Open in IMG/M |
3300009089|Ga0099828_10020846 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 5114 | Open in IMG/M |
3300009672|Ga0116215_1032629 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2397 | Open in IMG/M |
3300010379|Ga0136449_100120748 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 5269 | Open in IMG/M |
3300010379|Ga0136449_100564997 | All Organisms → cellular organisms → Bacteria | 1951 | Open in IMG/M |
3300010379|Ga0136449_101468154 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1047 | Open in IMG/M |
3300010379|Ga0136449_102252819 | Not Available | 792 | Open in IMG/M |
3300010379|Ga0136449_102965178 | Not Available | 664 | Open in IMG/M |
3300011120|Ga0150983_12165245 | Not Available | 579 | Open in IMG/M |
3300011270|Ga0137391_10538382 | Not Available | 985 | Open in IMG/M |
3300011270|Ga0137391_11318255 | Not Available | 569 | Open in IMG/M |
3300012189|Ga0137388_10133278 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2179 | Open in IMG/M |
3300012361|Ga0137360_10681106 | Not Available | 882 | Open in IMG/M |
3300012931|Ga0153915_10359200 | Not Available | 1640 | Open in IMG/M |
3300012931|Ga0153915_12025462 | Not Available | 674 | Open in IMG/M |
3300012944|Ga0137410_10249807 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1390 | Open in IMG/M |
3300014152|Ga0181533_1123759 | Not Available | 1102 | Open in IMG/M |
3300014156|Ga0181518_10261353 | Not Available | 875 | Open in IMG/M |
3300014158|Ga0181521_10491945 | Not Available | 588 | Open in IMG/M |
3300014159|Ga0181530_10195436 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1117 | Open in IMG/M |
3300014162|Ga0181538_10124412 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1499 | Open in IMG/M |
3300014164|Ga0181532_10198605 | Not Available | 1177 | Open in IMG/M |
3300014169|Ga0181531_10603024 | Not Available | 681 | Open in IMG/M |
3300014495|Ga0182015_10454443 | Not Available | 822 | Open in IMG/M |
3300014654|Ga0181525_10387419 | Not Available | 767 | Open in IMG/M |
3300014657|Ga0181522_10352187 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 877 | Open in IMG/M |
3300015051|Ga0137414_1162198 | Not Available | 4223 | Open in IMG/M |
3300017822|Ga0187802_10085347 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1179 | Open in IMG/M |
3300017822|Ga0187802_10192678 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 783 | Open in IMG/M |
3300017927|Ga0187824_10001566 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 5740 | Open in IMG/M |
3300017927|Ga0187824_10013058 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2402 | Open in IMG/M |
3300017927|Ga0187824_10168929 | Not Available | 732 | Open in IMG/M |
3300017927|Ga0187824_10363157 | Not Available | 524 | Open in IMG/M |
3300017928|Ga0187806_1040698 | Not Available | 1397 | Open in IMG/M |
3300017930|Ga0187825_10026954 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1934 | Open in IMG/M |
3300017930|Ga0187825_10240341 | Not Available | 661 | Open in IMG/M |
3300017936|Ga0187821_10076391 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1218 | Open in IMG/M |
3300017943|Ga0187819_10270802 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 991 | Open in IMG/M |
3300017948|Ga0187847_10240529 | Not Available | 986 | Open in IMG/M |
3300017994|Ga0187822_10280195 | Not Available | 582 | Open in IMG/M |
3300017995|Ga0187816_10303579 | Not Available | 701 | Open in IMG/M |
3300018022|Ga0187864_10494537 | Not Available | 514 | Open in IMG/M |
3300018046|Ga0187851_10316968 | Not Available | 902 | Open in IMG/M |
3300018047|Ga0187859_10230727 | Not Available | 991 | Open in IMG/M |
3300018047|Ga0187859_10630304 | Not Available | 606 | Open in IMG/M |
3300019268|Ga0181514_1249753 | Not Available | 528 | Open in IMG/M |
