NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F061051

Metagenome / Metatranscriptome Family F061051

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F061051
Family Type Metagenome / Metatranscriptome
Number of Sequences 132
Average Sequence Length 46 residues
Representative Sequence ATGLGSSGRARSYDIIDAKLFALRRCERNSPVPVCTILWCRPGG
Number of Associated Samples 118
Number of Associated Scaffolds 132

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.00 %
% of genes near scaffold ends (potentially truncated) 92.42 %
% of genes from short scaffolds (< 2000 bps) 90.91 %
Associated GOLD sequencing projects 115
AlphaFold2 3D model prediction Yes
3D model pTM-score0.36

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (94.697 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil
(18.182 % of family members)
Environment Ontology (ENVO) Unclassified
(31.061 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(40.152 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 34.72%    β-sheet: 0.00%    Coil/Unstructured: 65.28%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.36
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 132 Family Scaffolds
PF12804NTP_transf_3 55.30
PF01381HTH_3 4.55
PF13478XdhC_C 3.03
PF07813LTXXQ 2.27
PF00440TetR_N 2.27
PF00034Cytochrom_C 1.52
PF07859Abhydrolase_3 1.52
PF05988DUF899 0.76
PF02625XdhC_CoxI 0.76
PF13561adh_short_C2 0.76
PF13560HTH_31 0.76
PF00266Aminotran_5 0.76
PF01896DNA_primase_S 0.76
PF06039Mqo 0.76
PF13533Biotin_lipoyl_2 0.76
PF13358DDE_3 0.76

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 132 Family Scaffolds
COG3678Periplasmic chaperone Spy, Spy/CpxP familyPosttranslational modification, protein turnover, chaperones [O] 9.09
COG0657Acetyl esterase/lipaseLipid transport and metabolism [I] 1.52
COG0579L-2-hydroxyglutarate oxidase LhgOCarbohydrate transport and metabolism [G] 0.76
COG1975Molybdoenzyme maturation factor PaoD (Mo cofactor insertion), XdhC/CoxF familyPosttranslational modification, protein turnover, chaperones [O] 0.76
COG4312Predicted dithiol-disulfide oxidoreductase, DUF899 familyGeneral function prediction only [R] 0.76


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms97.73 %
UnclassifiedrootN/A2.27 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300002073|JGI24745J21846_1043018All Organisms → cellular organisms → Bacteria562Open in IMG/M
3300004633|Ga0066395_10455955All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae730Open in IMG/M
3300005331|Ga0070670_100059747All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales3272Open in IMG/M
3300005332|Ga0066388_101613477All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1142Open in IMG/M
3300005332|Ga0066388_102175067All Organisms → cellular organisms → Bacteria1000Open in IMG/M
3300005332|Ga0066388_104115735All Organisms → cellular organisms → Bacteria741Open in IMG/M
3300005468|Ga0070707_102229861All Organisms → cellular organisms → Bacteria515Open in IMG/M
3300005544|Ga0070686_100095534All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1997Open in IMG/M
3300005548|Ga0070665_100749664All Organisms → cellular organisms → Bacteria989Open in IMG/M
3300005554|Ga0066661_10249462All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1099Open in IMG/M
3300005557|Ga0066704_10214900All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1302Open in IMG/M
3300005587|Ga0066654_10838920All Organisms → cellular organisms → Bacteria524Open in IMG/M
3300005764|Ga0066903_101057319All Organisms → cellular organisms → Bacteria1491Open in IMG/M
3300005764|Ga0066903_101163711All Organisms → cellular organisms → Bacteria1428Open in IMG/M
3300005764|Ga0066903_103467186All Organisms → cellular organisms → Bacteria850Open in IMG/M
3300005764|Ga0066903_103683910All Organisms → cellular organisms → Bacteria824Open in IMG/M
3300005764|Ga0066903_105508431All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria667Open in IMG/M
3300006038|Ga0075365_10256431All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1229Open in IMG/M
3300006042|Ga0075368_10416568All Organisms → cellular organisms → Bacteria592Open in IMG/M
3300006178|Ga0075367_10274920All Organisms → cellular organisms → Bacteria1058Open in IMG/M
3300006603|Ga0074064_10010724All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1340Open in IMG/M
3300006604|Ga0074060_10010323All Organisms → cellular organisms → Bacteria829Open in IMG/M
3300006604|Ga0074060_11512071All Organisms → cellular organisms → Bacteria659Open in IMG/M
3300006605|Ga0074057_12173275All Organisms → cellular organisms → Bacteria814Open in IMG/M
3300006844|Ga0075428_100673335All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1103Open in IMG/M
3300006854|Ga0075425_100419818All Organisms → cellular organisms → Bacteria1541Open in IMG/M
3300006854|Ga0075425_102088214All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria633Open in IMG/M
