| Basic Information | |
|---|---|
| Family ID | F061064 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 132 |
| Average Sequence Length | 41 residues |
| Representative Sequence | LAGGWFGAHYAQKADPRKVRGVVIGVGLAMSAYFFITVR |
| Number of Associated Samples | 121 |
| Number of Associated Scaffolds | 132 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 2.27 % |
| % of genes near scaffold ends (potentially truncated) | 94.70 % |
| % of genes from short scaffolds (< 2000 bps) | 88.64 % |
| Associated GOLD sequencing projects | 116 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.52 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (84.848 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (11.364 % of family members) |
| Environment Ontology (ENVO) | Unclassified (25.758 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (57.576 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 52.24% β-sheet: 0.00% Coil/Unstructured: 47.76% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.52 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 132 Family Scaffolds |
|---|---|---|
| PF01274 | Malate_synthase | 12.12 |
| PF07729 | FCD | 9.85 |
| PF08546 | ApbA_C | 9.09 |
| PF00501 | AMP-binding | 8.33 |
| PF00266 | Aminotran_5 | 6.82 |
| PF00392 | GntR | 6.06 |
| PF01326 | PPDK_N | 4.55 |
| PF00821 | PEPCK_GTP | 3.79 |
| PF02359 | CDC48_N | 3.03 |
| PF01019 | G_glu_transpept | 2.27 |
| PF13193 | AMP-binding_C | 1.52 |
| PF02416 | TatA_B_E | 1.52 |
| PF07690 | MFS_1 | 1.52 |
| PF02933 | CDC48_2 | 1.52 |
| PF01925 | TauE | 0.76 |
| PF05635 | 23S_rRNA_IVP | 0.76 |
| PF13474 | SnoaL_3 | 0.76 |
| PF13376 | OmdA | 0.76 |
| PF00486 | Trans_reg_C | 0.76 |
| PF01381 | HTH_3 | 0.76 |
| PF13181 | TPR_8 | 0.76 |
| PF17147 | PFOR_II | 0.76 |
| PF07676 | PD40 | 0.76 |
| PF12762 | DDE_Tnp_IS1595 | 0.76 |
| PF12760 | Zn_Tnp_IS1595 | 0.76 |
| PF00575 | S1 | 0.76 |
| PF01728 | FtsJ | 0.76 |
| COG ID | Name | Functional Category | % Frequency in 132 Family Scaffolds |
|---|---|---|---|
| COG2225 | Malate synthase | Energy production and conversion [C] | 12.12 |
| COG1802 | DNA-binding transcriptional regulator, GntR family | Transcription [K] | 9.85 |
| COG2186 | DNA-binding transcriptional regulator, FadR family | Transcription [K] | 9.85 |
| COG1893 | Ketopantoate reductase | Coenzyme transport and metabolism [H] | 9.09 |
| COG0574 | Phosphoenolpyruvate synthase/pyruvate phosphate dikinase | Carbohydrate transport and metabolism [G] | 4.55 |
| COG1274 | Phosphoenolpyruvate carboxykinase, GTP-dependent | Energy production and conversion [C] | 3.79 |
| COG0405 | Gamma-glutamyltranspeptidase | Amino acid transport and metabolism [E] | 2.27 |
| COG1826 | Twin-arginine protein secretion pathway components TatA and TatB | Intracellular trafficking, secretion, and vesicular transport [U] | 1.52 |
| COG0293 | 23S rRNA U2552 (ribose-2'-O)-methylase RlmE/FtsJ | Translation, ribosomal structure and biogenesis [J] | 0.76 |
| COG0730 | Sulfite exporter TauE/SafE/YfcA and related permeases, UPF0721 family | Inorganic ion transport and metabolism [P] | 0.76 |
| COG1189 | Predicted rRNA methylase YqxC, contains S4 and FtsJ domains | Translation, ribosomal structure and biogenesis [J] | 0.76 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 84.85 % |
| Unclassified | root | N/A | 15.15 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2070309004|prs_FHA1B5K04Y4T46 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 505 | Open in IMG/M |
| 3300001172|JGI12681J13546_1001568 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1298 | Open in IMG/M |
| 3300003505|JGIcombinedJ51221_10426955 | All Organisms → cellular organisms → Bacteria | 537 | Open in IMG/M |
| 3300004152|Ga0062386_100797828 | All Organisms → cellular organisms → Bacteria | 778 | Open in IMG/M |
| 3300004479|Ga0062595_101926539 | All Organisms → cellular organisms → Bacteria | 567 | Open in IMG/M |
| 3300005174|Ga0066680_10173762 | All Organisms → cellular organisms → Bacteria | 1356 | Open in IMG/M |
| 3300005177|Ga0066690_10053162 | All Organisms → cellular organisms → Bacteria | 2477 | Open in IMG/M |
| 3300005575|Ga0066702_10507337 | All Organisms → cellular organisms → Bacteria | 733 | Open in IMG/M |
| 3300005591|Ga0070761_11123687 | All Organisms → cellular organisms → Bacteria | 500 | Open in IMG/M |
| 3300005602|Ga0070762_10260068 | All Organisms → cellular organisms → Bacteria | 1082 | Open in IMG/M |
| 3300005921|Ga0070766_10632797 | All Organisms → cellular organisms → Bacteria | 720 | Open in IMG/M |
| 3300005952|Ga0080026_10150624 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 673 | Open in IMG/M |
| 3300006176|Ga0070765_101680145 | All Organisms → cellular organisms → Bacteria | 596 | Open in IMG/M |
| 3300006796|Ga0066665_10325267 | All Organisms → cellular organisms → Bacteria | 1245 | Open in IMG/M |
| 3300006800|Ga0066660_10999947 | All Organisms → cellular organisms → Bacteria | 672 | Open in IMG/M |