3300019786|Ga0182025_1317126 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1787 | Open in IMG/M |
3300020199|Ga0179592_10027485 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2557 | Open in IMG/M |
3300020579|Ga0210407_10276517 | Not Available | 1310 | Open in IMG/M |
3300020581|Ga0210399_10030719 | All Organisms → cellular organisms → Bacteria | 4289 | Open in IMG/M |
3300020581|Ga0210399_10228841 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1549 | Open in IMG/M |
3300020581|Ga0210399_10767252 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 789 | Open in IMG/M |
3300020581|Ga0210399_11021598 | Not Available | 665 | Open in IMG/M |
3300020582|Ga0210395_10368277 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1081 | Open in IMG/M |
3300020583|Ga0210401_10000779 | All Organisms → cellular organisms → Bacteria | 38516 | Open in IMG/M |
3300020583|Ga0210401_11047694 | Not Available | 674 | Open in IMG/M |
3300021086|Ga0179596_10395281 | Not Available | 697 | Open in IMG/M |
3300021086|Ga0179596_10628916 | Not Available | 544 | Open in IMG/M |
3300021168|Ga0210406_10364899 | Not Available | 1163 | Open in IMG/M |
3300021168|Ga0210406_10746317 | Not Available | 750 | Open in IMG/M |
3300021178|Ga0210408_10004254 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 12833 | Open in IMG/M |
3300021180|Ga0210396_10024235 | All Organisms → cellular organisms → Bacteria | 5622 | Open in IMG/M |
3300021407|Ga0210383_10588712 | Not Available | 959 | Open in IMG/M |
3300021420|Ga0210394_10016770 | All Organisms → cellular organisms → Bacteria | 6912 | Open in IMG/M |
3300021432|Ga0210384_10024982 | All Organisms → cellular organisms → Bacteria | 5661 | Open in IMG/M |
3300021432|Ga0210384_10033988 | All Organisms → cellular organisms → Bacteria | 4738 | Open in IMG/M |
3300021476|Ga0187846_10006734 | All Organisms → cellular organisms → Bacteria | 5738 | Open in IMG/M |
3300021477|Ga0210398_11429477 | Not Available | 540 | Open in IMG/M |
3300021478|Ga0210402_10283262 | Not Available | 1533 | Open in IMG/M |
3300021479|Ga0210410_11393914 | Not Available | 594 | Open in IMG/M |
3300021559|Ga0210409_10004148 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 15772 | Open in IMG/M |
3300021560|Ga0126371_10453247 | Not Available | 1429 | Open in IMG/M |
3300021861|Ga0213853_11092297 | Not Available | 1347 | Open in IMG/M |
3300024227|Ga0228598_1130776 | Not Available | 511 | Open in IMG/M |
3300025679|Ga0207933_1020250 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2847 | Open in IMG/M |
3300026514|Ga0257168_1076532 | Not Available | 741 | Open in IMG/M |
3300027565|Ga0209219_1027204 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1416 | Open in IMG/M |
3300027674|Ga0209118_1024442 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1897 | Open in IMG/M |
3300027674|Ga0209118_1050714 | Not Available | 1228 | Open in IMG/M |
3300027854|Ga0209517_10014315 | All Organisms → cellular organisms → Bacteria | 8143 | Open in IMG/M |
3300027869|Ga0209579_10039160 | All Organisms → cellular organisms → Bacteria | 2556 | Open in IMG/M |
3300027875|Ga0209283_10059502 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2447 | Open in IMG/M |
3300027895|Ga0209624_10925005 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Sorangiineae → Polyangiaceae → unclassified Polyangiaceae → Polyangiaceae bacterium | 568 | Open in IMG/M |
3300027905|Ga0209415_10044943 | All Organisms → cellular organisms → Bacteria | 5850 | Open in IMG/M |
3300027905|Ga0209415_10098561 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3224 | Open in IMG/M |
3300027908|Ga0209006_10583784 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia | 925 | Open in IMG/M |
3300027910|Ga0209583_10618881 | Not Available | 554 | Open in IMG/M |