3300006854|Ga0075425_103138506All Organisms → cellular organisms → Bacteria503Open in IMG/M
3300007788|Ga0099795_10038350All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae1691Open in IMG/M
3300009088|Ga0099830_10694981All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium837Open in IMG/M
3300009147|Ga0114129_11089144All Organisms → cellular organisms → Bacteria1001Open in IMG/M
3300009162|Ga0075423_10840793All Organisms → cellular organisms → Bacteria972Open in IMG/M
3300009174|Ga0105241_10651174All Organisms → cellular organisms → Bacteria957Open in IMG/M
3300010046|Ga0126384_11571308All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae618Open in IMG/M
3300010047|Ga0126382_11631150All Organisms → cellular organisms → Bacteria599Open in IMG/M
3300010159|Ga0099796_10255788All Organisms → cellular organisms → Bacteria729Open in IMG/M
3300010333|Ga0134080_10612758All Organisms → cellular organisms → Bacteria531Open in IMG/M
3300010359|Ga0126376_10807120All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae917Open in IMG/M
3300010360|Ga0126372_10952457All Organisms → cellular organisms → Bacteria866Open in IMG/M
3300010361|Ga0126378_10824362All Organisms → cellular organisms → Bacteria1036Open in IMG/M
3300010361|Ga0126378_10957303All Organisms → cellular organisms → Bacteria961Open in IMG/M
3300010371|Ga0134125_12704202All Organisms → cellular organisms → Bacteria539Open in IMG/M
3300010376|Ga0126381_102055108All Organisms → cellular organisms → Bacteria823Open in IMG/M
3300010396|Ga0134126_12085402All Organisms → cellular organisms → Bacteria619Open in IMG/M
3300011271|Ga0137393_10424707All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1139Open in IMG/M
3300012199|Ga0137383_10264418All Organisms → cellular organisms → Bacteria1260Open in IMG/M
3300012201|Ga0137365_11356540All Organisms → cellular organisms → Bacteria502Open in IMG/M
3300012204|Ga0137374_10269540All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1415Open in IMG/M
3300012205|Ga0137362_10624025All Organisms → cellular organisms → Bacteria929Open in IMG/M
3300012206|Ga0137380_10183684All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1901Open in IMG/M
3300012209|Ga0137379_11427099All Organisms → cellular organisms → Bacteria595Open in IMG/M
3300012210|Ga0137378_10641019All Organisms → cellular organisms → Bacteria973Open in IMG/M
3300012211|Ga0137377_10096233All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria2800Open in IMG/M
3300012350|Ga0137372_10140588All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1981Open in IMG/M
3300012351|Ga0137386_10279548All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1201Open in IMG/M
3300012354|Ga0137366_10876436All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium633Open in IMG/M
3300012355|Ga0137369_10341698All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1096Open in IMG/M
3300012361|Ga0137360_10712886All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria862Open in IMG/M
3300012362|Ga0137361_10161759All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales2008Open in IMG/M
3300012505|Ga0157339_1066165All Organisms → cellular organisms → Bacteria512Open in IMG/M
3300012532|Ga0137373_10337376All Organisms → cellular organisms → Bacteria1187Open in IMG/M
3300012685|Ga0137397_10872318All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium667Open in IMG/M
3300012917|Ga0137395_11016834All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium593Open in IMG/M
3300012987|Ga0164307_10618495All Organisms → cellular organisms → Bacteria838Open in IMG/M
3300013308|Ga0157375_12972164All Organisms → cellular organisms → Bacteria566Open in IMG/M
3300014745|Ga0157377_10853898All Organisms → cellular organisms → Bacteria676Open in IMG/M
3300015077|Ga0173483_10285932All Organisms → cellular organisms → Bacteria801Open in IMG/M
3300015245|Ga0137409_10456738All Organisms → cellular organisms → Bacteria1098Open in IMG/M
3300015374|Ga0132255_102067434All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae868Open in IMG/M
3300015374|Ga0132255_105794455All Organisms → cellular organisms → Bacteria523Open in IMG/M
3300016294|Ga0182041_10754803All Organisms → cellular organisms → Bacteria866Open in IMG/M
3300016371|Ga0182034_11590382All Organisms → cellular organisms → Bacteria574Open in IMG/M
3300017792|Ga0163161_11811298All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium543Open in IMG/M
3300018468|Ga0066662_12972488All Organisms → cellular organisms → Bacteria504Open in IMG/M
3300019361|Ga0173482_10156793All Organisms → cellular organisms → Bacteria892Open in IMG/M
3300019885|Ga0193747_1149402All Organisms → cellular organisms → Bacteria532Open in IMG/M
3300019999|Ga0193718_1101988All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium587Open in IMG/M
3300021363|Ga0193699_10209254All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium810Open in IMG/M
3300021432|Ga0210384_11303312All Organisms → cellular organisms → Bacteria631Open in IMG/M