| 3300007258|Ga0099793_10066465 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_2_65_9 | 1621 | Open in IMG/M |
| 3300009088|Ga0099830_10761022 | All Organisms → cellular organisms → Bacteria | 798 | Open in IMG/M |
| 3300009088|Ga0099830_11314031 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 601 | Open in IMG/M |
| 3300009088|Ga0099830_11454642 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 570 | Open in IMG/M |
| 3300009089|Ga0099828_10194038 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1810 | Open in IMG/M |
| 3300009523|Ga0116221_1187470 | All Organisms → cellular organisms → Bacteria | 898 | Open in IMG/M |
| 3300009637|Ga0116118_1227488 | All Organisms → cellular organisms → Bacteria | 578 | Open in IMG/M |
| 3300009640|Ga0116126_1189789 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 667 | Open in IMG/M |
| 3300009683|Ga0116224_10391655 | All Organisms → cellular organisms → Bacteria | 661 | Open in IMG/M |
| 3300009698|Ga0116216_10823576 | All Organisms → cellular organisms → Bacteria | 556 | Open in IMG/M |
| 3300009700|Ga0116217_10012242 | All Organisms → cellular organisms → Bacteria | 7034 | Open in IMG/M |
| 3300009700|Ga0116217_10306551 | Not Available | 1020 | Open in IMG/M |
| 3300009760|Ga0116131_1232155 | Not Available | 507 | Open in IMG/M |
| 3300009764|Ga0116134_1056827 | Not Available | 1482 | Open in IMG/M |
| 3300010048|Ga0126373_13183869 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 511 | Open in IMG/M |
| 3300010048|Ga0126373_13222101 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 508 | Open in IMG/M |
| 3300010337|Ga0134062_10191877 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Ktedonobacteraceae → Ktedonobacter → Ktedonobacter racemifer | 927 | Open in IMG/M |
| 3300010339|Ga0074046_10257334 | All Organisms → cellular organisms → Bacteria | 1082 | Open in IMG/M |
| 3300010343|Ga0074044_10241181 | Not Available | 1195 | Open in IMG/M |
| 3300010375|Ga0105239_12664056 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 583 | Open in IMG/M |
| 3300010379|Ga0136449_100446123 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2272 | Open in IMG/M |
| 3300010399|Ga0134127_10398509 | All Organisms → cellular organisms → Bacteria | 1360 | Open in IMG/M |
| 3300010866|Ga0126344_1415820 | All Organisms → cellular organisms → Bacteria | 2294 | Open in IMG/M |
| 3300011271|Ga0137393_10520623 | All Organisms → cellular organisms → Bacteria | 1020 | Open in IMG/M |
| 3300012199|Ga0137383_11091827 | All Organisms → cellular organisms → Bacteria | 578 | Open in IMG/M |
| 3300012210|Ga0137378_10864798 | All Organisms → cellular organisms → Bacteria | 817 | Open in IMG/M |
| 3300012211|Ga0137377_10134016 | All Organisms → cellular organisms → Bacteria | 2368 | Open in IMG/M |
| 3300012357|Ga0137384_10282596 | All Organisms → cellular organisms → Bacteria | 1381 | Open in IMG/M |
| 3300012917|Ga0137395_10404151 | Not Available | 978 | Open in IMG/M |
| 3300012971|Ga0126369_10046951 | All Organisms → cellular organisms → Bacteria | 3667 | Open in IMG/M |
| 3300014155|Ga0181524_10297070 | All Organisms → cellular organisms → Bacteria | 738 | Open in IMG/M |
| 3300014495|Ga0182015_10698258 | All Organisms → cellular organisms → Bacteria | 640 | Open in IMG/M |
| 3300014501|Ga0182024_11027812 | Not Available | 980 | Open in IMG/M |
| 3300014654|Ga0181525_10036233 | All Organisms → cellular organisms → Bacteria | 2900 | Open in IMG/M |
| 3300014655|Ga0181516_10477320 | Not Available | 639 | Open in IMG/M |
| 3300014657|Ga0181522_10339706 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → unclassified Bryobacteraceae → Bryobacteraceae bacterium | 894 | Open in IMG/M |
| 3300016357|Ga0182032_11033577 | All Organisms → cellular organisms → Bacteria | 703 | Open in IMG/M |
| 3300016404|Ga0182037_10102489 | All Organisms → cellular organisms → Bacteria | 2063 | Open in IMG/M |
| 3300016730|Ga0181515_1282738 | All Organisms → cellular organisms → Bacteria | 1663 | Open in IMG/M |
| 3300017924|Ga0187820_1013992 | All Organisms → cellular organisms → Bacteria | 1959 | Open in IMG/M |
| 3300017940|Ga0187853_10241898 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 831 | Open in IMG/M |
| 3300017940|Ga0187853_10326980 | All Organisms → cellular organisms → Bacteria | 688 | Open in IMG/M |
| 3300017943|Ga0187819_10096818 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1762 | Open in IMG/M |
| 3300017946|Ga0187879_10231294 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1033 | Open in IMG/M |
| 3300017955|Ga0187817_10835795 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 588 | Open in IMG/M |
| 3300017972|Ga0187781_11440805 | All Organisms → cellular organisms → Bacteria | 510 | Open in IMG/M |
| 3300018022|Ga0187864_10400279 | All Organisms → cellular organisms → Bacteria | 591 | Open in IMG/M |
| 3300018033|Ga0187867_10230256 | All Organisms → cellular organisms → Bacteria | 1047 | Open in IMG/M |
| 3300018037|Ga0187883_10546254 | All Organisms → cellular organisms → Bacteria | 599 | Open in IMG/M |