3300027986|Ga0209168_10000561 | All Organisms → cellular organisms → Bacteria | 34609 | Open in IMG/M |
3300028792|Ga0307504_10101276 | Not Available | 918 | Open in IMG/M |
3300028800|Ga0265338_10218315 | Not Available | 1426 | Open in IMG/M |
3300028800|Ga0265338_10458055 | Not Available | 902 | Open in IMG/M |
3300028906|Ga0308309_10687880 | Not Available | 889 | Open in IMG/M |
3300031234|Ga0302325_10059453 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 7507 | Open in IMG/M |
3300031234|Ga0302325_11137153 | Not Available | 1047 | Open in IMG/M |
3300031236|Ga0302324_100867030 | Not Available | 1247 | Open in IMG/M |
3300031525|Ga0302326_10063149 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 6928 | Open in IMG/M |
3300031670|Ga0307374_10010059 | All Organisms → cellular organisms → Bacteria | 13801 | Open in IMG/M |
3300031708|Ga0310686_101186642 | All Organisms → cellular organisms → Bacteria | 7037 | Open in IMG/M |
3300031708|Ga0310686_104456233 | All Organisms → cellular organisms → Bacteria | 23360 | Open in IMG/M |
3300031708|Ga0310686_108440175 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2407 | Open in IMG/M |
3300031708|Ga0310686_113813431 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1872 | Open in IMG/M |
3300031715|Ga0307476_10031929 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3506 | Open in IMG/M |
3300031718|Ga0307474_11545897 | Not Available | 522 | Open in IMG/M |
3300031753|Ga0307477_11026039 | Not Available | 540 | Open in IMG/M |
3300031902|Ga0302322_103018107 | Not Available | 579 | Open in IMG/M |
3300031962|Ga0307479_10252610 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1741 | Open in IMG/M |
3300031962|Ga0307479_10649144 | Not Available | 1036 | Open in IMG/M |
3300032160|Ga0311301_10061204 | All Organisms → cellular organisms → Bacteria | 8218 | Open in IMG/M |
3300032160|Ga0311301_11603781 | Not Available | 792 | Open in IMG/M |
3300032174|Ga0307470_10163867 | Not Available | 1377 | Open in IMG/M |
3300032180|Ga0307471_100004860 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 8313 | Open in IMG/M |
3300032180|Ga0307471_102033573 | Not Available | 721 | Open in IMG/M |
3300032180|Ga0307471_103272498 | Not Available | 574 | Open in IMG/M |
3300032205|Ga0307472_100133507 | Not Available | 1781 | Open in IMG/M |
3300032770|Ga0335085_10003239 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 28591 | Open in IMG/M |
3300033486|Ga0316624_10396817 | Not Available | 1152 | Open in IMG/M |
3300034282|Ga0370492_0013506 | All Organisms → cellular organisms → Bacteria | 3341 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 15.91% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 9.85% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 9.09% |
Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 9.09% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 7.58% |
Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 6.82% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 6.82% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 4.55% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 4.55% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.79% |
Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 3.79% |
Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 3.03% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 2.27% |
Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 1.52% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.52% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 1.52% |
Watersheds | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Watersheds | 0.76% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.76% |
Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 0.76% |
Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 0.76% |