3300021444|Ga0213878_10051475All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1608Open in IMG/M
3300021560|Ga0126371_10437536All Organisms → cellular organisms → Bacteria1453Open in IMG/M
3300022756|Ga0222622_10602238All Organisms → cellular organisms → Bacteria793Open in IMG/M
3300025904|Ga0207647_10224150All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1083Open in IMG/M
3300025906|Ga0207699_10119628All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1701Open in IMG/M
3300025910|Ga0207684_11690651All Organisms → cellular organisms → Bacteria510Open in IMG/M
3300025911|Ga0207654_10517992All Organisms → cellular organisms → Bacteria844Open in IMG/M
3300025922|Ga0207646_10335363All Organisms → cellular organisms → Bacteria1366Open in IMG/M
3300025926|Ga0207659_10590355All Organisms → cellular organisms → Bacteria946Open in IMG/M
3300025934|Ga0207686_11286216All Organisms → cellular organisms → Bacteria600Open in IMG/M
3300025981|Ga0207640_11378855All Organisms → cellular organisms → Bacteria631Open in IMG/M
3300026330|Ga0209473_1206869All Organisms → cellular organisms → Bacteria737Open in IMG/M
3300026547|Ga0209156_10062087All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1941Open in IMG/M
3300027633|Ga0208988_1047158All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium canariense1101Open in IMG/M
3300027671|Ga0209588_1037382All Organisms → cellular organisms → Bacteria1563Open in IMG/M
3300027874|Ga0209465_10154010All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1142Open in IMG/M
3300027874|Ga0209465_10580728All Organisms → cellular organisms → Bacteria556Open in IMG/M
3300027884|Ga0209275_10698547Not Available584Open in IMG/M
3300027903|Ga0209488_10156559All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae1721Open in IMG/M
3300028047|Ga0209526_10008993All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium6885Open in IMG/M
3300028768|Ga0307280_10012205All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria2355Open in IMG/M
3300028803|Ga0307281_10302365All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium597Open in IMG/M
3300028824|Ga0307310_10285544All Organisms → cellular organisms → Bacteria800Open in IMG/M
3300028828|Ga0307312_10385201All Organisms → cellular organisms → Bacteria919Open in IMG/M
3300031152|Ga0307501_10016531All Organisms → cellular organisms → Bacteria1336Open in IMG/M
3300031200|Ga0307496_10060180All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium663Open in IMG/M
3300031543|Ga0318516_10145267All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_71361Open in IMG/M
3300031679|Ga0318561_10068926All Organisms → Viruses → Predicted Viral1808Open in IMG/M
3300031719|Ga0306917_10621571All Organisms → cellular organisms → Bacteria849Open in IMG/M
3300031747|Ga0318502_10025774All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales2909Open in IMG/M
3300031748|Ga0318492_10018335All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales3002Open in IMG/M
3300031751|Ga0318494_10405036All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium791Open in IMG/M
3300031764|Ga0318535_10011836All Organisms → Viruses → Predicted Viral3140Open in IMG/M
3300031779|Ga0318566_10505953All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium591Open in IMG/M
3300031795|Ga0318557_10551939All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium529Open in IMG/M
3300031797|Ga0318550_10026128All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales2475Open in IMG/M
3300031799|Ga0318565_10039974All Organisms → cellular organisms → Bacteria2150Open in IMG/M
3300031805|Ga0318497_10063724Not Available1924Open in IMG/M
3300031860|Ga0318495_10026762All Organisms → Viruses → Predicted Viral2501Open in IMG/M
3300031943|Ga0310885_10913702All Organisms → cellular organisms → Bacteria503Open in IMG/M
3300032009|Ga0318563_10326179All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium831Open in IMG/M
3300032042|Ga0318545_10137337All Organisms → cellular organisms → Bacteria → Proteobacteria866Open in IMG/M
3300032054|Ga0318570_10399099All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium627Open in IMG/M
3300032066|Ga0318514_10052456All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1977Open in IMG/M
3300032068|Ga0318553_10107841All Organisms → cellular organisms → Bacteria1424Open in IMG/M
3300032068|Ga0318553_10431132All Organisms → cellular organisms → Bacteria690Open in IMG/M
3300032089|Ga0318525_10064165All Organisms → Viruses → Predicted Viral1838Open in IMG/M
3300032122|Ga0310895_10237488All Organisms → cellular organisms → Bacteria836Open in IMG/M
3300032180|Ga0307471_101716439All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae781Open in IMG/M
3300032180|Ga0307471_101993312All Organisms → cellular organisms → Bacteria728Open in IMG/M
3300032205|Ga0307472_101335777All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae692Open in IMG/M