| 3300018037|Ga0187883_10657837 | All Organisms → cellular organisms → Bacteria | 545 | Open in IMG/M |
| 3300018047|Ga0187859_10161323 | All Organisms → cellular organisms → Bacteria | 1191 | Open in IMG/M |
| 3300018057|Ga0187858_10463055 | All Organisms → cellular organisms → Bacteria | 780 | Open in IMG/M |
| 3300018058|Ga0187766_10979465 | All Organisms → cellular organisms → Bacteria | 601 | Open in IMG/M |
| 3300018086|Ga0187769_10982346 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 639 | Open in IMG/M |
| 3300018088|Ga0187771_11179353 | Not Available | 650 | Open in IMG/M |
| 3300018090|Ga0187770_10527599 | Not Available | 935 | Open in IMG/M |
| 3300019786|Ga0182025_1091364 | All Organisms → cellular organisms → Bacteria | 2390 | Open in IMG/M |
| 3300019877|Ga0193722_1068085 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 885 | Open in IMG/M |
| 3300021088|Ga0210404_10615002 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 618 | Open in IMG/M |
| 3300021171|Ga0210405_10065866 | All Organisms → cellular organisms → Bacteria | 2859 | Open in IMG/M |
| 3300021181|Ga0210388_11338665 | All Organisms → cellular organisms → Bacteria | 603 | Open in IMG/M |
| 3300021401|Ga0210393_10438232 | Not Available | 1066 | Open in IMG/M |
| 3300021479|Ga0210410_10005939 | All Organisms → cellular organisms → Bacteria | 10609 | Open in IMG/M |
| 3300021479|Ga0210410_10625485 | All Organisms → cellular organisms → Bacteria | 955 | Open in IMG/M |
| 3300021559|Ga0210409_10350375 | All Organisms → cellular organisms → Bacteria | 1327 | Open in IMG/M |
| 3300021560|Ga0126371_12133216 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 675 | Open in IMG/M |
| 3300022881|Ga0224545_1033815 | All Organisms → cellular organisms → Bacteria | 727 | Open in IMG/M |
| 3300025446|Ga0208038_1067203 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 649 | Open in IMG/M |
| 3300025939|Ga0207665_10484435 | All Organisms → cellular organisms → Bacteria | 953 | Open in IMG/M |
| 3300026849|Ga0207804_118798 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 616 | Open in IMG/M |
| 3300026909|Ga0207858_1011502 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 873 | Open in IMG/M |
| 3300027326|Ga0209731_1023950 | Not Available | 862 | Open in IMG/M |
| 3300027334|Ga0209529_1004917 | All Organisms → cellular organisms → Bacteria | 2097 | Open in IMG/M |
| 3300027502|Ga0209622_1103724 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 521 | Open in IMG/M |
| 3300027565|Ga0209219_1029934 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1350 | Open in IMG/M |
| 3300027567|Ga0209115_1107241 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 633 | Open in IMG/M |
| 3300027604|Ga0208324_1104026 | Not Available | 792 | Open in IMG/M |
| 3300027610|Ga0209528_1117416 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 587 | Open in IMG/M |
| 3300027652|Ga0209007_1023869 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1574 | Open in IMG/M |
| 3300027701|Ga0209447_10185016 | All Organisms → cellular organisms → Bacteria | 571 | Open in IMG/M |
| 3300027795|Ga0209139_10066501 | Not Available | 1264 | Open in IMG/M |
| 3300027846|Ga0209180_10493999 | All Organisms → cellular organisms → Bacteria | 686 | Open in IMG/M |
| 3300027855|Ga0209693_10238454 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → unclassified Bryobacteraceae → Bryobacteraceae bacterium | 892 | Open in IMG/M |
| 3300027882|Ga0209590_10141939 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1481 | Open in IMG/M |
| 3300027884|Ga0209275_10008955 | All Organisms → cellular organisms → Bacteria | 4240 | Open in IMG/M |
| 3300027905|Ga0209415_11136266 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 505 | Open in IMG/M |
| 3300028047|Ga0209526_10269815 | Not Available | 1159 | Open in IMG/M |
| 3300028047|Ga0209526_10888142 | All Organisms → cellular organisms → Bacteria | 543 | Open in IMG/M |
| 3300028560|Ga0302144_10048475 | All Organisms → cellular organisms → Bacteria | 1362 | Open in IMG/M |
| 3300028776|Ga0302303_10138942 | All Organisms → cellular organisms → Bacteria | 866 | Open in IMG/M |
| 3300028808|Ga0302228_10033055 | All Organisms → cellular organisms → Bacteria | 2575 | Open in IMG/M |
| 3300028871|Ga0302230_10084013 | Not Available | 1294 | Open in IMG/M |
| 3300028906|Ga0308309_10344788 | All Organisms → cellular organisms → Bacteria | 1269 | Open in IMG/M |
| 3300029908|Ga0311341_10592430 | Not Available | 625 | Open in IMG/M |
| 3300031057|Ga0170834_107459217 | All Organisms → cellular organisms → Bacteria | 527 | Open in IMG/M |
| 3300031234|Ga0302325_11435681 | Not Available | 894 | Open in IMG/M |
| 3300031446|Ga0170820_12955268 | All Organisms → cellular organisms → Bacteria | 936 | Open in IMG/M |
| 3300031525|Ga0302326_11401263 | Not Available | 944 | Open in IMG/M |
| 3300031708|Ga0310686_111107226 | All Organisms → cellular organisms → Bacteria | 738 | Open in IMG/M |