Palsa | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa | 0.76% |
Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 0.76% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.76% |
Soil | Environmental → Terrestrial → Soil → Clay → Unclassified → Soil | 0.76% |
Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 0.76% |
Biofilm | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Biofilm | 0.76% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.76% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300000567 | Peat soil microbial communities from Weissenstadt, Germany - SII-2010 | Environmental | Open in IMG/M |
3300005534 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 | Environmental | Open in IMG/M |
3300005538 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 | Environmental | Open in IMG/M |
3300005541 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 | Environmental | Open in IMG/M |
3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
3300006050 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014 | Environmental | Open in IMG/M |
3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
3300009672 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_2_FS metaG | Environmental | Open in IMG/M |
3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
3300012931 | Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 3 metaG | Environmental | Open in IMG/M |
3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300014152 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_60_metaG | Environmental | Open in IMG/M |
3300014156 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_60_metaG | Environmental | Open in IMG/M |
3300014158 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_60_metaG | Environmental | Open in IMG/M |
3300014159 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_60_metaG | Environmental | Open in IMG/M |
3300014162 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_30_metaG | Environmental | Open in IMG/M |
3300014164 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_30_metaG | Environmental | Open in IMG/M |
3300014169 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_10_metaG | Environmental | Open in IMG/M |
3300014495 | Permafrost microbial communities from Stordalen Mire, Sweden - 712P3M metaG | Environmental | Open in IMG/M |
3300014654 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_10_metaG | Environmental | Open in IMG/M |
3300014657 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_10_metaG | Environmental | Open in IMG/M |
3300015051 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
3300017822 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_2 | Environmental | Open in IMG/M |
3300017927 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_4 | Environmental | Open in IMG/M |
3300017928 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_1 | Environmental | Open in IMG/M |
3300017930 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_5 | Environmental | Open in IMG/M |
3300017936 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_1 | Environmental | Open in IMG/M |
3300017943 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4 | Environmental | Open in IMG/M |
3300017948 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_10 | Environmental | Open in IMG/M |
3300017994 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_2 | Environmental | Open in IMG/M |
3300017995 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_1 | Environmental | Open in IMG/M |
3300018022 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_40 | Environmental | Open in IMG/M |
3300018046 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_10 | Environmental | Open in IMG/M |