3300032770|Ga0335085_11207728All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae803Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil18.18%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil15.15%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil9.09%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil8.33%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil6.06%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil4.55%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere4.55%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil3.03%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere3.03%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil2.27%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil2.27%
Populus EndosphereHost-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere2.27%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil1.52%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil1.52%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil1.52%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere1.52%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere1.52%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere1.52%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.52%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere1.52%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.76%
Bulk SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Bulk Soil0.76%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil0.76%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil0.76%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil0.76%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil0.76%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere0.76%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere0.76%
Corn, Switchgrass And Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere0.76%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.76%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.76%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere0.76%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300002073Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4Host-AssociatedOpen in IMG/M
3300004633Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBioEnvironmentalOpen in IMG/M
3300005331Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaGHost-AssociatedOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005468Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaGEnvironmentalOpen in IMG/M
3300005544Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaGEnvironmentalOpen in IMG/M
3300005548Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaGHost-AssociatedOpen in IMG/M
3300005554Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110EnvironmentalOpen in IMG/M
3300005557Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153EnvironmentalOpen in IMG/M
3300005587Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103EnvironmentalOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300006038Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5Host-AssociatedOpen in IMG/M
3300006042Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3Host-AssociatedOpen in IMG/M
3300006178Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2Host-AssociatedOpen in IMG/M
3300006603Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMC (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006604Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLMB (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006605Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHAB (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006844Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2Host-AssociatedOpen in IMG/M
3300006854Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4Host-AssociatedOpen in IMG/M
3300007788Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2EnvironmentalOpen in IMG/M
3300009088Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaGEnvironmentalOpen in IMG/M
3300009147Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2)Host-AssociatedOpen in IMG/M
3300009162Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2Host-AssociatedOpen in IMG/M
3300009174Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaGHost-AssociatedOpen in IMG/M
3300010046Tropical forest soil microbial communities from Panama - MetaG Plot_36EnvironmentalOpen in IMG/M
3300010047Tropical forest soil microbial communities from Panama - MetaG Plot_30EnvironmentalOpen in IMG/M
3300010159Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3EnvironmentalOpen in IMG/M
3300010333Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300010359Tropical forest soil microbial communities from Panama - MetaG Plot_15EnvironmentalOpen in IMG/M
3300010360Tropical forest soil microbial communities from Panama - MetaG Plot_6EnvironmentalOpen in IMG/M
3300010361Tropical forest soil microbial communities from Panama - MetaG Plot_23EnvironmentalOpen in IMG/M