| 3300031708|Ga0310686_113900774 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 566 | Open in IMG/M |
| 3300031765|Ga0318554_10072926 | All Organisms → cellular organisms → Bacteria | 1905 | Open in IMG/M |
| 3300031768|Ga0318509_10543800 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 648 | Open in IMG/M |
| 3300031779|Ga0318566_10374273 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 702 | Open in IMG/M |
| 3300031794|Ga0318503_10318898 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 505 | Open in IMG/M |
| 3300031795|Ga0318557_10605784 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 503 | Open in IMG/M |
| 3300031820|Ga0307473_10097338 | All Organisms → cellular organisms → Bacteria | 1556 | Open in IMG/M |
| 3300031823|Ga0307478_10772888 | All Organisms → cellular organisms → Bacteria | 804 | Open in IMG/M |
| 3300031823|Ga0307478_11282056 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 609 | Open in IMG/M |
| 3300031912|Ga0306921_10861043 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1031 | Open in IMG/M |
| 3300031947|Ga0310909_10081096 | All Organisms → cellular organisms → Bacteria | 2573 | Open in IMG/M |
| 3300032001|Ga0306922_10915405 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 910 | Open in IMG/M |
| 3300032042|Ga0318545_10104010 | Not Available | 996 | Open in IMG/M |
| 3300032089|Ga0318525_10207171 | All Organisms → cellular organisms → Bacteria | 1008 | Open in IMG/M |
| 3300032160|Ga0311301_10734626 | All Organisms → cellular organisms → Bacteria | 1376 | Open in IMG/M |
| 3300032160|Ga0311301_11385808 | All Organisms → cellular organisms → Bacteria | 879 | Open in IMG/M |
| 3300033805|Ga0314864_0180864 | All Organisms → cellular organisms → Bacteria | 546 | Open in IMG/M |
| 3300034163|Ga0370515_0146319 | Not Available | 1013 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 11.36% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 9.85% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 8.33% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 7.58% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 7.58% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 5.30% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 3.79% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 3.79% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 3.79% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 3.79% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 3.03% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 3.03% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 3.03% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 2.27% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 2.27% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.27% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.27% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.52% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 1.52% |
| Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 1.52% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.52% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 1.52% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.76% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.76% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.76% |
| Green-Waste Compost | Environmental → Terrestrial → Soil → Unclassified → Tropical Rainforest → Green-Waste Compost | 0.76% |
| Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 0.76% |
| Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 0.76% |
| Permafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil | 0.76% |
| Palsa | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa | 0.76% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 0.76% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 0.76% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.76% |
| Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 0.76% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2070309004 | Green-waste compost microbial communities at University of California, Davis, USA, from solid state bioreactor - Luquillo Rain Forest, Puerto Rico | Environmental | Open in IMG/M |
| 3300001172 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_O1 | Environmental | Open in IMG/M |
| 3300003505 | Forest soil microbial communities from Harvard Forest LTER, USA - Combined assembly of forest soil metaG samples (ASSEMBLY_DATE=20140924) | Environmental | Open in IMG/M |
| 3300004152 | Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3 | Environmental | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300005174 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 | Environmental | Open in IMG/M |
| 3300005177 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 | Environmental | Open in IMG/M |
| 3300005575 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 | Environmental | Open in IMG/M |
| 3300005591 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 | Environmental | Open in IMG/M |