3300018047 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_10 | Environmental | Open in IMG/M |
3300019268 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_10_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300019786 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (PacBio error correction) | Environmental | Open in IMG/M |
3300020199 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
3300021086 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
3300021476 | Biofilm microbial communities from the roof of an iron ore cave, State of Minas Gerais, Brazil - TC_06 Biofilm (v2) | Environmental | Open in IMG/M |
3300021477 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O | Environmental | Open in IMG/M |
3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
3300021861 | Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - ABR_2016 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Host-Associated | Open in IMG/M |
3300025679 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample F53-3 deep-092012 (SPAdes) | Environmental | Open in IMG/M |
3300026514 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DL-13-B | Environmental | Open in IMG/M |
3300027565 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M1 (SPAdes) | Environmental | Open in IMG/M |
3300027674 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M1 (SPAdes) | Environmental | Open in IMG/M |
3300027854 | Peat soil microbial communities from Weissenstadt, Germany - SII-2010 (SPAdes) | Environmental | Open in IMG/M |
3300027869 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027895 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 (SPAdes) | Environmental | Open in IMG/M |
3300027905 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes) | Environmental | Open in IMG/M |
3300027908 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
3300027910 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 (SPAdes) | Environmental | Open in IMG/M |
3300027986 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300028792 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 19_S | Environmental | Open in IMG/M |
3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Host-Associated | Open in IMG/M |
3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
3300031234 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2 | Environmental | Open in IMG/M |
3300031236 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1 | Environmental | Open in IMG/M |
3300031525 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3 | Environmental | Open in IMG/M |
3300031670 | Soil microbial communities from Risofladan, Vaasa, Finland - OX-3 | Environmental | Open in IMG/M |
3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
3300031902 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_2 | Environmental | Open in IMG/M |
3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
3300033486 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_N3_C1_D5_A | Environmental | Open in IMG/M |
3300034282 | Peat soil microbial communities from wetlands in Alaska, United States - Eight_mile_03D_16 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
JGI12270J11330_100176922 | 3300000567 | Peatlands Soil | MIHRTMFLHYRVVSEAVTTLVTIGVALLFSYLILWARL* |
Ga0070735_1000209013 | 3300005534 | Surface Soil | MIERAYFLHYRLIREVIALAVTIGAAGLGSYLILWTHL* |
Ga0070735_102966401 | 3300005534 | Surface Soil | MIYRTLFLHYRVVSEAVTTLVTIGAALLFSYLILWARL* |
Ga0070731_100130857 | 3300005538 | Surface Soil | MIHRTFFLHYRPIREAITTAVGVGIAFLVSYLILWARP* |
Ga0070733_105672671 | 3300005541 | Surface Soil | MIPRTFFSHYRLVCEAITNVVTIGGALLLSYLILWARL* |
Ga0070732_100044236 | 3300005542 | Surface Soil | MIHRTLFLHYRLVREATTALVTIGTALLFSYLILWARL* |
Ga0070732_102642292 | 3300005542 | Surface Soil | MANGEEGDAMLRQKLFLHYRFVREAITVAVTIGAALLASYLILRVRL* |