3300010371Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1EnvironmentalOpen in IMG/M
3300010376Tropical forest soil microbial communities from Panama - MetaG Plot_28EnvironmentalOpen in IMG/M
3300010396Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2EnvironmentalOpen in IMG/M
3300011271Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaGEnvironmentalOpen in IMG/M
3300012199Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaGEnvironmentalOpen in IMG/M
3300012201Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaGEnvironmentalOpen in IMG/M
3300012204Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaGEnvironmentalOpen in IMG/M
3300012205Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaGEnvironmentalOpen in IMG/M
3300012206Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaGEnvironmentalOpen in IMG/M
3300012209Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaGEnvironmentalOpen in IMG/M
3300012210Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaGEnvironmentalOpen in IMG/M
3300012211Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaGEnvironmentalOpen in IMG/M
3300012350Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaGEnvironmentalOpen in IMG/M
3300012351Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaGEnvironmentalOpen in IMG/M
3300012354Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaGEnvironmentalOpen in IMG/M
3300012355Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaGEnvironmentalOpen in IMG/M
3300012361Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaGEnvironmentalOpen in IMG/M
3300012362Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaGEnvironmentalOpen in IMG/M
3300012505Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.yng.090610Host-AssociatedOpen in IMG/M
3300012532Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_80_16 metaGEnvironmentalOpen in IMG/M
3300012685Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaGEnvironmentalOpen in IMG/M
3300012917Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaGEnvironmentalOpen in IMG/M
3300012987Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MGEnvironmentalOpen in IMG/M
3300013308Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaGHost-AssociatedOpen in IMG/M
3300014745Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaGHost-AssociatedOpen in IMG/M
3300015077Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S178-409R-2 (version 2)EnvironmentalOpen in IMG/M
3300015245Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300016294Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178EnvironmentalOpen in IMG/M
3300016371Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172EnvironmentalOpen in IMG/M
3300017792Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaGHost-AssociatedOpen in IMG/M
3300018468Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111EnvironmentalOpen in IMG/M
3300019361Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 (version 2)EnvironmentalOpen in IMG/M
3300019885Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1m2EnvironmentalOpen in IMG/M
3300019999Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2a1EnvironmentalOpen in IMG/M
3300021363Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3c2EnvironmentalOpen in IMG/M
3300021432Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-MEnvironmentalOpen in IMG/M
3300021444Vellozia epidendroides bulk soil microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - BS_R02EnvironmentalOpen in IMG/M
3300021560Tropical forest soil microbial communities from Panama - MetaG Plot_4EnvironmentalOpen in IMG/M
3300022756Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1EnvironmentalOpen in IMG/M
3300025904Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025906Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025910Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025911Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025922Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025926Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025934Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025981Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026327Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 (SPAdes)EnvironmentalOpen in IMG/M
3300026330Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 (SPAdes)EnvironmentalOpen in IMG/M
3300026547Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 (SPAdes)EnvironmentalOpen in IMG/M
3300027633Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA Ref_M1 (SPAdes)EnvironmentalOpen in IMG/M
3300027671Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes)EnvironmentalOpen in IMG/M
3300027874Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes)EnvironmentalOpen in IMG/M
3300027884Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes)EnvironmentalOpen in IMG/M
3300027903Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes)EnvironmentalOpen in IMG/M