| 3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
| 3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
| 3300005952 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-045 | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
| 3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009523 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaG | Environmental | Open in IMG/M |
| 3300009637 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_40 | Environmental | Open in IMG/M |
| 3300009640 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_40 | Environmental | Open in IMG/M |
| 3300009683 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_b_LC metaG | Environmental | Open in IMG/M |
| 3300009698 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG | Environmental | Open in IMG/M |
| 3300009700 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG | Environmental | Open in IMG/M |
| 3300009760 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_17_100 | Environmental | Open in IMG/M |
| 3300009764 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_40 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010337 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09082015 | Environmental | Open in IMG/M |
| 3300010339 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM3 | Environmental | Open in IMG/M |
| 3300010343 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1 | Environmental | Open in IMG/M |
| 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300010866 | Boreal forest soil eukaryotic communities from Alaska, USA - C1-3 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300014155 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_60_metaG | Environmental | Open in IMG/M |
| 3300014495 | Permafrost microbial communities from Stordalen Mire, Sweden - 712P3M metaG | Environmental | Open in IMG/M |
| 3300014501 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014654 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_10_metaG | Environmental | Open in IMG/M |
| 3300014655 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_10_metaG | Environmental | Open in IMG/M |
| 3300014657 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_10_metaG | Environmental | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300016730 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_30_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300017924 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_5 | Environmental | Open in IMG/M |
| 3300017940 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_100 | Environmental | Open in IMG/M |
| 3300017943 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4 | Environmental | Open in IMG/M |
| 3300017946 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_10 | Environmental | Open in IMG/M |
| 3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
| 3300017972 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300018022 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_40 | Environmental | Open in IMG/M |
| 3300018033 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_10 | Environmental | Open in IMG/M |
| 3300018037 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_10 | Environmental | Open in IMG/M |
| 3300018047 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_10 | Environmental | Open in IMG/M |
| 3300018057 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_150 | Environmental | Open in IMG/M |
| 3300018058 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MG | Environmental | Open in IMG/M |
| 3300018086 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MG | Environmental | Open in IMG/M |
| 3300018088 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MG | Environmental | Open in IMG/M |
| 3300018090 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300019786 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (PacBio error correction) | Environmental | Open in IMG/M |
| 3300019877 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2m1 | Environmental | Open in IMG/M |
| 3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300022881 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 P1 20-24 | Environmental | Open in IMG/M |
| 3300025446 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_100 (SPAdes) | Environmental | Open in IMG/M |
| 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026849 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 46 (SPAdes) | Environmental | Open in IMG/M |
| 3300026909 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 23 (SPAdes) | Environmental | Open in IMG/M |