Ga0070732_105622082 | 3300005542 | Surface Soil | MAKGMGEAAMLRRQLYLHYRVVREAVTAVVTIGAALLLSYLILNARL* |
Ga0070762_105157291 | 3300005602 | Soil | MIQRAFFLHYRMVREAITIVVTLGTAALLGYLILWVRL* |
Ga0066903_1016097602 | 3300005764 | Tropical Forest Soil | MLRQKLFLHYRLIRDAITAVVTIGAALLASYLILRARL* |
Ga0070766_100013818 | 3300005921 | Soil | MIYRAYLLHYRGVQNAITILVTVGTALLASYLILWARL* |
Ga0070766_102886062 | 3300005921 | Soil | MIHRTFFLHYRLFLGAVTTAATIGAALLLSYLVLWARL* |
Ga0075028_1002678062 | 3300006050 | Watersheds | MIYRTYLLHYRRVQNAITILVTVGTALLVSYFILWARL* |
Ga0075017_1006150902 | 3300006059 | Watersheds | MIERTYFLHFRGIREVITAAVTVGAAFLASYLILWARP* |
Ga0070765_1004169482 | 3300006176 | Soil | VQDSGQEDAMIHRTFFLHYGLFLGAVTTAATIGAALLLSYLVLWARL* |
Ga0099830_107319492 | 3300009088 | Vadose Zone Soil | MLYRKYYLHYRLVREAITAVVTIGAALLFSYLILQVHS* |
Ga0099828_100208462 | 3300009089 | Vadose Zone Soil | MLQQKFYLNYRLVCEALTGVVTIGAALLFSYLILRVRS* |
Ga0116215_10326291 | 3300009672 | Peatlands Soil | SQEGAMIHRTMFLHYRVVSEAVTTLVTIGVALLFSYLILWARL* |
Ga0136449_1001207483 | 3300010379 | Peatlands Soil | MIHRILFLHYRVVSEAAITLVTIGVALLFSYLILWARL* |
Ga0136449_1005649972 | 3300010379 | Peatlands Soil | MIHRTLILHYRLVREAIATLVTIGAALLFSYLILWARL* |
Ga0136449_1014681541 | 3300010379 | Peatlands Soil | MIHRTMFLHYRLVSEAVTTLVTIGVALLFSYLILWARL* |
Ga0136449_1022528192 | 3300010379 | Peatlands Soil | MISRKFFLHYRLVRETLTAVVTIGTALLFSYLILRVRL* |
Ga0136449_1029651782 | 3300010379 | Peatlands Soil | MLYRKYLLHYHLVRETITAIVTIGTALLFSYLILQVRF* |
Ga0150983_121652452 | 3300011120 | Forest Soil | MIQRVFFLHYRQFRDALADMITIGTALLLSYLILWLRL* |
Ga0137391_105383822 | 3300011270 | Vadose Zone Soil | MYFLHYRLVREVITAVVTIGTALLFSYLILWARL* |
Ga0137391_113182552 | 3300011270 | Vadose Zone Soil | MFYRKFYIHYRLVREAITALLTIGAALLFSYLIVKVGS* |
Ga0137388_101332782 | 3300012189 | Vadose Zone Soil | HAREAPMLHRKFYLHYRLVREAITAVVTVGAALLFSYLILQVHS* |
Ga0137360_106811061 | 3300012361 | Vadose Zone Soil | MIRQTYYLHYRLVNGVIAGVVSIGTAVLLSYLILWARY* |
Ga0153915_103592002 | 3300012931 | Freshwater Wetlands | EAAVLYRKYLLHYRLVRETITAIVMIGTALLFSYLILQVRF* |
Ga0153915_120254621 | 3300012931 | Freshwater Wetlands | MIYPRDFLHRRFYLHYRLVREAIMAAVMVGAALLLSYLILQGHF* |
Ga0137410_102498072 | 3300012944 | Vadose Zone Soil | MIRRIYFMHYRLVNGAIATVATIGTALLLSYLILWARL* |
Ga0181533_11237591 | 3300014152 | Bog | DEAREAPMLYRTYLLHYRLVRETITAIVTIGTALLFSYLILQARF* |
Ga0181518_102613532 | 3300014156 | Bog | MISRKIFLHYRLVRETLTAVVTIGTALLFSYLILRVRL* |
Ga0181521_104919451 | 3300014158 | Bog | NGRQEAAMIHRTFFLHYRVVREVITSVVAVGTALLLSYLILWARL* |
Ga0181530_101954362 | 3300014159 | Bog | MIHRTFFLHYRVVREVITSVVAVGTALLLSYLILWARL* |
Ga0181538_101244122 | 3300014162 | Bog | MISRKIFLHYRLVRETLTAVVTIGTALLFSYLILRVRL |
Ga0181532_101986052 | 3300014164 | Bog | MLSRKFFLHYRLVREALTAVVTIGTALLFSYLILRVRL* |
Ga0181531_106030242 | 3300014169 | Bog | MSSRKIYLHYRLVRETVTALVTIGTALLFSYLILRVQL* |
Ga0182015_104544432 | 3300014495 | Palsa | MQASGGFAMISRQFYLHYRLVREALTAVVTVGTALLFSYLILRVR* |
Ga0181525_103874192 | 3300014654 | Bog | MISRKIYLHYRLVRETVTALVTIGTALLFSYLILRV |
Ga0181522_103521872 | 3300014657 | Bog | MIRRIYFLHYRMVHEAIAGVVGIGAALLLSYLILWVRL* |
Ga0137414_11621985 | 3300015051 | Vadose Zone Soil | MLHRRFFLHYRLVRESLTAIAAITGAAFLSYLILRARF* |
Ga0187802_100853472 | 3300017822 | Freshwater Sediment | MIQRTFFLHYRLVREAITTMVTVGTALLLSYLILWLRL |
Ga0187802_101926781 | 3300017822 | Freshwater Sediment | MILRAFFLHYRMIREAITVMVTIGTALLLSYLILSV |
Ga0187824_100015662 | 3300017927 | Freshwater Sediment | MIYRTLFLHYRVVSEAVTTLVTIGAALLFSYLILWARL |
Ga0187824_100130582 | 3300017927 | Freshwater Sediment | MIYRTYLLHYRQVQNAITILVTVGAALLASYLILWARP |
Ga0187824_101689292 | 3300017927 | Freshwater Sediment | MIHRTLFLHYQFLREAFVTAATLGAALLFSYLILWARL |
Ga0187824_103631572 | 3300017927 | Freshwater Sediment | MIQRTLFLHYGLLRELLTTLISIGVALLFSYLILWARL |