3300028047Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes)EnvironmentalOpen in IMG/M
3300028768Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_119EnvironmentalOpen in IMG/M
3300028803Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_120EnvironmentalOpen in IMG/M
3300028824Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_197EnvironmentalOpen in IMG/M
3300028828Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202EnvironmentalOpen in IMG/M
3300031152Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 15_SEnvironmentalOpen in IMG/M
3300031200Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 9_SEnvironmentalOpen in IMG/M
3300031543Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20EnvironmentalOpen in IMG/M
3300031679Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23EnvironmentalOpen in IMG/M
3300031719Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2)EnvironmentalOpen in IMG/M
3300031747Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22EnvironmentalOpen in IMG/M
3300031748Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f22EnvironmentalOpen in IMG/M
3300031751Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24EnvironmentalOpen in IMG/M
3300031764Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f27EnvironmentalOpen in IMG/M
3300031779Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f22EnvironmentalOpen in IMG/M
3300031795Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f19EnvironmentalOpen in IMG/M
3300031797Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f23EnvironmentalOpen in IMG/M
3300031799Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f21EnvironmentalOpen in IMG/M
3300031805Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23EnvironmentalOpen in IMG/M
3300031860Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f25EnvironmentalOpen in IMG/M
3300031943Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D2EnvironmentalOpen in IMG/M
3300032009Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f19EnvironmentalOpen in IMG/M
3300032042Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f26EnvironmentalOpen in IMG/M
3300032054Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f23EnvironmentalOpen in IMG/M
3300032066Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f18EnvironmentalOpen in IMG/M
3300032068Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f21EnvironmentalOpen in IMG/M
3300032089Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f23EnvironmentalOpen in IMG/M
3300032122Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D4EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300032205Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05EnvironmentalOpen in IMG/M
3300032770Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGI24745J21846_104301823300002073Corn, Switchgrass And Miscanthus RhizosphereCRAAGLGSGGWARSVNVVDAKIWALRRCERGSPVPVCTILWCRPGG*
Ga0066395_1045595513300004633Tropical Forest SoilSLVTSEASAYVCFATGVGSSGGGRSYSIIDAKLIALRRCEHHSPVPICTILWCRPGY*
Ga0070670_10005974753300005331Switchgrass RhizosphereVCRAVGIGSGGYGRSFSVIDAKLIALRRCENYSPIPVCTILWCRPGG*
Ga0066388_10161347713300005332Tropical Forest SoilWVCRATGVGSGGWARSGSIIDAKFMALRRCERHSPVPVCTVVYCRPGW*
Ga0066388_10217506713300005332Tropical Forest SoilLASSEASAWVCYATGLGSGGFARAYDIIDAKLFALRRCERNSPVPVCTLLWCRPGR*
Ga0066388_10411573523300005332Tropical Forest SoilSSEASAWVCHATGLGSGASARSYSIIDAKLWALRRCERGSPLPVCTILWCRPGG*
Ga0070707_10222986123300005468Corn, Switchgrass And Miscanthus RhizosphereASAWVCRAAGLGSGGWARSVNVVDAKIWALRRCERGSPVPVCTILWCRPGG*
Ga0070686_10009553413300005544Switchgrass RhizosphereAGLGSGGWARSVSVVDAKIWALRRCERNSPVPVCTILWCRPGG*
Ga0070665_10074966423300005548Switchgrass RhizosphereASSEASAWVCRAAGLGSGGWARSVNVVDAKIWALRRCERGSPVPVCTILWCRPGG*
Ga0066661_1024946213300005554SoilMGASYSIVDAKLWALRRCEHYSPLPVCTILWCRPGG*
Ga0066704_1021490023300005557SoilASSEASAWVCRAAGLGSGGWGRSYSIVDAKLWALRRCEHYSPLPVCTILWCRPGG*
Ga0066654_1083892023300005587SoilLGSGGYGRSYDIIDAKLFALRRCERNSPAPVCTILWCRPGG*
Ga0066903_10105731913300005764Tropical Forest SoilMASSEASAWVCQATGVGSGGWARSYSIIDAKLGALRRCEHHSPVPICTIVWCRPGF*
Ga0066903_10116371123300005764Tropical Forest SoilGLGSSGTARAYDIIDAKLFALRRCERNSPVPVCTLLWCRPGR*
Ga0066903_10346718623300005764Tropical Forest SoilGGWARSGSIIDAKFMALRRCERHSPVPVCTVVYCRPGW*
Ga0066903_10368391013300005764Tropical Forest SoilQASAWACFATGLGSSGFARAYDIIDAKLFALRQCERNSPAPVCVILWCRPRG*
Ga0066903_10550843123300005764Tropical Forest SoilIVSMASSEASAWVCQAAGVGSGGWARSYSIIDAKLGALRRCEHHSPVPICTIVWCRPDF*
Ga0075365_1025643123300006038Populus EndosphereSARSYSIIDAKLWALRRCERGSPLPVCTILWCRPGG*
Ga0075368_1041656813300006042Populus EndosphereWARSYNVVDAKIWALRRCERNSPVPVCTILWCRPGG*
Ga0075367_1027492013300006178Populus EndosphereWARSYNVVDAKIWALRRCERGSPVPVCTILWCRPGG*
Ga0074064_1001072423300006603SoilSEASAWVCRAAGLGSGGWARSFNVVDAKIWALRRCERNSPVPVCTILWCRPGG*
Ga0074060_1001032313300006604SoilSAWVCRAAGLGSGGWARSVNVVDAKIWALRRCERGSPVPVCTILWCRPGG*