| 3300027326 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_RefH0_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027334 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027502 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM3H0_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027565 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027567 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027604 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027610 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027652 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027701 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027795 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027855 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027884 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027905 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes) | Environmental | Open in IMG/M |
| 3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028560 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_E2_2 | Environmental | Open in IMG/M |
| 3300028776 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E2_1 | Environmental | Open in IMG/M |
| 3300028808 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N1_2 | Environmental | Open in IMG/M |
| 3300028871 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N2_1 | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300029908 | II_Bog_E1 coassembly | Environmental | Open in IMG/M |
| 3300031057 | Oak Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031234 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2 | Environmental | Open in IMG/M |
| 3300031446 | Fir Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031525 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031765 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22 | Environmental | Open in IMG/M |
| 3300031768 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22 | Environmental | Open in IMG/M |
| 3300031779 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f22 | Environmental | Open in IMG/M |
| 3300031794 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f23 | Environmental | Open in IMG/M |
| 3300031795 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f19 | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032042 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f26 | Environmental | Open in IMG/M |
| 3300032089 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f23 | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300033805 | Tropical peat soil microbial communities from peatlands in Loreto, Peru - MAQ_50_10 | Environmental | Open in IMG/M |
| 3300034163 | Peat soil microbial communities from wetlands in Alaska, United States - Goldstream_04D_14 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| prs_02422750 | 2070309004 | Green-Waste Compost | MTAGALSGGWFGAHYAQKADPRMMRYVVIAIGLLMSAYFFVTTR |
| JGI12681J13546_10015681 | 3300001172 | Forest Soil | GGWFGAHYAQKADPGKVRALVIGVGVAMSAYFFLTAR* |
| JGIcombinedJ51221_104269551 | 3300003505 | Forest Soil | GALLGGWFGAHYAQKADPRKVRAFVIAVGVAMSAYFFLTTR* |
| Ga0062386_1007978281 | 3300004152 | Bog Forest Soil | GHCLVMIAGSMAGGWFGAHYAQKADPRKVRGVVIAIGLAMTAYYFVTVR* |
| Ga0062595_1019265391 | 3300004479 | Soil | GGALTGGWFGAHFTQRADPRKMRYAVIGVGLAMSAYFFIAGR* |
| Ga0066680_101737621 | 3300005174 | Soil | GSLAGGWFGAHYAQKADPRKVRGFVIGVGLPMSAYFFVKVR* |
| Ga0066690_100531624 | 3300005177 | Soil | SLAGGWFGAHYAQKADPRKMRYIVIGVGLVMSAYFFIATR* |
| Ga0066702_105073372 | 3300005575 | Soil | GGWFGAHYAQKADPRKMRYIVIGVGLVMSAYFFIATR* |
| Ga0070761_111236871 | 3300005591 | Soil | GGWFGAHYAQRADPQKVRGFVIGVGVAMTVYFFITLH* |
| Ga0070762_102600682 | 3300005602 | Soil | FGAHYAQRADPQKVRGFVIGVGVAMTVYFFITLH* |
| Ga0070766_106327971 | 3300005921 | Soil | GWFGAHYAQKADPRKVRAFVIAVGVAMSAYFFLTTR* |
| Ga0080026_101506241 | 3300005952 | Permafrost Soil | ALLGGWFGARYAQKADPKKVRALVIGVGLAMSAYFFVTVY* |
| Ga0070765_1016801452 | 3300006176 | Soil | FGAHYAQKADPRKVRAFVIAVGVAMSAYFFLTTR* |
| Ga0066665_103252673 | 3300006796 | Soil | FGAHYSQKADPKKVRYVVIAVGFAMTAYFFVTVY* |
| Ga0066660_109999471 | 3300006800 | Soil | AGGWFGAHYAQKADPRKMRYIVIGVGLVMSAYFFIATR* |
| Ga0099793_100664651 | 3300007258 | Vadose Zone Soil | GALTGGLFGAHYAQKADPQKMRYAVIGMGLAMSAYFFIAGH* |
| Ga0099830_107610221 | 3300009088 | Vadose Zone Soil | GALTGGWFGAHFAQTADPKKMRYAVIGIGLAMSAYFFIAGH* |
| Ga0099830_113140312 | 3300009088 | Vadose Zone Soil | GWFGAHYAQKADPRKMRFAVIAVGLVMSAYFFLTTR* |
| Ga0099830_114546422 | 3300009088 | Vadose Zone Soil | MIAGSLAGGWFGAHYAQKADPRKVRGVVIGVGLAMSAYFFVTVR* |
| Ga0099828_101940384 | 3300009089 | Vadose Zone Soil | VMIAGALLGGWFGAHYAQKADPQRVRYMVIAMGIAMSVYFFATVH* |
| Ga0116221_11874702 | 3300009523 | Peatlands Soil | QCVVMIAGALVGGWFGAHYAQKADPRKVRLVVIAVGVAMTAYYFVTVR* |
| Ga0116118_12274881 | 3300009637 | Peatland | IAGALLGGWFGAHYAQKADPRKVRLVVIAVGVAMSAYYFVTVR* |
| Ga0116126_11897892 | 3300009640 | Peatland | GGYGGAHFAQNLDPQIVRRFVIAVGISMSAYFFLRH* |
| Ga0116224_103916552 | 3300009683 | Peatlands Soil | IAGALVGGWFGAHYAQKADPRKVRLVVIAVGVAMTAYYFVTVR* |
| Ga0116216_108235761 | 3300009698 | Peatlands Soil | QCVVMIAGALVGGWFGAHYAQKADPRKVRLVVIAVGVAMSAYYFVTVR* |
| Ga0116217_100122426 | 3300009700 | Peatlands Soil | FGAQYAQKADPRKVRWFIIALGLGLSAYFFVKAR* |
| Ga0116217_103065513 | 3300009700 | Peatlands Soil | FGAHYAQKADPRKVRLVVIAVGVAMTAYYFVKVR* |