Ga0187806_10406982 | 3300017928 | Freshwater Sediment | MILRAFFLHYRMIREAITVMVTIGTALLLSYLILSVRL |
Ga0187825_100269542 | 3300017930 | Freshwater Sediment | MIYRTLFLHYRLVSEAVTTLVTIGAALLFSYLILWARL |
Ga0187825_102403411 | 3300017930 | Freshwater Sediment | MIQRTLFLHYGLVREALTTLVSIGAALLFSYLILWARL |
Ga0187821_100763912 | 3300017936 | Freshwater Sediment | MIHRTLFLHYQFLREAFVTAATLGAALLFGYLILWARL |
Ga0187819_102708022 | 3300017943 | Freshwater Sediment | MIHRTMFLHYRVVREAITTLVTIGAALLFSYLILWARL |
Ga0187847_102405292 | 3300017948 | Peatland | MLSRKFFLHYRLVREALTAVVTIGTALLFSYLILRVRL |
Ga0187822_102801952 | 3300017994 | Freshwater Sediment | MIHRTLLLHYQFLREAFVTAATLGAALLFSYLILWARL |
Ga0187816_103035792 | 3300017995 | Freshwater Sediment | MQYKWRREAVMIQRGFFLHYRMVREAITTMVTVGSALLLSYLIVWLRL |
Ga0187864_104945372 | 3300018022 | Peatland | MLYRTYLLHYRLVRETITAIVTIGTALLFSYLILQARF |
Ga0187851_103169682 | 3300018046 | Peatland | MIRRNYFLHYRMVHDAITAMAGIGAALLLSYLVLWVRL |
Ga0187859_102307272 | 3300018047 | Peatland | MISRKIYLHYRLVRETVTALVTIGTALLFSYLILRVQL |
Ga0187859_106303042 | 3300018047 | Peatland | MISRAYYLHYRLVSEGLTTAATIGTALLLGYLILWVRL |
Ga0181514_12497532 | 3300019268 | Peatland | PRKVMLHYRFVRDAITAVVTIGTALLLSYLILKVQL |
Ga0182025_13171262 | 3300019786 | Permafrost | MIHRTMFLHYRLVSEAVTTLVTIGVALLFSYLILWARL |
Ga0179592_100274852 | 3300020199 | Vadose Zone Soil | MIRQTYYLHYRLVNGVIAGVVSIGTAVLLSYLILWARY |
Ga0210407_102765172 | 3300020579 | Soil | MIRRTYFLHYRLVNGVIAGVVSIGTAVLLSYLILWARF |
Ga0210399_100307192 | 3300020581 | Soil | MIQRAFFLHYRMVRKAITIVVTLGTAALLGYLILWVRL |
Ga0210399_102288412 | 3300020581 | Soil | MIQRAYFLHYRLVREGITAAVTIGTAMLVSYLILWA |
Ga0210399_107672521 | 3300020581 | Soil | MIQRAFFLHYRMVREAITIMVTLGTAALLGYLILRMH |
Ga0210399_110215982 | 3300020581 | Soil | MIHRTFFLHYRLVLGAVTTAATIGAALLLSYLVLWARL |
Ga0210395_103682771 | 3300020582 | Soil | IMPRAMFLHYGLVRDALTTLVSIGAALLFSYLMLWARL |
Ga0210401_100007792 | 3300020583 | Soil | MIYRTYLLHYRRIQDAITILVTAGTALLLSYLIMWARL |
Ga0210401_110476941 | 3300020583 | Soil | MIYRAYLLHYRGVQNAITILVTVGTALLASYLILWARL |
Ga0179596_103952812 | 3300021086 | Vadose Zone Soil | MILRMYFLHYRLVREVITAVVTIGTALLFSYLILWARL |
Ga0179596_106289161 | 3300021086 | Vadose Zone Soil | MIQRAYFLHYRMVREAITIVVTLGTAALLSYLILWVRL |
Ga0210406_103648991 | 3300021168 | Soil | MIRRTYFLHYRLVNGVIAGVVSIGTAVLLSYLILWSRF |
Ga0210406_107463171 | 3300021168 | Soil | MIQRAYFLHYRLVREGITAAVTIGTAMLVSYLILWARL |
Ga0210408_100042542 | 3300021178 | Soil | MIQRAYFLHYRMVNDVITAVVTLGTAVLFSYLILWARL |
Ga0210396_100242352 | 3300021180 | Soil | MIQRVFFLHYRRFRDALAAMITIGTALLVSYLILWLRL |
Ga0210383_105887122 | 3300021407 | Soil | KEAAMLPRTFFLHYRLIREAVTTAITLGAALLLSYLILWARL |
Ga0210394_100167703 | 3300021420 | Soil | MIQRAMFLHYGLVRDALTTLVSIGAALLFSYLILWARL |
Ga0210384_100249826 | 3300021432 | Soil | MIYRTYLLHYRRVQNAITILVTVGTALLVSYFILWARL |
Ga0210384_100339884 | 3300021432 | Soil | MIHRAFFLHYRLVREAVTSTVTIGTALLLSYLILWARL |
Ga0187846_100067342 | 3300021476 | Biofilm | MRYRTLYLHYRLLREAITIAVTLATALLFSYLILQGRA |
Ga0210398_114294771 | 3300021477 | Soil | MIQRAFFLHYRMVREAITTMISVGTALLLSYLILWMRL |
Ga0210402_102832622 | 3300021478 | Soil | MIRRNYFLHYRLVNDAIATVAAIGTALLLSYLILWARL |
Ga0210410_113939142 | 3300021479 | Soil | MIQRAYFLHYRLVRERITAAVTIGTAMLVSYLILWARL |
Ga0210409_100041489 | 3300021559 | Soil | MIHRTFFLHYHTICEAFTNGLTIGTALLLGYLILSARL |
Ga0126371_104532472 | 3300021560 | Tropical Forest Soil | MLRQKLFLHYRLIRDAITAVVTIGAALLASYLILRARL |
Ga0213853_110922972 | 3300021861 | Watersheds | MIHRTLFLHYRLVREATTALVTIGTALLFSYLILWARL |
Ga0228598_11307761 | 3300024227 | Rhizosphere | MIQRTYFLHYRLVHEAITNVVTIGTALLLGYFILWARL |
Ga0207933_10202502 | 3300025679 | Arctic Peat Soil | MISRQFYLHYRLVREAITVVVMIGMALLLSYLILSVRL |