Ga0074060_1151207113300006604SoilASSEASAWVCRAAGLGSGGWARSFNVVDAKIWALRRCERNSPVPVCTILWCRPGG*
Ga0074057_1217327513300006605SoilGVGSGGWARSYSVIDAKFMALRRCEHHSPVPVCTILWCRPGG*
Ga0075428_10067333513300006844Populus RhizosphereCVLKASSESSAWVCRAVGIGSGGYGRSFSVIDAKLIIALRRCENYSPIPVCTILCCRPGG
Ga0075425_10041981823300006854Populus RhizosphereYGRSYDIIDAKLFALRRCERNSPVPVCTILWCRPGG*
Ga0075425_10208821423300006854Populus RhizosphereSAWVCRAVGIGSGGYGRSFSVIDAKLIIALRRCENYSPIPVCTILCCRPGG*
Ga0075425_10313850613300006854Populus RhizosphereWGSWGWARSFSIERAKFVALRRCERGSALHVCTISWCRP*
Ga0099795_1003835063300007788Vadose Zone SoilSEASAWVCRAVGVGSGGMGRSATVADAKFQALRRCEHRGPVPVCTILWCRPGG*
Ga0099830_1069498143300009088Vadose Zone SoilAWVCFATGLGSGGWGRSYDIIDAKLFALRRCERNSPLPVCTILWCRPGG*
Ga0114129_1108914423300009147Populus RhizosphereWVCLATGLGSGGYGRSYDIIDAKLFALRRCERNSPVPICTILWCRPGG*
Ga0075423_1084079323300009162Populus RhizosphereMSAATSEASAWVCRATGLYSGGFARSANIIDAKLFALRRCERNSPIPVCTLTWCRPGY*
Ga0105241_1065117423300009174Corn RhizosphereGSGGWARSVNVVDAKIWALRRCERGSPVPVCTILWCRPGG*
Ga0126384_1157130823300010046Tropical Forest SoilGVGSGGWARAYSVIDAKLIALLRCEHHSLVPICTILWCRPGY*
Ga0126382_1163115013300010047Tropical Forest SoilRAYDIIDAKLFALRRCERNSPVPVCTLLWCRPGR*
Ga0099796_1025578823300010159Vadose Zone SoilGSGGWGRGYSIIDAKLWALRSCERHSAVPVCTLIWCRPGR*
Ga0134080_1061275823300010333Grasslands SoilGFARAYDIIDAKLFALRRCERNSSVPVCTLLWCRPGR*
Ga0126376_1080712033300010359Tropical Forest SoilAGVGSGGWARNYSIIDAKLMALRRCEHHSPVPVCTILWCRPGY*
Ga0126372_1095245713300010360Tropical Forest SoilWVCFATGLGSGGYGRSYDIIDAKLFALRRCERNSPVPVCTILWCRPGG*
Ga0126378_1082436233300010361Tropical Forest SoilTVASSEASAWVCFATGLGSSGTARAYDIIDAKLFALRRCERNSPVPVCTLVWCRPGR*
Ga0126378_1095730323300010361Tropical Forest SoilARSYDIIDAKLFALRRCERNSPVPVCTLLWCRPGG*
Ga0134125_1270420213300010371Terrestrial SoilGLGSGGWARSYNVVDAKIWALRRCERGSPVPVCTILWCRPGG*
Ga0126381_10205510823300010376Tropical Forest SoilTVASSEASAWVCFATGLGSSGTARAYDIIDAKLFALRRCERDSPVPVCTLVWCRPGR*
Ga0134126_1208540213300010396Terrestrial SoilSEASAWVCFATGLGSGGYGRSYDVIDAKLFALRRCERNSPVPICTILWCRPGG*
Ga0137393_1042470733300011271Vadose Zone SoilGGWGRSYDIIDAKLFALRRCERNSPLPVCTILWCRPGG*
Ga0137383_1026441823300012199Vadose Zone SoilMASSEASAWVCYATGLGSGGFARAYDIIDAKLFALRRCERNSPVPVCTLLWCRPGR*
Ga0137365_1135654023300012201Vadose Zone SoilEASAWVCYATGLGSSGAARAYDIIDAKLFALRRCERNSPLPICTILWCRPGR*
Ga0137374_1026954023300012204Vadose Zone SoilMASSEASAWVCYATGLGSGGFARAYDIIDAKLFALRRCERNSPLPVCTLLWCRPGR*
Ga0137362_1062402513300012205Vadose Zone SoilMASSEASAWVCYATGLGSSGFARAYDIIDAKLFALRRCERNSPLPVCTLLWCRPGR*
Ga0137380_1018368423300012206Vadose Zone SoilMATSEASAWVCYATGLGSGGFARAYDIIDAKLFALRRCERNSSVPVCTLLWCRPGR*
Ga0137379_1142709923300012209Vadose Zone SoilGSGTYDIIDAKLFALRRCERNSPVPVCTLLWCRPGH*
Ga0137378_1064101923300012210Vadose Zone SoilARAYDIIDAKLFALRRCERNSPVPVCTLLWCRPGR*
Ga0137377_1009623343300012211Vadose Zone SoilFARAYDIIDAKLFALRRCERNSPVPVCTLLWCRPGR*
Ga0137372_1014058813300012350Vadose Zone SoilARAYDIIDAKLFALRRCERNSPLPVCTLLWCRPGR*
Ga0137386_1027954823300012351Vadose Zone SoilMATSEASAWVCYATGLGSGGFARAYDIIDAKLFALRRCERNSPVPVCTLLWCRPGR*
Ga0137366_1087643623300012354Vadose Zone SoilMATSEASAWVCYATGLGSGGIARAYDIIDAKLFALRRCERNSSVPVCTLLWCRPGR
Ga0137369_1034169823300012355Vadose Zone SoilGFARAYDIIDAKLFALRRCERNSPLPVCTLLWCRPGR*
Ga0137360_1071288623300012361Vadose Zone SoilMASSEASAWVCYATGLGSSGFARAYDIIDAKLFALRRCERNSPLPVCTLL
Ga0137361_1016175913300012362Vadose Zone SoilAWVCYATGLGSGGFARAYDIIDAKLFALRRCERNSPLPVCTILWCRPGR*
Ga0157339_106616513300012505Arabidopsis RhizosphereATGLGSGASARSYSIIDAKLWALRRCERGSPLPVCTILWCRPGG*
Ga0137373_1033737613300012532Vadose Zone SoilMATSEASAWVCYATGLGSGGFARAYDIIDAKLFALRRCERNSPVPVCTLFWCRPGR*
Ga0137397_1087231823300012685Vadose Zone SoilEASAWVCRAAGLGSGGLGRSYSIIDAKLLALRRCEHYSPLPVCTILWCRPGG*
Ga0137395_1101683413300012917Vadose Zone SoilMASSEASAWVCRAAGLGSGGLGRSYSIIDAKLLALRRCEHYSPLPVCTILWCRPG
Ga0164307_1061849513300012987SoilRSYNVVDAKIWALRRCERNSPVPVCTILWCRPGG*
Ga0157375_1297216413300013308Miscanthus RhizosphereASAWVCRAAGLVSGGWARSVSVVDAKIWALRRCERNSPVPVCTILWCRPGG*
Ga0157377_1085389823300014745Miscanthus RhizosphereEASAWVCRAAGLGSGGWARSVNVVDAKIWALRRCERGSPVPVCTILWCRPGG*
Ga0173483_1028593213300015077SoilGWARSVNVVDAKIWALRRCERGSPVPVCTILWCRPGG*
Ga0137409_1045673813300015245Vadose Zone SoilARSYSIIDAKLLALRRCERHSPVPVCTLLWCRPY*
Ga0132255_10206743413300015374Arabidopsis RhizosphereGWARSYSIIDAKLMALRRCEHHSPVPVCTILWCRPGF*
Ga0132255_10579445523300015374Arabidopsis RhizosphereRSVSVVDAKIWVLRRCERNSPVPVCTILWCRPGG*
Ga0182041_1075480313300016294SoilARAYDIIDAKLFALRRCERNSPVPLCTLVWCRPGR
Ga0182034_1159038223300016371SoilLGSSGRARSYDIIDAKLFALRRCERNSPVPVCTLLWCRPGG
Ga0163161_1181129813300017792Switchgrass RhizosphereSSEASAWVCRAVGIGSGGYGRSFSVIDAKLIALRRCENYSPIPVCTILWCRPGG
Ga0066662_1297248823300018468Grasslands SoilEASAWVCLATGLGSGGYGRSYDIIDAKLFALRRCERNSPVPICTILWCRPGG
Ga0173482_1015679323300019361SoilGLGSGGWARSYNVVDAKIWALRRCERGSPVPVCTILWCRPGG