| Ga0116131_12321551 | 3300009760 | Peatland | VGGWFGAQDGQKADPRKLRLVVIAVGVAMSAYYFVTVR* |
| Ga0116134_10568272 | 3300009764 | Peatland | GWFGAHYAQKADPRKVRGVVIGVGLAMSAYFFITVR* |
| Ga0126373_131838692 | 3300010048 | Tropical Forest Soil | AGALSGGWFGAHYAQKADPLMMRYVVIAIGLLMSAYFFVTTW* |
| Ga0126373_132221012 | 3300010048 | Tropical Forest Soil | AGALSGGWFGAHYAQKADPLMMRYVVIAIGLLMSAYFFVTTR* |
| Ga0134062_101918771 | 3300010337 | Grasslands Soil | ALLGGWFGARYAQKADPKKLRVLVICVGIVLSVYFFVRIYIMAV* |
| Ga0074046_102573341 | 3300010339 | Bog Forest Soil | LAGGWFGAHYAQKADPRKVRRVVIAVGVAMSAYYFVTVR* |
| Ga0074044_102411812 | 3300010343 | Bog Forest Soil | ECAVMVAGALTGGWFGAHYAQKADPRKVRACVIGLGLVMSAYFFVMTR* |
| Ga0105239_126640561 | 3300010375 | Corn Rhizosphere | IAGGWSGGHYAQKADPKKLRYLVIAVGLAMTIYFFVRDALLR* |
| Ga0136449_1004461234 | 3300010379 | Peatlands Soil | IAGALVGGWFGAHYAQKADPRKVRLVVIAVGVAMTAYYFVKVR* |
| Ga0134127_103985093 | 3300010399 | Terrestrial Soil | AGGWSGGHYAQKADPKKLRYLVIAVGLAMTIYFFVRDALLR* |
| Ga0126344_14158201 | 3300010866 | Boreal Forest Soil | VMIAGSLTGGWFGAHYAQKADPRKVRGVVIGVGIAMSAYFFVTVH* |
| Ga0137393_105206232 | 3300011271 | Vadose Zone Soil | LGAHFAQKADPQKMRYAVIGMGLAMSAYFFIAGR* |
| Ga0137383_110918272 | 3300012199 | Vadose Zone Soil | MIAGSLAGGWLGAHYAQKADPRKMRYVVIGVGLVMSAYFFVATR* |
| Ga0137378_108647982 | 3300012210 | Vadose Zone Soil | GSLAGGWLGAHYAQKADPRKMRYVVIGVGLVMNAYSFVATR* |
| Ga0137377_101340163 | 3300012211 | Vadose Zone Soil | SLAGGWVGAHYAQKADPQKVRGFVIGVGLAMSAYFFVTVR* |
| Ga0137384_102825962 | 3300012357 | Vadose Zone Soil | GGWFGAHYAQKADPRKMRYVVIGVGLVMSAYFFVATR* |
| Ga0137395_104041512 | 3300012917 | Vadose Zone Soil | ALIGGWFGAHYVQKIDSEKVRGVVIAIGIAMTVYFFVALR* |
| Ga0126369_100469514 | 3300012971 | Tropical Forest Soil | ALSGGWFGARYAQKADPRMMRYVVIGIGLLMSAYFFVTTW* |
| Ga0181524_102970701 | 3300014155 | Bog | WFGAHYAQKADPRKVRLVVIAVGVAMSAYCFVTVR* |
| Ga0182015_106982582 | 3300014495 | Palsa | FGAHYAQRADPKRVRSMVIGVGIAMTAYFFFKVY* |
| Ga0182024_110278122 | 3300014501 | Permafrost | SLAGGWFGAHYAQKADPRKVRGAVIAVGVAMTAYFFVTVR* |
| Ga0181525_100362335 | 3300014654 | Bog | ALAGGWFGAHYAQKAVPRRVRAFIIGLGFTMSAYFFVTTR* |
| Ga0181516_104773202 | 3300014655 | Bog | FGAHYAQKADPRKVRGVVIGVGIVMTVYFFIKVS* |
| Ga0181522_103397062 | 3300014657 | Bog | GSLAGGWFSAHYAQKADLKTVRGVVIGVGVAMTAYFFIKVR* |
| Ga0182032_110335771 | 3300016357 | Soil | PQCFVMLAGALSGGWFGAHYAQKADPQKMRHLVIGVGLAMSAYFFVTTR |
| Ga0182037_101024893 | 3300016404 | Soil | VMLAGALSGGWFGAHYAQQADPQKMRYLVIGVGLAMSAYFFVTTR |
| Ga0181515_12827383 | 3300016730 | Peatland | ALVGGWFGAHYAQKADPRKVRLVVIAVGVAMTAYYFVTVR |
| Ga0187820_10139923 | 3300017924 | Freshwater Sediment | RAVLWSQCLGMIAGALTGGWFGADYMQKADPQRMRYVVIGVGLVMSAYFIVTAR |
| Ga0187853_102418982 | 3300017940 | Peatland | MIAGSLAGGWFGAHYAQKADPKKVRGVVIGVGLAMSVYFFVTVR |
| Ga0187853_103269802 | 3300017940 | Peatland | LIGGWFGAHYAQKADPRKVRLVVIAVGVAMSAYYFVTVR |
| Ga0187819_100968182 | 3300017943 | Freshwater Sediment | LGSLVGGWFGAHYAQKADPRKVRGVVIGVGIAMSAYFFLTIR |
| Ga0187879_102312942 | 3300017946 | Peatland | VMIAGSLVGGWFGAHYAQKADPRKVRFAVIGVGVAMTAYFFVTVR |
| Ga0187817_108357952 | 3300017955 | Freshwater Sediment | GGWFGAHYAQKADPRKVRRVVIAVGVAMSAYYFVTVR |
| Ga0187781_114408052 | 3300017972 | Tropical Peatland | VVMTAGALLGGWCGAHYAQKADPRKVRLVVIAIGVAMTAYYFATVYFAKVYLAKVR |
| Ga0187864_104002792 | 3300018022 | Peatland | GGWFGAHYAQKADPRKVRLVVIAVGVAMTAYYFVTVR |
| Ga0187867_102302562 | 3300018033 | Peatland | GGWFGAHYAQKADPRKVRFAVIGVGVAMTAYFFVTVR |
| Ga0187883_105462542 | 3300018037 | Peatland | SLVGGWFGAHYAQKADPVKVRRVVIAIGLAMSAYYFITVH |
| Ga0187883_106578373 | 3300018037 | Peatland | IAGALVGGWFGAHYAQKADPMKVRRVVIAIGVAMSVYYFTRLFT |
| Ga0187859_101613233 | 3300018047 | Peatland | VGGWFGAHYAQKADPMKVRRVVIAIGVAMSVYYFTRLFT |
| Ga0187858_104630552 | 3300018057 | Peatland | GGWFGAHYAQKADPVKVRRVVIAIGVAMSAYYFVTVR |
| Ga0187766_109794652 | 3300018058 | Tropical Peatland | ALSGGWFGAQYAQKADPRKVRWLIIALGLGLSAYFFVTAR |
| Ga0187769_109823462 | 3300018086 | Tropical Peatland | WFGAQYAQKADPKKVRWFIIALGLGLSAYFFVTAR |
| Ga0187771_111793533 | 3300018088 | Tropical Peatland | WFGAHYAQRADPRKMRLVVIAVGLVMSAYFFVTVR |
| Ga0187770_105275992 | 3300018090 | Tropical Peatland | WFGAQYAQKADPRKVRWFIIALGLGLSAYFFVKVR |
| Ga0182025_10913642 | 3300019786 | Permafrost | MVAGSLAGGWFGAHYAQKADPRKVRVVVICIGVAMSAYFFVTVR |
| Ga0193722_10680852 | 3300019877 | Soil | FGAHYAQKLPAPLVRALVIAVGVAVTTYYFWKSYHG |
| Ga0210404_106150022 | 3300021088 | Soil | ALSGGWFGAHYAQKADPRKMRYLVIGVGLAMSAYFFVATR |
| Ga0210405_100658661 | 3300021171 | Soil | ALVGGWFGAHYAQKADPGTVRALVIGVGLAMSAYFFVTAR |
| Ga0210388_113386652 | 3300021181 | Soil | GSLAGGWFGAHYAQRADPQKVRGFVIGVGVAMTVYFFITLH |
| Ga0210393_104382322 | 3300021401 | Soil | LLGGWFGAHYAQKADPRKVRALVIAVGVSMSAYFFLTAR |
| Ga0210410_1000593911 | 3300021479 | Soil | CLVMLGGALTGGWFGAQLAQTADPKKMRYAVIGIGLGMSAYFFITGR |
| Ga0210410_106254851 | 3300021479 | Soil | FGADFAQRADPQKMRYAVIAVGLAMSAYFFIVGALKN |