Ga0257168_10765321 | 3300026514 | Soil | MIQRTFFLHYRLFREVITTVVTIGTAVLVSYLILWARL |
Ga0209219_10272042 | 3300027565 | Forest Soil | MIHRTFFLHYRLVREAVTTVVTIGTALLVSYLILWARL |
Ga0209118_10244422 | 3300027674 | Forest Soil | MIHRAFFLHYRLVREAVTSTVTIGTALLLGYLILWARL |
Ga0209118_10507141 | 3300027674 | Forest Soil | MIHRTLFLHYRLVREAVTVLVTIGTALLFSYLILWAKL |
Ga0209517_100143153 | 3300027854 | Peatlands Soil | MIHRTMFLHYRVVSEAVTTLVTIGVALLFSYLILWARL |
Ga0209579_100391602 | 3300027869 | Surface Soil | MIHRTFFLHYRPIREAITTAVGVGIAFLVSYLILWARP |
Ga0209283_100595022 | 3300027875 | Vadose Zone Soil | MLQQKFYLNYRLVCEALTGVVTIGAALLFSYLILRVRS |
Ga0209624_109250051 | 3300027895 | Forest Soil | MIHRTFFLHYRVVREAITSVGTVGTALLLGYLILWAR |
Ga0209415_100449433 | 3300027905 | Peatlands Soil | MIHRTLILHYRLVREAIATLVTIGAALLFSYLILWARL |
Ga0209415_100985611 | 3300027905 | Peatlands Soil | MLYRKYLLHYRLVRETVTAIVTIGTALLFSYLILQVRF |
Ga0209006_105837841 | 3300027908 | Forest Soil | MIRRTYFSHYRMVNEAITGAVGVGAALLLSYLILWVRL |
Ga0209583_106188811 | 3300027910 | Watersheds | MIYRTYLLHYRRVQNAITILVTVGAALLVSYFILWARL |
Ga0209168_1000056113 | 3300027986 | Surface Soil | MIERAYFLHYRLIREVIALAVTIGAAGLGSYLILWTHL |
Ga0307504_101012762 | 3300028792 | Soil | MIQGTFYLHYRLVREAITNVVTIGTALLLSYLILWARL |
Ga0265338_102183152 | 3300028800 | Rhizosphere | MISRKVYLHYRLVREGLTAVVTIGTALLFSYLILRVQF |
Ga0265338_104580552 | 3300028800 | Rhizosphere | MISRKIFLHYRLVREALTAVVTIGTALLFSYLILRVRL |
Ga0308309_106878801 | 3300028906 | Soil | MIHRTFFLHYGLFLGAVTTAATIGAALLLSYLVLWARL |
Ga0302325_100594532 | 3300031234 | Palsa | MIRRTYFSHYRMIHEAITCTVGIGAALLLSYLILWVRL |
Ga0302325_111371531 | 3300031234 | Palsa | MISRKIFLHYRLVREMVTAVVTVGTALLFSYLILQVRL |
Ga0302324_1008670302 | 3300031236 | Palsa | MIRRAYFLHYRMVREAITGAVGIGAALLLSYLILWVRL |
Ga0302326_100631491 | 3300031525 | Palsa | MIRRTYFSHYRMIHEAITCTVGIGAALLLSYLILWVR |
Ga0307374_100100597 | 3300031670 | Soil | MISRQYYLHYRLVREAITVVVMIAMALLFSYLILSVRL |
Ga0310686_1011866425 | 3300031708 | Soil | MIHRTLFLHYSLVREAITTLVTVGAALLFGYLILWARL |
Ga0310686_10445623317 | 3300031708 | Soil | MIQRAFFMHYRMVREAITTMITVGTALLLSYLILWMRF |
Ga0310686_1084401752 | 3300031708 | Soil | MILRAFFLHYRMVRDAITITVTLGTAALLGYLILWMRL |
Ga0310686_1138134312 | 3300031708 | Soil | MIHRTLFLHYRLIREVITTLVAIGMALLFSYLILWARL |
Ga0307476_100319293 | 3300031715 | Hardwood Forest Soil | MLRQKLFLHYRFVREAITVAVTIGAALLASYLILRVRL |
Ga0307474_115458972 | 3300031718 | Hardwood Forest Soil | MANGEEGDAMLRQKLFLHYRFVREAITVAVTIGAALLASYLILRVRL |
Ga0307477_110260391 | 3300031753 | Hardwood Forest Soil | MIYRTYLLHYRRVQDAITILVTAGTALLLSYLILWARL |
Ga0302322_1030181072 | 3300031902 | Fen | MLYRSYLLHYRLVRETITAVVTIGTALLFSYLILQARF |
Ga0307479_102526102 | 3300031962 | Hardwood Forest Soil | MIQRTIFLHYRLVREAVTTVVAIGTALLLSYLILWARL |
Ga0307479_106491441 | 3300031962 | Hardwood Forest Soil | MLHRKFYLHYRLVREAITAVVTIGAALLYSYLILQVHS |
Ga0311301_100612043 | 3300032160 | Peatlands Soil | MIHRILFLHYRVVSEAAITLVTIGVALLFSYLILWARL |
Ga0311301_116037811 | 3300032160 | Peatlands Soil | MISRKFFLHYRLVRETLTAVVTIGTALLFSYLILRVRL |
Ga0307470_101638671 | 3300032174 | Hardwood Forest Soil | MERAYFLHYRVVREAILTAITIGTALLASYLILWARL |
Ga0307471_1000048605 | 3300032180 | Hardwood Forest Soil | MLYRKYYIRYRLVREAITAVVTIGAALLFSYLILQVHS |
Ga0307471_1020335732 | 3300032180 | Hardwood Forest Soil | RTYFLHYRLVNGVISGVVSIGTAVLLSYLILWSRF |
Ga0307471_1032724981 | 3300032180 | Hardwood Forest Soil | MIYRTYLLHYRRIQDAITILVTVGTALLLSYLIMWARL |
Ga0307472_1001335072 | 3300032205 | Hardwood Forest Soil | MIYRTYLLHYRRVQDAITILVTVGAALLLSFLILWARL |
Ga0335085_100032397 | 3300032770 | Soil | MVRQKLYLHYRLLREAVTAVVTIGTALLFSYLILRVRL |
Ga0316624_103968171 | 3300033486 | Soil | MMTGGCRDPSNIFFHYRVVCEAITGVVTIGTALLLSYLILWARL |
Ga0370492_0013506_1198_1311 | 3300034282 | Untreated Peat Soil | MRRSYFLHYRMVHEAITSMLGIGAALLLSYLILATGH |
⦗Top⦘ |