Ga0193747_114940223300019885SoilSAWVCFATGLGSGGYGRSYDVIDAKLFALRRCERNSPVPICTILWCRPGG
Ga0193718_110198813300019999SoilRAVGLSSGGYGRNFSVIDAKLIALRRCENYSPIPVCTILWCRPDG
Ga0193699_1020925423300021363SoilVCRAVGLGSGGWGRSYSVIDAKLIALRRCENYSPLPVCTILWCRPGG
Ga0210384_1130331213300021432SoilASSEASAWVCFATGLGSGGYGRHYDIIDAKLFALRRCERNSPVPICTILWCRPGG
Ga0213878_1005147523300021444Bulk SoilCFATGLGSSGRARSYDIIDAKLFALRRCERNSPVPICTLLWCRPGG
Ga0126371_1043753623300021560Tropical Forest SoilATGLGSGGYARAYDIIDAKLFALRRCERGSPVPVCTLLWCRPGR
Ga0222622_1060223823300022756Groundwater SedimentVGLGSCGYGRSFSVIDAKLIALRRCENYSPIPVCTILWCRPGG
Ga0207647_1022415013300025904Corn RhizosphereGSGGYGRSFSVIDAKLIALRRCENYSPIPVCTILWCRPGG
Ga0207699_1011962823300025906Corn, Switchgrass And Miscanthus RhizosphereASSEASAWVCLATGLGSGGYGRSYDIIDAKLFALRRCERNSPVPICTILWCRPGG
Ga0207684_1169065113300025910Corn, Switchgrass And Miscanthus RhizosphereGSSGRARSYDIIDAKLFALRRCERNSPVPICTLLWCRPGG
Ga0207654_1051799213300025911Corn RhizosphereGGWARSYNVVDAKIGALRRCERGSPVPVCTILWCRPGG
Ga0207646_1033536313300025922Corn, Switchgrass And Miscanthus RhizosphereSGRARSYDIIDAKLFALRRCERNSPVPICTLLWCRPGG
Ga0207659_1059035523300025926Miscanthus RhizosphereGASSEASAWVCRAAGLGSGGWARSVNVVDAKIWALRRCERGSPVPVCTILWCRPGG
Ga0207686_1128621613300025934Miscanthus RhizosphereGGWARSVNVVDAKIWALRRCERGSPVPVCTILWCRPGG
Ga0207640_1137885513300025981Corn RhizosphereEASAWVCRAAGLGSGGWARSVNVVDAKIWALRRCERGSPVPVCTILWCRPGG
Ga0209266_117033923300026327SoilMGRILASLVVGGWGRSYSIIDAKLWALRRCEHYSPLPICTILWCRPGG
Ga0209473_120686923300026330SoilSGGYGRSYDIIDAKLFALRRCERNSPVPVCTILWCRPGG
Ga0209156_1006208733300026547SoilYGRSYDIIDAKLFALRRCERNSPVPVCTILWCRPGG
Ga0208988_104715813300027633Forest SoilGWGRSYSVIDAKLIALRRCENYSPLPVCTILWCRPGG
Ga0209588_103738213300027671Vadose Zone SoilSAWVCFATGLGSSGRARSYDIIDAKLFALRRCERNSPVPICTLLWCRPGG
Ga0209465_1015401013300027874Tropical Forest SoilSLVTSEASAYVCFATGVGSSGGGRSYSIIDAKLIALRRCEHHSPVPICTILWCRPGY
Ga0209465_1058072813300027874Tropical Forest SoilSAWVCFATGLGSGGYGRSYDIIDAKLFALRRCERNSPVPVCTILWCRPGG
Ga0209275_1069854723300027884SoilARSYDIIDAKLFALRRCERNSPVPVCTLLWCRPGG
Ga0209488_1015655953300027903Vadose Zone SoilSGGMGRSATVAGAKFQALRRCEHRGPVPVCTILWCRPGG
Ga0209526_1000899313300028047Forest SoilARSYDIIDAKLFALRRCERNSPVPICTLLWCRPGG
Ga0307280_1001220533300028768SoilGLGSGGWARSVSVVDAKIWALRRCERNSPVPVCTILWCRPGG
Ga0307281_1030236513300028803SoilASSEASAWVCRAVGIGSGGYGRSFSVIDAKLIALRRCENYSPIPVCTILWCRPGG
Ga0307310_1028554423300028824SoilSAWVCRAVGIGSGGYGRSFSVIDAKLIALRRCENYSPIPVCTILWCRPGG
Ga0307312_1038520123300028828SoilTGLGSGGYGRSYDVIDAKLFALRRCERNSPVPICTILWCRPGG
Ga0307501_1001653113300031152SoilLGSGGWARNVSVVDAKIWALRRCERNSPVPVCTILWCRPGG
Ga0307496_1006018013300031200SoilVGLGSGGYGRSFSVIDAKLIALRRCENYSPIPVCTILWCRPGG
Ga0318516_1014526723300031543SoilSEASAWVCYASGLGTRGYARAYDIIDAKLFALRRCERYSPVPVCILVWCRPGG
Ga0318561_1006892613300031679SoilRARSYDIIDAKLFALRRCERNSPVPVCTILWCRPGG
Ga0306917_1062157123300031719SoilATGLGSSGFARAYDIIDAKLFALRRCERNSPVPVCTLLWCRPGR
Ga0318502_1002577413300031747SoilEASAWVCYATGLGSGGYARAYDIIDAKLFALRRCERGSPVPVCTLLWCRPGR
Ga0318492_1001833543300031748SoilGGYARAYDIIDAKLFALRLCERGSPVPVCTLLWCRPGR
Ga0318494_1040503613300031751SoilFATGLGSSGRARSYDIIDAKLFALRRCERNSPVPVCTILWCRPGG
Ga0318535_1001183613300031764SoilAASSEASAWVCFATGLGSSGRARSYDIIDAKLFALRRCERNSPVPVCTILWCRPGG
Ga0318566_1050595313300031779SoilSSEASAWVCFATGLGSSGRARSYDIIDAKLFALRRCERNSPVPVCTILWCRPGG
Ga0318557_1055193923300031795SoilLTLTTSEASAWVCYATGLGTRGYARAYDIIDAKLFALRRCERYSPVPVCILVWCRPGG
Ga0318550_1002612813300031797SoilYATGLGSGGYARAYDIIDAKLFALRRCERGSPVPVCTLLWCHPGR
Ga0318565_1003997413300031799SoilTGLGSSGRARSYDIIDAKLFALRRCERNSPVPVCTILWCRPGG
Ga0318497_1006372413300031805SoilARSYDIIDAKLFALRRCERNSPVPVCTILWCRPGG
Ga0318495_1002676213300031860SoilLAAASSEASAWVCFATGLGSSGRARSYDIIDAKLFALRRCERNSPVPVCTILWCRPGG
Ga0310885_1091370213300031943SoilSAWVCRAAGLGSGGWARSVNVVDAKIWALRRCERGSPVPVCTILWCRPGG
Ga0318563_1032617913300032009SoilSGRARSYDIIDAKLFALRRCERNSPVPVCTILWCRPGG
Ga0318545_1013733713300032042SoilLQEIEDAVGPGGWGRNYSIIDAKLSALRRCERNSPLPVCTIVWCRPGP
Ga0318570_1039909913300032054SoilVCYATGLGTRGYARAYDIIDAKLFALRRCERYSPVPVCILVWCRPGG
Ga0318514_1005245613300032066SoilASSEASAWVCFATGLGSSGRARSYDIIDAKLFALRRCERNSPVPVCTILWCRPGG
Ga0318553_1010784113300032068SoilSEASAWVCFATGLGSSGTARAYDIIDAKLFALRRCERNSPVPVCTLVWCRPGR
Ga0318553_1043113223300032068SoilASSEASAWVCFATGLGSSGRARSYDIIDAKLFALRRCERNSPVPVCTLLWCRPGG
Ga0318525_1006416513300032089SoilATGLGSSGRARSYDIIDAKLFALRRCERNSPVPVCTILWCRPGG
Ga0310895_1023748823300032122SoilSGGWARSYNVVDAKIWALRRCERNSPVPVCTILWCRPGG
Ga0307471_10171643913300032180Hardwood Forest SoilLSLATSEASAAWVCQAAGVGSGGWAHSYSIIDAKLIALRRCEHHSPVPMCTILWCRPGY
Ga0307471_10199331223300032180Hardwood Forest SoilTGLGSSGRARSYDIIDAKLFALRRCERNSPVPICTLLWCRPGG
Ga0307472_10133577713300032205Hardwood Forest SoilWAHSYSIIDAKLIALRRCEHHSPVPMCTILWCRPGY
Ga0335085_1120772813300032770SoilYVCHATGLGSGGWARSYSIIDAKLIALRRCEHHSPVPVCTILWCRPGY


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.