| Ga0210409_103503753 | 3300021559 | Soil | MLAGALTGGWFGADFAQRADPQKMRYAVIAVGLAMSAYFFIVGALKN |
| Ga0126371_121332161 | 3300021560 | Tropical Forest Soil | MTAGALSGGWFGAHYAQKADPLMMRYVVIAIGLLMSAYFFVTTW |
| Ga0224545_10338152 | 3300022881 | Soil | GLFGAHYAQRADPKRVRSMVIGVGIAMTAYFFFKVY |
| Ga0208038_10672031 | 3300025446 | Peatland | SLAGGWFGAHYAQKADPRKVRMIVIGVGISMSAYFFVTVR |
| Ga0207665_104844351 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | QCLVMLGGALTGGWFGAHFTQRADPRKMRYAVIGVGLAMSAYFFIAGR |
| Ga0207804_1187983 | 3300026849 | Tropical Forest Soil | VMLAGALSGGWFGAHYAQKADPQKMRYLVIGVGLAMSAYFFVTTR |
| Ga0207858_10115021 | 3300026909 | Tropical Forest Soil | PQCFVMLAGALSGGWFGAHYAQKADPQKMRYLVIGVGLAMSAYFFVTTR |
| Ga0209731_10239502 | 3300027326 | Forest Soil | LGGWMAAHYAQKADPVRVRYLVIATGLTMSAYFFVQLR |
| Ga0209529_10049173 | 3300027334 | Forest Soil | GGWFGAHYAQRTDPQRVRAMVIGVGVAMTMYFFIKVH |
| Ga0209622_11037242 | 3300027502 | Forest Soil | CLEMIAGALLGGWLAAHYAQKADPVRVRYLVIATGLAMSTYFFLRLR |
| Ga0209219_10299341 | 3300027565 | Forest Soil | AGALTGGWFGAHFAQKADPRKTRYAVIGVGLAMSAYFFITAH |
| Ga0209115_11072412 | 3300027567 | Forest Soil | AGGWFGAHYAQQADPKRVRGMVIGVGIAMTAYFFMRVG |
| Ga0208324_11040261 | 3300027604 | Peatlands Soil | VGGWFGAHYAQKADPRKVRAVVIAIGVAMSAYYFVTVK |
| Ga0209528_11174163 | 3300027610 | Forest Soil | MVAGALVGGWFGAHYAQKADPQKVRILVIGVGLAMSAYFFVTTY |
| Ga0209007_10238691 | 3300027652 | Forest Soil | VMMAGSLAGGWFGAHYAQKADPRKVRLGIIGVGIAMSAYFFVTVR |
| Ga0209447_101850162 | 3300027701 | Bog Forest Soil | VMIAGALAGGWFGAHYAQKADPRRIRAVVISLGFAMSAYFFVTAR |
| Ga0209139_100665012 | 3300027795 | Bog Forest Soil | MVAGALLGGWFGARYAQKADPKKVRALVIAVGLAMSAYFFVTVR |
| Ga0209180_104939992 | 3300027846 | Vadose Zone Soil | CAVMIAGSLAGGWFGAHYAQKADPRKMRYVVIGVGLVMSAYFFVANR |
| Ga0209693_102384541 | 3300027855 | Soil | GWFGAHYAQQADPKRVRGMVIGVGIAMTAYFFMRVG |
| Ga0209590_101419394 | 3300027882 | Vadose Zone Soil | GALLGGWFGAHYAQKADPQKVRYVVIAMGITMSGYFFVTVH |
| Ga0209275_100089551 | 3300027884 | Soil | LGGWFGAHYAQKADPRKVRALVIAVGAVMSAYFFVTAR |
| Ga0209415_111362661 | 3300027905 | Peatlands Soil | QCVVMIAGALVGGWFGAHYAQKADPRKVRLVVIAVGVAMTAYYFVTVR |
| Ga0209526_102698152 | 3300028047 | Forest Soil | AGALIGGWFGAHYVQKVDSEKVRGAVIAIGIAMTVYFFVALR |
| Ga0209526_108881421 | 3300028047 | Forest Soil | WFGAHYAQKADPRKVRALVIAVGIVMSLYFFIKTA |
| Ga0302144_100484751 | 3300028560 | Bog | LAGGWFGARFAQQADPRKVRAFIIGLGLVMSAYFFVTTR |
| Ga0302303_101389422 | 3300028776 | Palsa | PHCLVMIAGSLVGGWFGAHYAQKADPVKVRRVVIAIGLAMSAYYFITVH |
| Ga0302228_100330553 | 3300028808 | Palsa | GGWCGAHYAQKADPRKVRALVIGIGIVMSAYFFVQVL |
| Ga0302230_100840132 | 3300028871 | Palsa | CAVMVAGSLVGGWFGARYAQKAEPGKMRAVVIGVGLLMSAYFFVTVH |
| Ga0308309_103447882 | 3300028906 | Soil | ALAGGWFGAHYAQKADPAKMRCVVIGVGIVMTAYFFFVAAR |
| Ga0311341_105924302 | 3300029908 | Bog | LAGGWFGAHYAQKADPRKVRGVVIGVGLAMSAYFFITVR |
| Ga0170834_1074592172 | 3300031057 | Forest Soil | TGGWFGAHFAQKADPQKMRYAVIGVGLAMSAYFFIMGH |
| Ga0302325_114356811 | 3300031234 | Palsa | GGWFGARYAQKADPGKMRAVVIGVGLLMSAYFFVTVR |
| Ga0170820_129552682 | 3300031446 | Forest Soil | GALTGGWFGADFAQKADPQKMRYAVIGVGLAMSAYFFIAGALKN |
| Ga0302326_114012632 | 3300031525 | Palsa | GSLVGGWFGARYAQKADPGKMRAVVIGVGLLMSAYFFVTVR |
| Ga0310686_1111072261 | 3300031708 | Soil | GALAGGWFGAHYAQRADPRKIRAFVISLGFAMSAYFFVTAR |
| Ga0310686_1139007742 | 3300031708 | Soil | DYGGAHYAQKADPRKVRAAVIAIGVAMSAYYFVTVH |
| Ga0318554_100729264 | 3300031765 | Soil | VVMVTGALAGGWFGAHYAQKADPQKTRYFVIGVGLAMSAYFFTAPR |
| Ga0318509_105438001 | 3300031768 | Soil | GGGWFGAHYAQKADPQKMRYLVIGVGLAMSAYFFVTTR |
| Ga0318566_103742731 | 3300031779 | Soil | MLAGALSGGWFGAHYAQQADPQKMRYLVIGVGLAMSAYFFVTTR |
| Ga0318503_103188982 | 3300031794 | Soil | TGALAGGWFGAHYAQKADPQKTRYFVIGVGLAMSAYFFTAPR |
| Ga0318557_106057842 | 3300031795 | Soil | LSGGWFGAHYAQKADPRMMRYVVIAIGLLMSAYFFVTTR |
| Ga0307473_100973381 | 3300031820 | Hardwood Forest Soil | VMIAGALAGGWFGAHYAQKADPRKVRYAVIGVGLAMSGYFFVATR |
| Ga0307478_107728882 | 3300031823 | Hardwood Forest Soil | LGGWFGAHYAQKADPRKVRAFVIAVGVAMSAYFFLTTR |
| Ga0307478_112820561 | 3300031823 | Hardwood Forest Soil | AFVGGWFGAHCAQKADPRKVRGVVIGVGVAMSAYFFLTIR |
| Ga0306921_108610433 | 3300031912 | Soil | RRGRNLYLGGCRLVMLAGALSGGWFGAHYAQQADPQKMRYLVIGVGLAMSAYFFVTTR |
| Ga0310909_100810964 | 3300031947 | Soil | GGWFGAHYAQKADPRMMRYVVIAIGLLMSAYFFVTTR |
| Ga0306922_109154053 | 3300032001 | Soil | GGCRLVMLAGALSGGWFGAHYAQQADPQKMRYLVIGVGLAMSAYFFVTTR |
| Ga0318545_101040101 | 3300032042 | Soil | LSGGWFGAHYAQKADPQKMRHLVIGVGLAMSAYFFVTTR |
| Ga0318525_102071711 | 3300032089 | Soil | GALSGGWFGAHYAQKADPQKMRHLVIGVGLAMSAYFFVTTR |
| Ga0311301_107346261 | 3300032160 | Peatlands Soil | VMIAGALVGGWFGAHYAQKADPRKVRLVVIAVGVAMTAYYFVTVR |
| Ga0311301_113858082 | 3300032160 | Peatlands Soil | MVGGWFGAHYAQKANPVKVRRVVIAIGLAMTAYYFVTVR |
| Ga0314864_0180864_434_544 | 3300033805 | Peatland | GGYWGAYYAQRMDPDRVRQFVIAVGVAMTAYFFARG |
| Ga0370515_0146319_78_212 | 3300034163 | Untreated Peat Soil | MIVGSLAGGWFGANYAQKADPQKVRAAVIGVGISMSVYFFITVR |
| ⦗Top⦘ |